Dataset for protein BCL-2-like of organism Cyanoderma ruficeps

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .  :  *                         .:                                
------mfyynrelvidyvsY-----------------------klsqsgy-w-a-e-rae-p--l-g--aa--g-----
mamptrrysvvyyiaqkfnq cggapalspggpgerpepaaaagvsqer--s-s-l-e---p-tg-s-pg--vr-vssgs
  hegaegaskpka lg ll                        a e prdrsgqgpdedpnrrdfiveedepdatlndh
         d        ih                            k  d a a a   l pa a ca  aa ligcg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--l--p--e--g-a------pa-hlrpat---------------------------------------------------
tt-ws-ts-pv-s-tvsqss--vgslrrqppgppdglrqdslelisrylrevageaepaskklfpgllggpgrpgaagda
pswvr hphlpngepephrpleedei gp                                                   
ag ha ee id c aaheag  a  g  a                                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .  .**  .. .  .    :  :  .: :      .  .  *    * ** .****::::: **. :         
--tvvrrvLRtigdefsrryerafsqmlsqlhitpvtayqs-fvqVveelFsDG-vNWGRivtffsFGgvlcvesvvrem
vmqralqt  raassvqlqtrldlrpltrriqlqssevrsrivng mnhk r  vt    vmalit  alvtkklqskkv
  ek hla    glmdkhqe  qg sgk d  qfadlk   ee aa      n        i e   fma h knigq
  ad ae             ad  d      e  a     a                        a      eh  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       . :   :*  :      *:: :***:  *:  :                      . :::   : .     : 
svlv---ssiaywmTeylvshlseWiqsnGGWer-Fvdlygn--------------------kwllsfatvaglltlgay
rqtieekkrlvsii taitrskrp leeq   dng ltkfrvsmlegvrrgrptfnfswislrvimtlvlitavilsvss
qpsa   ee sgf   nnn hn  dd       ef erndaaesik qel d      nt  agsk g cgial l
el     d   a      id  d    a            ea                   s     g     a    

      
....:.
: .   
lsrk--
mih-yy
 g e  
 f    
© 1998-2022Legal notice