Dataset for protein BCL-2-like of organism Cyanoderma ruficeps

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3QRB8_MCL1-01      ------MFAVKPKAVIGFNLYCGGAPALSPGGPGERPEPAAAAGASEQPR
A0A8C3NVU4_BCL2A1-      --METAEFYYVYYLAQDYLQY-----------------------VLQES-
A0A8C3QX54_BCL2-01      MAHPGRRGYDNREIVLKYIHY-----------------------KLSQRG
A0A8C3XCF2_BCL2L1-      ------MYSSNRELVIDFVSY-----------------------KLSQKG
                                      .  :  *                         .:  

A0A8C3QRB8_MCL1-01      DRSGAAPARAEPPRALIGCGAAPRALIGCGATLWRPEEELDGCEPEPERG
A0A8C3NVU4_BCL2A1-      --------------------------------------------------
A0A8C3QX54_BCL2-01      YDWAAGEDRAPLPPGLSVPAAAAAGTSSDHTGLVSPHPEPPGSAAASHAP
A0A8C3XCF2_BCL2L1-      YSWSQLEEEDENRTDFAGEEDEVDGVLNGSPSWHAPTSHIVNGATVHQSS
                                                                          

A0A8C3QRB8_MCL1-01      PAADSLPGTPPGPPDGLRQDSLELISRYLREVAGEAEPASKKLFPGLLGG
A0A8C3NVU4_BCL2A1-      ---HLGPAQ-----------------------------------------
A0A8C3QX54_BCL2-01      PAEGLRPAP-----------------------------------------
A0A8C3XCF2_BCL2L1-      LEVHEIRRA-----------------------------------------
                                                                          

A0A8C3QRB8_MCL1-01      PGRPGAAGDAVMEKALETLRRIGDGVMRKHELAFQGMLRKLQIQQEEDLQ
A0A8C3NVU4_BCL2A1-      ------------TRVARVLRTIASSLQDQTEEALRPLLDRIDITSVAVAK
A0A8C3QX54_BCL2-01      ------------QVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARS
A0A8C3XCF2_BCL2L1-      ------------ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQ
                                      .  .**  .. .  .    :  :  .: :      .

A0A8C3QRB8_MCL1-01      S-VVEVAAHLFSDGVTNWGRVVTLISFGAFVAKHLKSIKQEQSI---SSL
A0A8C3NVU4_BCL2A1-      RIFNGVMEEKFSDGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEI
A0A8C3QX54_BCL2-01      R-FVAVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLV---DSI
A0A8C3XCF2_BCL2L1-      S-FEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVVKEMRVLV---KRI
                          .  *    * ** .****::::: **. :                . :

A0A8C3QRB8_MCL1-01      AGIITDALVSSKREWLESQGGWEG-FVDFFRVEDLEGSIR----------
A0A8C3NVU4_BCL2A1-      SYFITEYIINNKSEWIDANGGWENGFLTKFER------------------
A0A8C3QX54_BCL2-01      AAWMTEYLNRHLHNWIQDNGGWDA-FVELYGNSM-------RPLFDFSWI
A0A8C3XCF2_BCL2L1-      VSWMTTYLTDHLDPWIQENGGWER-FVDLYGNNAAAEVRKGQETFN----
                           :*  :      *:: :***:  *:  :                    

A0A8C3QRB8_MCL1-01      --NVLMAFAGVAGLGASLAYMIR---
A0A8C3NVU4_BCL2A1-      --RSLLSFSKITALLIAVASLFREYY
A0A8C3QX54_BCL2-01      SLKTILSLVLVGACITLGAYLGHK--
A0A8C3XCF2_BCL2L1-      --KWLLTGATVAGVLLLGSLLSRK--
                          . :::   : .     : : .   

© 1998-2022Legal notice