Dataset for protein BCL-2-like of organism Chrysolophus pictus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :. .:: * *.:                                                       
------rsyynrelvqdyvsYkLsqsgygw---e---------a--a----v-----s-h----p-g------------l
mamptrmgsrvyyialkflq v qerhld-sel-erppvrtdt-pt-epts-lngsp-w-hrpp-p-svvnsevvprss-
  hegaef d     i  ih     k hc aag dedenppal ae amda aaaga s    e a haaagatphaeg 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        . *  .**: ...:. .    :  : ..: :*.  .    *  *::* * ** .*****:::* *** :  :
-----paqtrVrqaLRqagdefsrryrrafsqmtsqlhiTpvtayqr-FvqVveElFrDG-vNWGRIvafFtFGGvlcve
svheivrpsg hlv  niasslqlqtqedlrplsgridl sgdvhksi ng mn k h  nt     mti s   lmtkk
e      apd ah   d     ed  e   adfl      ag   ea      a             e   a    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :. :        .*  ::* *:  :   **: ****:  *:  : .     :           ::   ..    :   
svnremsvl---vgrIvywmTeYltrhlhpWIqeNGGWer-Fvtlygnssrpsfs---------tltlvtvavvsllgsy
lqekgvrptgeekeq stfi t innnkdn  dd    dng lekferrmplllrkswitlntwlisgilaggfltfrel
  dh  ql     dn as      id  aa   a          naaae dfgqesfkk i  daf  aci   a 

    
....
    
l--k
ysr-
 gh 
© 1998-2022Legal notice