Dataset for protein BCL-2-like of organism Chrysolophus pictus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3KTI3_BCL2A1-      --METAEFYYVYYLAQDYLQYVLQESHLG---------------------
A0A8C3LBC4_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPTAAPT
A0A8C3LRK6_BCL2L1-      ------MSSRNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMD
                                     :. .:: * *.:                         

A0A8C3KTI3_BCL2A1-      -----------------------------------PAQTRVAHVLRNIAS
A0A8C3LBC4_BCL2-01      AVAAAGASSHHRPEPPGSAAASEVPPAEGLS----PAPPGVHLALRQAGD
A0A8C3LRK6_BCL2L1-      SVLNGSPSWH---PPAGHVVNGATVHRSSLEVHEIVRASDVRQALRDAGD
                                                              . *  .**: ..

A0A8C3KTI3_BCL2A1-      SLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTNWGRIMTI
A0A8C3LBC4_BCL2-01      EFSRRYQRDFAQMSGQLHLTPFTAHGR-FVAVVEELFRDG-VNWGRIVAF
A0A8C3LRK6_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNELFHDG-VNWGRIVAF
                        .:. .    :  : ..: :*.  .    *  *::* * ** .*****:::

A0A8C3KTI3_BCL2A1-      FTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWEN
A0A8C3LBC4_BCL2-01      FEFGGVMCVESVNREMSPL---VDNIATWMTEYLNRHLHNWIQDNGGWDA
A0A8C3LRK6_BCL2L1-      FSFGGALCVESVDKEMRVL---VGRIVSWMTTYLTDHLDPWIQENGGWER
                        * *** :  :  :. :        .*  ::* *:  :   **: ****: 

A0A8C3KTI3_BCL2A1-      GFLTKFERRSPLSFS---------TITDIFAAVFSLFREYY---
A0A8C3LBC4_BCL2-01      -FVELYGNSMRPLFDFSWISLKT-ILSLVLVGACITLGAYLGHK
A0A8C3LRK6_BCL2L1-      -FVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
                         *:  : .     :           ::   ..    :       

© 1998-2022Legal notice