Dataset for protein BCL-2-like of organism Cebus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------g---g-g-g-----------------------------------
hlsslpliaarmatpasapmfgaqraaviglnlycg-yvc-a-p-sggatppggrllatekeasaqrevgggeagavigg
                   dtrllvndfvaykgrqk aga l a rrrhlvgrhqamra          a d feegapr
                     m aa  aa aa aa    r s s gatppg l                      trfr 
                                       l     e p ad                             
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
svgdspqaaltpdarrvvrpppigyelsqvgatpsrllffaptrreapleemeapaifadaimspeseldgyepeplgkr
gasamspslrvtygnaelvvdflsakvpdktyeweqfsdveenvtaseegtarprv  tssepetpeainpnpswheees
tf  laaqgh gpds qqmmtyyrngteseelsyleyvsrpgptp p pappp ag  spqalhagpvskerg qerade
                 i fkqvhqr frrvpn gd clef geg     a       pggpgg  gpngapd vvgtvq
                   a    d    l  d d   a   d               f    c   gaa m  la qsp
                             g                                                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
p------------------------------e----------------------------p---sg-a-------lrrag
-avvpllelvgapgngsstdgslpstparvr-teeelyrqsleklsrlwrevatgakdtk-mgr--p-srkaletimsve
eglley  trletwhsailpaeeeapkppaeqmdd fgyihaliikeyqnvqekqmnmsp pknaravqkvlhsvqkpil
 wpna     addadh tggprsviim a kme s      n tqdymlyllqipqsglg s te vladp fqam acv
 smp          ia  e wl  v   v hla                     krt  r          g irrw eta
              a                                                              qp 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .                                    .    .                                   
dgverryrrafsg----lhitpgdavqsfeqvmehlfsdG--vnwgrivaffyfggal----------------------
eefq-nhet--qdmlsq----nvtyyktlsrlvvevhrcsvgttrvtlltlkssea--gfayiefsdkesvrtslaldes
pkmna---siy--ltrkvdvkiendrarate-entfpgg s pr ----cdif--hpk                 lergp
an stda -t veyaay ils-ds-gti-a-msa-elqr p i   nv -i-a a-iv                      
 s rlvf  f aawvgg     --rq--v-t -da  e  i r      m-lv   vm                      
 d lk    d    sc      f  -gl    a-   c              -   t                       
                          e                         e   f                       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      .   .  :                  
---------------------ciesvtkemgplvs----ia-wmatylvrtlrdwiqrsggw------------------
lfrgrqikwgvqsrlyssltqvvplrqnrpqvstttykr--f-rtrvrndhtnynlvknrfyvstrrgtrggmgtreglt
 vvakhl vdfkafikepegntknklnciielded   drgepi-e-iatrkep sseq s                   
  t  wk              iakqedrnepicsg   qvsafvvdr-mnn-ge -rs                      
                     ---hqselvasare   elqys- -  e--ha-  hq                      
                     asrdkkiaqsf ic   p  l c a  -gq -t  --                      
                       h     a        n             ha  ed                      
                                                         a                      

       410       420       430       440       450       460      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                  
---------------dgfvelygg-al-g-rr--e--s-w------fl------------------
hvprwlllllqdlllst-nsrprvr--ees--gtswfnp-vsvrrt--gvvavgavvllgslfsrk
               aei--ffhnnvyr-rakar-rygnyaltltwlatgmtlkglrtvslfyasy
               tn ta----edaavgvvnqplk-gtwtsvmvvtefllkarrqs aaylqyr
               gk snkiadgmfp aiclvlphlasrnqplarvsaagrlpkmm   akli 
               fa m    psg   md ss idhrlhalmgsgkrytpqikel      gh 
               e       lp    f  kf  aflif iikn  issi  cck         
                                     dfgd gg m  al     ai         
© 1998-2021Legal notice