Dataset for protein BCL-2-like of organism Cebus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5R5C4_MCL1-04      -------------------MFGLQRNAVIGLNLYCGGAGLGAGSGGATPP
A0A2K5RUN8_BCL2L2-      HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVCGAGPG-----
A0A2K5RUN8_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG-----
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5PP81_BCL2-01      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      -----------MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAA
A0A2K5RUN8_BCL2L2-      ---------------------MAAAAAAAAAAGAAGG--RGSGPGRRRHL
A0A2K5RUN8_BCL2L2-      ---------------------MAAAAAAAAAAGAAGG--RGSGPGRRRHL
A0A2K5R5C4_MCL1-03      -------------------MFGLQRNAVIGLNLYCGG--AGLGAGSGGAT
A0A2K5R5C4_MCL1-02      -------------------MFGLQRNAVIGLNLYCGG--AGLGAGSGGAT
A0A2K5R5C4_MCL1-01      -------------------MFGLQRNAVIGLNLYCGG--AGLGAGSGGAT
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5R5C4_MCL1-04      GGR-----------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RIU7_BCL2L10      ------------------------------------------------MA
A0A2K5PP81_BCL2-01      ----------------------------------MAQAGRTGYDNREIVM
A0A2K5Q6R6_BCL2L1-      ----------------------------------MSQS------NRELVV
A0A2K5Q6R6_BCL2L1-      ----------------------------------MSQS------NRELVV
A0A2K5RUN8_BCL2L2-      DPLHQAMRA----------AGDEFETRFRRTFSDLAAQLHVTPGSAQQRF
A0A2K5RUN8_BCL2L2-      VPG----------------AGGEAGEGAPGGAGD----------------
A0A2K5RUN8_BCL2L2-      VPG----------------AGGEAGEGAPGGAGD----------------
A0A2K5R5C4_MCL1-03      PPGGRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRP
A0A2K5R5C4_MCL1-02      PPGGRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRP
A0A2K5R5C4_MCL1-01      PPGGRLLATEKEASAQREVGGGEAGAVIGGSVGASPPAALTPDARRVVRP
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5R5C4_MCL1-04      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RIU7_BCL2L10      DPLRQRTERLVADYLEYCSREPGTPESPPATAEAAV--------------
A0A2K5PP81_BCL2-01      KYIHYKLSQRGYEWD-----AGDVGAAPPGAAPAPGIFSSQPGHTPGPAA
A0A2K5Q6R6_BCL2L1-      DFLSYKLSQKGYSWSQFSDVEENRTEAPEG--------TDSEMETPSAIN
A0A2K5Q6R6_BCL2L1-      DFLSYKLSQKGYSWSQFSDVEENRTEAPEG--------TDSEMETPSAIN
A0A2K5RUN8_BCL2L2-      TQVSDELFQGGPNWGRLVAFF--------------V--FGAALCAESVNK
A0A2K5RUN8_BCL2L2-      --YGNGLESEELEPEELLLEPEPEPEPEEEPPRPRA--PPGAPGPGPGSG
A0A2K5RUN8_BCL2L2-      --YGNGLESEELEPED----------------------------------
A0A2K5R5C4_MCL1-03      PPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPA--ADAIMSPEEELD
A0A2K5R5C4_MCL1-02      PPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPA--ADAIMSPEEELD
A0A2K5R5C4_MCL1-01      PPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPA--ADAIMSPEEELD
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5R5C4_MCL1-04      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RUN8_BCL2L2-      --------------------------------------------------
A0A2K5RIU7_BCL2L10      --------------------------------------------------
A0A2K5PP81_BCL2-01      PRDPVARTSPPSPP------AAPAAAATGPALSPVP-PVVHLT-------
A0A2K5Q6R6_BCL2L1-      GNPSWHLADSPAVN------GATGHSSSLDAREVIPMAAVKQA-------
A0A2K5Q6R6_BCL2L1-      GNPSWHLADSPAVN------GATGHSSSLDAREVIPMAAVKQA-------
A0A2K5RUN8_BCL2L2-      EMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEE----
A0A2K5RUN8_BCL2L2-      APGSQEEEEEPGLVE-----GDPGDGAIEDPELEAIKARVREMEEE----
A0A2K5RUN8_BCL2L2-      ----QEEEEEPGLVE-----GDPGDGAIEDPELEAIKARVREMEEE----
A0A2K5R5C4_MCL1-03      GYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSLPSTPPPAEEEEDELYRQ
A0A2K5R5C4_MCL1-02      GYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSLPSTPPPAEEEEDELYRQ
A0A2K5R5C4_MCL1-01      GYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSLPSTPPPAEEEEDELYRQ
A0A2K5Q6R6_BCL2L1-      --------------------------------------------------
A0A2K5PYQ3_BCL2A1-      -----------------------------------------MTDSEFGYI
A0A2K5PYQ3_BCL2A1-      -----------------------------------------MTDSEFGYI
                                                                          

A0A2K5R5C4_MCL1-04      ----------LLATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETA
A0A2K5RUN8_BCL2L2-      ------------------------EGPAADPLHQAMRAAGDEFETRFRRT
A0A2K5RUN8_BCL2L2-      ------------------------EGPAADPLHQAMRAAGDEFETRFRRT
A0A2K5RIU7_BCL2L10      -----------------------------------LRATAAGVRKVYRSF
A0A2K5PP81_BCL2-01      -----------------------------------LRQAGDDFSRRYRRD
A0A2K5Q6R6_BCL2L1-      -----------------------------------LREAGDEFELRYRRA
A0A2K5Q6R6_BCL2L1-      -----------------------------------LREAGDEFELRYRRA
A0A2K5RUN8_BCL2L2-      -AEKLKELQNEVEKQMNMSPPPGNAGPV-------IMSIEEKMEADARSI
A0A2K5RUN8_BCL2L2-      -AEKLKELQNEVEKQMNMSPPPGNAGPV-------IMSIEEKMEADARSI
A0A2K5RUN8_BCL2L2-      -AEKLKELQNEVEKQMNMSPPPGNAGPV-------IMSIEEKMEADARSI
A0A2K5R5C4_MCL1-03      SLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETA
A0A2K5R5C4_MCL1-02      SLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETA
A0A2K5R5C4_MCL1-01      SLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETA
A0A2K5Q6R6_BCL2L1-      -------MW-----KRTGLRP-------QKGLIRRWRPPVPSML------
A0A2K5PYQ3_BCL2A1-      HNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVN------
A0A2K5PYQ3_BCL2A1-      HNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVN------
                                                                  .       

A0A2K5R5C4_MCL1-04      FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNWGRIVTLIYFGAFV--
A0A2K5RUN8_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAAL--
A0A2K5RUN8_BCL2L2-      FSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAAL--
A0A2K5RIU7_BCL2L10      FSAYLGY----PGNRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTL--
A0A2K5PP81_BCL2-01      FAEMSSQLHLTPFTARGRFATVVEELFRDG--VNWGRIVAFFEFGGVM--
A0A2K5Q6R6_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGAL--
A0A2K5Q6R6_BCL2L1-      FSDLTSQLHITPGTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGAL--
A0A2K5RUN8_BCL2L2-      YVG--------NVDYGATAEELEAHFHGCGS-VNRVTILCDKFSGHPKGF
A0A2K5RUN8_BCL2L2-      YVG--------NVDYGATAEELEAHFHGCGS-VNRVTILCDKFSGHPKGF
A0A2K5RUN8_BCL2L2-      YVG--------NVDYGATAEELEAHFHGCGS-VNRVTILCDKFSGHPKGF
A0A2K5R5C4_MCL1-03      FQGWVCGV-----------------LPCRGP-RRW---------------
A0A2K5R5C4_MCL1-02      FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNWGRIVTLIYFGA----
A0A2K5R5C4_MCL1-01      FQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNWGRIVTLIYFGA----
A0A2K5Q6R6_BCL2L1-      --------HITPGTAYQSFEQVVNELFRDG--VNWGRIVAFFSFGGAL--
A0A2K5PYQ3_BCL2A1-      --------IVSIDNARTIFSQVMETEFEDGI-INWGRIVTIFAFEGIL--
A0A2K5PYQ3_BCL2A1-      --------IVSIDNARTIFSQVMETEFEDGI-INWGRIVTIFAFEGIL--
                                                     .    .               

A0A2K5R5C4_MCL1-04      -----------------------------------------AKHLKTINQ
A0A2K5RUN8_BCL2L2-      -----------------------------------------CAESVNKEM
A0A2K5RUN8_BCL2L2-      -----------------------------------------CAESVNKEM
A0A2K5RIU7_BCL2L10      ---------------LERGPLVTARWKKWGFQSRLKEPEGNVSRDRQRLV
A0A2K5PP81_BCL2-01      -----------------------------------------CVESVNREM
A0A2K5Q6R6_BCL2L1-      -----------------------------------------CVESVDKEM
A0A2K5Q6R6_BCL2L1-      -----------------------------------------CVESVDKEM
A0A2K5RUN8_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIKVDVKAFIYSSLTQVIPKRTNRP
A0A2K5RUN8_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIK-------------VIPKRTNRP
A0A2K5RUN8_BCL2L2-      AYIEFSDKESVRTSLALDESLFRGRQIK-------------VIPKRTNRP
A0A2K5R5C4_MCL1-03      --------------------------------------------HQKCAA
A0A2K5R5C4_MCL1-02      ---------------------FVAKHLK-------------TINQESCIE
A0A2K5R5C4_MCL1-01      ---------------------FVAKHLK-------------TINQESCIE
A0A2K5Q6R6_BCL2L1-      -----------------------------------------CVESVDKEM
A0A2K5PYQ3_BCL2A1-      -----------------------------------------IKKLLQERI
A0A2K5PYQ3_BCL2A1-      -----------------------------------------IKKLLQERI
                                                                          

A0A2K5R5C4_MCL1-04      ESCIE---PLAESITDVLVRTKRDWLVKQRGW------------------
A0A2K5RUN8_BCL2L2-      EPLVG---QVQEWMVAYLETRLADWIHSSGGW------------------
A0A2K5RUN8_BCL2L2-      EPLVG---QVQEWMVAYLETRLADWIHSSGGW------------------
A0A2K5RIU7_BCL2L10      GLLSS-----------RLVGQHRAWLEAQGGWVSTRRGTRGGMGTREGLT
A0A2K5PP81_BCL2-01      SPLVD---NIALWMTEYLNRHLHTWIQDNGGW------------------
A0A2K5Q6R6_BCL2L1-      QVLVS---RIAAWMATYLNDHLEPWIQENGGW------------------
A0A2K5Q6R6_BCL2L1-      QVLVS---RIAAWMATYLNDHLEPWIQENGGW------------------
A0A2K5RUN8_BCL2L2-      GISTT---DRGFPRARYRARTTNYNSSRSRFY------------------
A0A2K5RUN8_BCL2L2-      GISTT---DRGFPRARYRARTTNYNSSRSRFY------------------
A0A2K5RUN8_BCL2L2-      GISTT---DRGFPRARYRARTTNYNSSRSRFY------------------
A0A2K5R5C4_MCL1-03      GFCRC--------C----------W---SRSW------------------
A0A2K5R5C4_MCL1-02      PLAES--------ITDVLVRTKRDWLVKQRGW------------------
A0A2K5R5C4_MCL1-01      PLAES--------ITDVLVRTKRDWLVKQRGW------------------
A0A2K5Q6R6_BCL2L1-      QVLVS---RIAAWMATYLNDHLEPWIQENGGW------------------
A0A2K5PYQ3_BCL2A1-      APDVDTYKEISYFVAEYIMNNTGEWIRQNGGW------------------
A0A2K5PYQ3_BCL2A1-      APDVDTYKEISYFVAEYIMNNTGEWIRQNGGW------------------
                                                .   .  :                  

A0A2K5R5C4_MCL1-04      ---------------DGFVEFFHVEDL-------E--GGIRNVLLAFAGV
A0A2K5RUN8_BCL2L2-      ---------------AEFTALYGDGALEEARRLRE--GNWASVRTVLTGA
A0A2K5RUN8_BCL2L2-      ---------------AEFTALYGDGALEEARRLRE--GNWASVRTVLTGA
A0A2K5RIU7_BCL2L10      HVPRWLLLLLQDLLLTGIMEKIAGPGFPVMVVNSSIHLLLDTIIRSFKIF
A0A2K5PP81_BCL2-01      ---------------DAFVELYGPSM-------RPLFDFSWLSLKTLLSL
A0A2K5Q6R6_BCL2L1-      ---------------DTFVELYGNNAAAESRKGQERFN------RWFLTG
A0A2K5Q6R6_BCL2L1-      ---------------DTFVELYGNNAAAESRKGQERFN------RWFLTG
A0A2K5RUN8_BCL2L2-      ---------------SGFNSRPRGRVYRGRARATSWYSPY----------
A0A2K5RUN8_BCL2L2-      ---------------SGFNSRPRGRVYRGRARATSWYSPY----------
A0A2K5RUN8_BCL2L2-      ---------------SGFNSRPRGRVYRGRARATSWYSPY----------
A0A2K5R5C4_MCL1-03      ---------------FGISNKIAL--------------------------
A0A2K5R5C4_MCL1-02      ---------------DGFVEFFHVEDLEGGDCS---DHATVLQPGNRARF
A0A2K5R5C4_MCL1-01      ---------------DGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAY
A0A2K5Q6R6_BCL2L1-      ---------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGV
A0A2K5PYQ3_BCL2A1-      ---------------GK----------------------WHSLMLMLVES
A0A2K5PYQ3_BCL2A1-      ---------------EN-----------GFVKKFEPKSGW----MTFLEV
                                                                          

A0A2K5R5C4_MCL1-04      AGVGA----GLAYLIR
A0A2K5RUN8_BCL2L2-      VALGALVTVGAFFASK
A0A2K5RUN8_BCL2L2-      VALGALVTVGAFFASK
A0A2K5RIU7_BCL2L10      SPLLPAQL--------
A0A2K5PP81_BCL2-01      ALVGACITLGAYLGHK
A0A2K5Q6R6_BCL2L1-      MTVAGVVLLGSLFSRK
A0A2K5Q6R6_BCL2L1-      MTVAGVVLLGSLFSRK
A0A2K5RUN8_BCL2L2-      ----------------
A0A2K5RUN8_BCL2L2-      ----------------
A0A2K5RUN8_BCL2L2-      ----------------
A0A2K5R5C4_MCL1-03      ----------------
A0A2K5R5C4_MCL1-02      LLKKRKRS--------
A0A2K5R5C4_MCL1-01      LIR-------------
A0A2K5Q6R6_BCL2L1-      V-----LL-GSLFSRK
A0A2K5PYQ3_BCL2A1-      VAQKKRKM-AL-----
A0A2K5PYQ3_BCL2A1-      TGKICEML-SLLKQYY
                                        

© 1998-2021Legal notice