Dataset for protein Mcl-1 of organism Catagonus wagneri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************                                           
MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLaagkeataqrevgggeagaviggsagasppstpapdarrvarp
                                     -------------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spigaegpdvtatparlvffaptrlasppeemdspasdaimspeeeldgyepeplgkrpavlpllglveeassgpgtdgs
--------------------------------------------------------------------------------

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              **************************************************
lpstpppaeeeddelyrqsleiisrylreqATGAKDAKPMGGCGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
------------------------------                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************************************************  .* : 
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWd-gFvef
                                                                         vws knk

       330       340       350       360        
....:....|....:....|....:....|....:....|....:...
*:   **   **     :.***            *  * *:       
FhvedLEggiRNvllafagVAG-----------vGagLaYlir-----
 ysyv  qrr  r----ts   qsenstrwkksq lr r fpeafyfl
© 1998-2022Legal notice