Dataset for protein Mcl-1 of organism Catagonus wagneri

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3W949_MCL1-03      MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLL-------------
A0A8C3W949_MCL1-01      MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLAAGKEATAQREVG
A0A8C3W949_MCL1-02      MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLAAGKEATAQREVG
                        *************************************             

A0A8C3W949_MCL1-03      --------------------------------------------------
A0A8C3W949_MCL1-01      GGEAGAVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLVFF
A0A8C3W949_MCL1-02      GGEAGAVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLVFF
                                                                          

A0A8C3W949_MCL1-03      --------------------------------------------------
A0A8C3W949_MCL1-01      APTRLASPPEEMDSPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A8C3W949_MCL1-02      APTRLASPPEEMDSPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
                                                                          

A0A8C3W949_MCL1-03      ----------------------------------------ATGAKDAKPM
A0A8C3W949_MCL1-01      ASSGPGTDGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPM
A0A8C3W949_MCL1-02      ASSGPGTDGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPM
                                                                **********

A0A8C3W949_MCL1-03      GGCGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A8C3W949_MCL1-01      GGCGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
A0A8C3W949_MCL1-02      GGCGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRV
                        **************************************************

A0A8C3W949_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A8C3W949_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
A0A8C3W949_MCL1-02      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLV
                        **************************************************

A0A8C3W949_MCL1-03      RTKRDWLVKQRGWD-GFVEFFHVEDLEGGIRNVLLAFAGVAG--------
A0A8C3W949_MCL1-01      RTKRDWLVKQRGWVWSFKNKFYSYVLEQRRRNR----TSVAGQSENSTRW
A0A8C3W949_MCL1-02      RTKRDWLVKQRGWD-GFVEFFHVEDLEGGIRNVLLAFAGVAG--------
                        *************  .* : *:   **   **     :.***        

A0A8C3W949_MCL1-03      ---VGAGLAYLIR-----
A0A8C3W949_MCL1-01      KKSQGLRLRYFPEAFYFL
A0A8C3W949_MCL1-02      ---VGAGLAYLIR-----
                            *  * *:       

© 1998-2022Legal notice