Dataset for protein BCL-2-like of organism Catagonus wagneri

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                  . :.                                          
                       mmm-prmgqyt m  tkfvnavpq-k gvesqfsdveenrtes ggtpspgitsaqi
                        ahagnefgsi a  q akh   mgr  sc     a d   aa eaaeae efp a 
                         a d          m  ig        e                            

        90       100       110       120       130       140       150       160
ggn  paladp a                                                                   

       170       180       190       200       210       220       230       240
                                         . .              .:. ..  .. .    :     
                                   pt-t--ae ldls- i m  tsrv  e   s snqv kn kpcsd
                                   ngiaqh a   kde      lkl   d   d  l f  d ae a 
                                     g aa                    a                  

       250       260       270       280       290       300       310       320
:: :         :  *    * .*  ****:*:.: * . :       :    :     :   :.  :      *: ..
kfhvknigddrqrltq veel rg vv    l afiv egalaveskniemspcidtykriqysiatvinthkht lqsn
 lgs fs yii nt snke q  ip       v e   vmmak lrrqiqvd s   qvptfvvef tkrtgq  rqs
       d  qg    d   e   i         a   i      d   a   g   n  l      edn ep  h
                                                         e             a    

       330       340       350       360       370       380 
 **   *   :                                                  
r  vwt tnkyhpya-eesrrn--lfnf--a-lagv---va----vlt-raaf--rafyfl
   ens kkf yssvaaqriklvpg d sitt--tatlss-rwlvs-gvksrlss-     
   a e  a  enns  gg  gqlr   rfrn rlqsgnmvgmkklq a ql gre     
     a      dkm   a         n fg ke feklcel cci    f fp      
             g              a        a i aa          ah      
© 1998-2023Legal notice