Dataset for protein BCL-2-like of organism Catagonus wagneri

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3W949_MCL1-01      MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLAAGKEATAQREVG
A0A8C3W949_MCL1-02      MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLAAGKEATAQREVG
A0A8C3WEA1_BCL2A1-      -------------------------MTDNEFGYIHMLAQDYLNYVLQ---
A0A8C3WCN0_BCL2-01      -----------------------MAHAGRTGYDNREIVMKYIHYKLSQRG
A0A8C3WJH5_BCL2L1-      -----------------------------MSQSNRELVVDFLSYKLSQKG
A0A8C3W949_MCL1-03      MFGFKRNAVIGLNLYCGGAGLGPGSGSSASAPGGRLLATGAKDAKPMG--
A0A8C3X592_BCL2L2-      ------------------------MATPASAPDTRALVADFVGYKLRQKG
                                                          . :.            

A0A8C3W949_MCL1-01      GGEAGAVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLVFF
A0A8C3W949_MCL1-02      GGEAGAVIGGSAGASPPSTPAPDARRVARPSPIGAEGPDVTATPARLVFF
A0A8C3WEA1_BCL2A1-      --------------------------------------------------
A0A8C3WCN0_BCL2-01      YEW----DAGDAGAASPGAAPAPGIFSSQPGRTPAPARTSPPPP------
A0A8C3WJH5_BCL2L1-      YSWSQFSDVEENRTEAPEGTESEAETPSAINGNPSWHLADSPAV------
A0A8C3W949_MCL1-03      --------------------------------------------------
A0A8C3X592_BCL2L2-      YVC-----------------------------------------------
                                                                          

A0A8C3W949_MCL1-01      APTRLASPPEEMDSPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A8C3W949_MCL1-02      APTRLASPPEEMDSPASDAIMSPEEELDGYEPEPLGKRPAVLPLLGLVEE
A0A8C3WEA1_BCL2A1-      --------------------------------------------------
A0A8C3WCN0_BCL2-01      --------------------------------------------------
A0A8C3WJH5_BCL2L1-      --------------------------------------------------
A0A8C3W949_MCL1-03      --------------------------------------------------
A0A8C3X592_BCL2L2-      --------------------------------------------------
                                                                          

A0A8C3W949_MCL1-01      ASSGPGTDGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPM
A0A8C3W949_MCL1-02      ASSGPGTDGSLPSTPPPAEEEDDELYRQSLEIISRYLREQATGAKDAKPM
A0A8C3WEA1_BCL2A1-      -----------------------------------------------IPQ
A0A8C3WCN0_BCL2-01      ---------------------------------------------PTAPA
A0A8C3WJH5_BCL2L1-      ---------------------------------------------NGATG
A0A8C3W949_MCL1-03      --------------------------------------------------
A0A8C3X592_BCL2L2-      -----------------------------------------------GAG
                                                                          

A0A8C3W949_MCL1-01      GGCGAASRK------ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDD
A0A8C3W949_MCL1-02      GGCGAASRK------ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDD
A0A8C3WEA1_BCL2A1-      PGSGPSK--------TSRVLQDVAFSVQNQVEKNLKPCLDNFDVGSIDTA
A0A8C3WCN0_BCL2-01      AAAGPALSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTA
A0A8C3WJH5_BCL2L1-      HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTA
A0A8C3W949_MCL1-03      -GCGAASRK------ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDD
A0A8C3X592_BCL2L2-      PGEGPAADP------LHQAMRAAGDEFETRFRRTFSDLASQLHVTP-GSA
                         . .              .:. ..  .. .    :     :: :      

A0A8C3W949_MCL1-01      VKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE---P
A0A8C3W949_MCL1-02      VKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE---P
A0A8C3WEA1_BCL2A1-      RIIFNQVMEKEFEDGIINWGRIVTVFAFEGILMKKLLRKQIASDVDTYKE
A0A8C3WCN0_BCL2-01      RGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVD---N
A0A8C3WJH5_BCL2L1-      YQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVS---R
A0A8C3W949_MCL1-03      VKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE---P
A0A8C3X592_BCL2L2-      QQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVG---Q
                           :  *    * .*  ****:*:.: * . :       :    :     

A0A8C3W949_MCL1-01      LAESITDVLVRTKRDWLVKQRGWVWSFKNKFYSYVLEQRRRNR-------
A0A8C3W949_MCL1-02      LAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVEDLEGGIRNVLL---AF
A0A8C3WEA1_BCL2A1-      IPYFVAEFITKNTGQWIRQNGGWENGFVKKFEPKS-------------GW
A0A8C3WCN0_BCL2-01      IALWMTEYLNRHLHTWIQDNGGWD-AFVELYGPSM-------RPLFDFSW
A0A8C3WJH5_BCL2L1-      IATWMATYLNDHLEPWIQENGGWD-TFVELYGNNAAAESRKGQERFN-RW
A0A8C3W949_MCL1-03      LAESITDVLVRTKRDWLVKQRGWD-GFVEFFHVEDL-------EG---GI
A0A8C3X592_BCL2L2-      VQEWMVTYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLREG---NW
                        :   :.  :      *: .. **   *   :                   

A0A8C3W949_MCL1-01      TSVAGQSENSTRWKKSQGLRLRYFPEAFYFL
A0A8C3W949_MCL1-02      AGVAG-----------VGAGLAYLIR-----
A0A8C3WEA1_BCL2A1-      LTLLEVTGKICEMLCVL--KQYY--------
A0A8C3WCN0_BCL2-01      LSLK-ALLSLALVGACITLGAYLGHK-----
A0A8C3WJH5_BCL2L1-      F-----LTGMTLAGVVL-LGSLFSRK-----
A0A8C3W949_MCL1-03      RNVLLAFAGVAGVGA----GLAYLIR-----
A0A8C3X592_BCL2L2-      ASVRTVLTGAVALGALVTVGAFFASK-----
                                                       

© 1998-2022Legal notice