Dataset for protein Bcl-w of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 * .. :. * .. : *  *    : * . . :*. *           
------------------------------matPasapdtrAlvadfvGykLrqkgyvCgagpgeGpaAdplhqamr---
mgwpnlkylplglspyihasflcltptaardrl lpgfenl qfpalg gv ----fd qvispn al xxxxxxxxxxx
                            lt                                                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      :.*   **..         :* .* :
-------------------aagdefetrfrrtfsdlaaqlhvtpgsaqqrftqvsdElfqGGpnwgrlvaffvfGaaLca
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxag gap  ag--------dy ng es
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*.:: *   :**      *      *.  .    .: *                                          
EsvnkE---mEPlvgqvqEwmvaylEtrladwihssgGw-------g----ee---l-eg------------------el
 elep elll  epepep -----e pprprappgap paeftaly-dgal--arr-r--nwasvrtvltgdvalgdp--
                                       gpgsgap nqee  epg v  d        p ag ieal  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 *..*:: .* *  ** .              
eaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeAdaRsiyvGnVdyGAtaeeleahfhgcgsvn
------------------------------------------------- sv tvlt a al  lvt-------------
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsr
--------------------------------------------------------------------------------
                                                                                

       410       420       
....:....|....:....|....:..
                   . :::   
fysgfnsrprgrvyrgraratswyspy
-------------------vgaffl--
                        ask
© 1998-2022Legal notice