Dataset for protein Bcl-w of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452ECF0_BCL2L2-      ------------------------------MATPASAPDTRALVADFVGY
A0A8C2R4Z3_BCL2L2-      MGWPNLKYLPLGLSPYIHASFLCLTPTAARMATPASAPDTRALVADFVGY
A0A8C2R4Z3_BCL2L2-      MGWPNLKYLPLGLSPYIHASFLCLTPTAARMATPASAPDTRALVADFVGY
A0A8C2R4Z3_BCL2L2-      ----------------------------LTDRLPLPGFENLAQFPALGGG
A0A8C2R4Z3_BCL2L2-      ------------------------------MATPASAPDTRALVADFVGY
                                                         * .. :. * .. : * 

A0A452ECF0_BCL2L2-      KLRQKGYVCGAGPGEGPAADPLHQAMR----------------------A
A0A8C2R4Z3_BCL2L2-      KLRQKGYVCGAGPGEGPAADPLHQAMR----------------------A
A0A8C2R4Z3_BCL2L2-      KLRQKGYVCGAGPGEGPAADPLHQAMR----------------------A
A0A8C2R4Z3_BCL2L2-      VL----FDCQVISPNGALAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C2R4Z3_BCL2L2-      KLRQKGYVCGAGPGEGPAADPLHQAMR----------------------A
                         *    : * . . :*. *                               

A0A452ECF0_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVA
A0A8C2R4Z3_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVA
A0A8C2R4Z3_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVA
A0A8C2R4Z3_BCL2L2-      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGEGAPGGAG------
A0A8C2R4Z3_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVA
                                                          :.*   **..      

A0A452ECF0_BCL2L2-      FFVFGAALCAESVNKE---MEPLVGQVQEWMVAYLETRLADWIHSSGGWA
A0A8C2R4Z3_BCL2L2-      FFVFGAALCAESVNKE---MEPLVGQVQEWMVAYLETRLADWIHSSGGW-
A0A8C2R4Z3_BCL2L2-      FFVFGAALCAESVNKE---MEPLVGQVQEWMVAYLETRLADWIHSSGGW-
A0A8C2R4Z3_BCL2L2-      --DYGNGLESEELEPEELLLEPEPEPEPE-----EEPPRPRAPPGAPGPG
A0A8C2R4Z3_BCL2L2-      FFVFGAALCAESVNKE---MEPLVGQVQEWMVAYLETRLADWIHSSGGWA
                           :* .* :*.:: *   :**      *      *.  .    .: *  

A0A452ECF0_BCL2L2-      EFTALYGDGALEEARRLREGNW----------------------------
A0A8C2R4Z3_BCL2L2-      --------------------------------------ELEAIKARVREM
A0A8C2R4Z3_BCL2L2-      --------------------------------------ELEAIKARVREM
A0A8C2R4Z3_BCL2L2-      PGSGAPGNQEEEEEPGLVEGD--------PGDGAIEDPELEAIKARVREM
A0A8C2R4Z3_BCL2L2-      EFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALELEAIKARVREM
                                                                          

A0A452ECF0_BCL2L2-      ---------------------------------------ASVRTVLTGAV
A0A8C2R4Z3_BCL2L2-      EEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV
A0A8C2R4Z3_BCL2L2-      EEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV
A0A8C2R4Z3_BCL2L2-      EEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV
A0A8C2R4Z3_BCL2L2-      EEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNV
                                                               *..*:: .* *

A0A452ECF0_BCL2L2-      ALGALVT-------------------------------------------
A0A8C2R4Z3_BCL2L2-      DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS
A0A8C2R4Z3_BCL2L2-      DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS
A0A8C2R4Z3_BCL2L2-      DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS
A0A8C2R4Z3_BCL2L2-      DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTS
                          ** .                                            

A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A8C2R4Z3_BCL2L2-      LALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
A0A8C2R4Z3_BCL2L2-      LALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
A0A8C2R4Z3_BCL2L2-      LALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
A0A8C2R4Z3_BCL2L2-      LALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSR
                                                                          

A0A452ECF0_BCL2L2-      -------------------VGAFFASK
A0A8C2R4Z3_BCL2L2-      FYSGFNSRPRGRVYRGRARATSWYSPY
A0A8C2R4Z3_BCL2L2-      FYSGFNSRPRGRVYRGRARATSWFL--
A0A8C2R4Z3_BCL2L2-      FYSGFNSRPRGRVYRGRARATSWYSPY
A0A8C2R4Z3_BCL2L2-      FYSGFNSRPRGRVYRGRARATSWYSPY
                                           . :::   

© 1998-2022Legal notice