Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------mfglqrnlvidylly-----------------------------csq-g-g-g------p--rllatp-vaspp
mamads--q-n-ea--gln--klsqrgyswsqfsdvgenrtgappgtgsf-ggp-l-p-sggatp-gg----pgvp--k-
  htgrts-y-h--tv---s v q k  e da g  eaappe aeaedies--asmtasptppsn vwhtsv--t-nyat
     plrysteqi tkfiq                              mpts hinmkaa rd st aapsepkgt-q
      eg ri    q   h                              ier  a   a    a da   eadkeeg l
         d     m   e                                                   d  f da a
                                                                          a     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
r---g--lrav-----v---------------------------------------------------------------
-tas-avag--tpvsagasppaaltpdarrvvrpppigaevpdvtatpsrllffaptrraapleemegpaadplmspeee
shvtspt--y pgtgpt                                                  a    ai      
mgsgalqssp i ma a                                                               
gere gek k c g                                                                  
aa    d  e                                                                      
      a                                                                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ldgyepeplgkrpavlpllelvgepangsstdgslpstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgaa
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       :.     .                          .  :    : ..   .**.:* :: *             
----lqtlrrvgdgvqrryrrafsgmlsqlhitp-gtavqsfsrvmeelfsdgv--nWGriVtlfsFggal---------
srkaheavqqa--efetnhettyqdl-rk-d-kniendrkrlaqmvvhvlrgs-gtt  nv afia -a--lkrgplvtk
    srvm k-af-lylsffssllsyt--v-v-s fdrytlvtt snke q  p p    l milv e-vviek af aa
    kls  e   s skev kd kecsdn  la  ds qgi  ada  e  i i         e a tm         
    aa   a   d         a  aa           e                             i          
                                                                     f          
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :   :   :      *:  . **                                 
---------cvesvnkemeplverlaewmteylvrtlrdWivkqgGWd--------------------------------
rwktwnqqsrl-e---------spivasiadvinthkht lqsnr  gleaikarvremeeeaeklkelqnevekqmnms
hl kigfe lkr-rtrpvvvtyqqvsllvvtr mnrtgp  rqs   e                                
         aiklpiinqssdikn qhflssf egqhee  he                                     
          ah kegddqrccge      a   dn aa  ed                                     
              da  ad  d                   a                                     
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .                      
--------------------------gfvel-fhvedle----------------kvlvgvvlg-ayi-lg----ir---
pppgnagpvimsieekmeadarsiyvtwhyfgyg-s---aswrgrgsfnrvwltlntvlslfa-w---a--syfs-ktsl
                          kncsy m-t-salglrk qprvrnwtisgmmfa-hpqvvrlvtvsllywv-   
                          a  d  atpnm aehih celidfsl lflk sqagksllktgffikllt    
                                 rn e   gf    g    f acdg    a kk gmea daegr    
                                  a a                  a        g cl   a   h    
                                                                f               

       490       500       510       520       530       540       550      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                            
----------------------------------------------------------------------------
aldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
                                                                            
                                                                            
                                                                            
                                                                            
                                                                            
© 1998-2020Legal notice