Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------aa--maqynrnlvvdylsyklrqrgy--g------gg--gegppgap-pygssge---
mfglqrnaviglnlycggagmm--daefgsthgatqgfgqgvgs----vw-gggtva--dv-a--t--ap-tpremarpp
                    lgmtasasadiaeragkrvlepsqrkhlspseaaaptfseae-nr-eg-ggidqrlm   
                     ahgsrtwyaagqiltatnk c gaglvggd     q  spl tgaadtedsangav   
                        ppsgtrqea  m lih a a  egec      p  rl  sa pesthqtmfvs   
                        ggl ppp    l  eg        a              p  k llam i s    
                          g  l     i   e                       a     k e a      
                                   a                                   d        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------p-----------p-------p-----------------------------------
piseelepvtrttseelllepept-spiegpprpra-swhpgpg-vvgrlvaffvfgaalaptsqsseleprpvekrpav
  gd vptrfarpfsl ffqltveagaenerfaqvndpgalads gsn            gaggheesedagllg     
   a f d      rd aaa hrr estqqmet as vlrts p pwa            s eevntgytlse       
                       q ahlp  a   d eimq    np             c aaelk p  lv       
                           a         aaf                        aad m  e        
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             :.                                 
-------------------------------------pleavkarlrevgdeaekrkerafsevlsqlnitp--------
lpllelvgdpgdgaiedwsvpytptrleewihssyrpepskisrvvqqmeesvqrlyrl-qngmeknmhmssppgnagpv
        e an svtegmlasleppaadeedelggigmr-tlqt  raafgfylevpkslksltd-vdlatlrrvgdg 
             qsq                    wvvaiahla  k----lsdthftgyqdc--r----n        
                                    qss-  aey   q td k sf sdrl ysrkka k         
                                     a      s          n  m  a aa     e         
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .               .                         :             :   : 
imtaetkfeqvarslfvdgv--nwGrivt----hffffG-----------------gfkclesvdke--svvtsla--la
-dsiresmsadvekiyrgnigidyvataeelea-vhsc-svnrvtilcdkfsghpk-kayirfsnapmvvlrsrisawmt
qgnvyqi-armmneelsksp ttd nvlarvmvllage iliwrgpvvtiswktwvqaslvkeri--dqdtykp vhsvd
grrhksv qt lvhvde  e p   ks s    iise- vtlegraftlarl kinf-lr ----rdvs---ee  efis
end  lr  g   a  i           m        d t        a hf afgavmh  tpeq  ardiqn  ll  
 f   gl                              a                   q     i g   pccd       
      a                                                  e                      
                                                                                

       330       340       350       360       370       380       390   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
  :      .:  :  .                                                        
eylvrhrriwiqpnggw----------f--fryrarttnynssrsrfyslfns---gr---------------
tsinnglqpkviqqrtnrpgisttdrg-vraygffsvegsdcgwlsvllg-l-rpr--vyrgrarltswyspy
dv fdttge lvkk   dg fvkkfdtkpewvtvsmsaelvaqqrnlsvqyfaswmlvtvgsyylaraylgrk
sf mgnked  re    gn      ep sklmsqnlrsvrrwlnkkynt-v-tqvlvtlfvlvvwtg lf h 
 r   qhht  ed    ek       a mgvihpmhmpskqkemgdsmrwtplgga mgafikktks      
        a   a                  hfnlelllilgdke kkkcsi      d aagiki       
                               felida dfif i   hh ac      a   cf         
                               c  ea    e  e    a             a          
© 1998-2023Legal notice