Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------aa--maqynrnlvvdylsyklsqrgyvwg-----agg--ge--pgaa---g---e---
mfglqrnaviglnlycggagmm--daefgsthgatqgfgqg--r-k--g--eagav---dv--gp----tpy-srl-rpp
                    lgmtasasadiaeragkrvlevg-r-qs-ps     tfseaeanrtegpggtdngmv   
                     ahgsrtwyaagqiltatnk psqiphlsmd     qsrsplgaasadledqarevs   
                        ppsgtrqea  m lih a a  eveg      c  ag  sga   php mfsl   
                        ggl ppp    l  eg         c                   lae i aa   
                          g  l     i   e                               d g      
                                   a                                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------tpgp-eg-----ap-------p-----------------------------------
piseelepvtrttseelllepepe--ai-epprpr--swhpgpg-vvgrlvaffvfgaalaptsqsseleprpvekrpav
  gd vptrfarpfsl ffqltv-ts-en-rfatasdpgalads gsn            gaggheesedagllg     
   a f d      rd aaa hrraettqtmetqvngvlrts p pwa            s eevntgytlse       
                       q asppskasg eaeimq    np             c aaelk p  lv       
                       a  hldq  m  d aaf                        aad m  e        
                           k                                                    
                           a                                                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             :.                                 
------------------------------------ppleavkarlrevgdeaekrkerafsevlsqlnitp--------
lpllelvgdpgdgaiedwsvpytptrleewihssyr-epskisrvvqqmeesvqrlyrl-qngmeknmhmssppgnagpv
        e an svtegmlasleppaadeedelggi-mr-tlqt  raafgfylevpkslksltd-vdlatlrrvgdg 
             qsq                    avvaiahla  k----lsdthftgyqdc--r----n        
                                    wss-  aey   q td k sf sdrl ysrkka k         
                                    qa      s          n  m  a aa     e         
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .          .               .                          :             :   :
-mnaeesfeqvarslfvdgv--nwGrivt-----ffsf-G-----------------g-kclesvdke--svvtsla--l
igtirtkmsadvekiyrgnigidyvataeeleahlhgce-svnrvtilcdkfsghpk-fayirfsnapmvvlrsrisawm
qdsryqivarmmneelsksp ttd nvlarvmv ilada ilikrgpvvtiswktwvqaslvkeri--dqdtykp vhsv
 rdhvkrlqt lvhvde  e p   ks s     vie   vtlwgraftlarl kinfvlr ----rdvs---ee  efi
 f d gl  g   a  i           m           t  e     a hf afgaqmh  tpeq  ardiqn  ll 
 e    a                                                   e     i g   pccd      
                                                                                
                                                                                

       330       340       350       360       370       380       390     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
   :      .:  :  .                                                         
aeylvrhrriwiqpnggw--------dgfvefryrarttnynssrlr-fysgfns---gr-y--r----------
ttsinnglqpkviqqrtnrpgisttdr--prafhvssllgsirqvssqlkll-l-rpr--v-rg-arltswyspy
ddv fdttge lvkk   gn fvkkf-tk--wygtedveerdcnwkvlyft-w-tvgvvvyvwsvvtagaylgrk
ssf mgnked  re    ek      ep sylmtqnmsavlwwkqglkvsryvpltamlmtfvtkklks lf h 
  r   qhht  ed             a mkvispmlrplkvkgned snqwtigq afll ligik        
         a   a               cg hrnlem airfem   mhhssaa    id gac          
                                 fliaa  gqadk   aaacc       a a            
                                  f     f   e                              
© 1998-2022Legal notice