Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---a--mr---r-lvgdylsyklrq-gy--gag---g-g---ap------------------------------------
mmm-dplfqdt-natagfvegcgs-r--vw---gdv-e-rpgeapgtgsfsstpshtpgpaaprnpvwrtspspvvngpg
 aatpa-agynhevfvlrrqcvsgrklssgstsstppsnpat--eaediemeq gain      d sahladp ppaaat
  h gst-ysqeqmatkqnnapiqlpqlgpdqflgaegagtlpt                                   a
    arsspriagi q lil  f inhgem p ke  a aleg                                     
      egala a  m  gh    ag  cc g a       ad                                     
      a  a     i   g        a                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------vhrtlrqagd-lerrfrrafsell-qlhitp-gnavesfarvaeelfsd--gpnwgrivalfaf
tpesppstrevavlragaqgvqk---efy-------lgy-s-----sietrrqrvsqmvvavlrgsp-vt------f---
akstsltlasappvaktsaangtvsfsvqtsyfstykdmsanvevkn fsegtltttsmppsppagv --s nv t-ls 
ghd k mgspgias  mlyvmareaeg--pnvetslqsctrkrdpgg dpdykvprprsnkgaq  i tg   l miiv 
 aa g da     m  lkls  l   d sleh kd elaalep le   e qgplgg  ghe e    i         e 
                agel  e      k      a   d    a   d eai e   d                    
                 d    a                                                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-gal---s---e--p-v---------------------------------------------------------------
g---cve-vrk-me-l-vtyvpgvgaiaswmvtylntrlatwiqenggweleaikarvremeeeaeklkelqnevekqve
aatmtpklrnevrsvplgegd ddtrvqlrltffaprhrhpplhsseapdad  mspee ldgyepeplgkrpa lpfmn
e v ikgaqevriq gidae    sqtpe  le  ed  ed  edm   at                          ll 
  i aad ldr ep d        dn ed  aa       a                                       
             a              a                                                   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lygppgnagstdgslpstppvimsieekmeadarsiyvgnvdygataeeleapfhgcgsvsrvtllclvrvgdgvqrnhe
mspnsaags           paeee delyrqsle isrylreq  gsrktrhrfrswwlnlkaietdk           
 v enm  e                                      akdgqemgnrsfatgm vasvr           
                                                   k l df a       g             
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------l--gafvgrr-k-i---s---------------ls---
tafsghpkgfayiefsdkesvsrvmvhvfsdgvtnwgrtsla-ersplrtkqw-v-pqr-nrkepegdvardcqri-tti
   q mlrkldikned vk l                lvvtlidl-l--aakl twnketcl           pp-vesd
                                      igac te -yl--hi k gfq wi           eg aalv
                                           sf s fsh-        r            ke  hfm
                                                                               l
                                                                                

       410       420       430       440       450       460       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                   
--f-----r-wl--qggwdgf-sff----------------f-g------g--y--r----------
tg-lvrtr-r--vr-------v---rvsdllalwrnvlvqv-s-wnsvpa-ry-wt-aratswyspy
sdvimgqkadyrekttnynssryrmhteyseggikklmllaylsvlltgrflvfri           
rsr  nphga iaanr  gkwcel lmlv v qk rk a   a fagrav ia lg           
ap    nt e  rq       h      s                                      
 e                                                                 
                                                                   
© 1998-2021Legal notice