Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8MY14_BCL2-01      --------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW
A0A8I3ZZI7_BCL2L1-      --------------------------MSQSNRELVVDFLSYKLSQKGYSW
A0A8I3ZZI7_BCL2L1-      --------------------------MSQSNRELVVDFLSYKLSQKGYSW
F7GTF7_MCL1-01          MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
U3CRF8_BCL2L2-01        ---------------------MATPASAPDTRALVADFVGYKLRQKGYVC
U3CRF8_BCL2L2-02        ---------------------MAAAAAAAAAAGAAGGRGSGPGRRRHLVP
U3CRF8_BCL2L2-03        ---------------------MAAAAAAAAAAGAAGGRGSGPGRRRHLVP
F7CT87_BCL2L10-01       ----------------------MADPLWQRTEQLVTDYLEYCSR------
F7GTF7_MCL1-02          --------------------------MFGLQRNAVIGLNLYCGGAGLGAG
F7HXW0_BCL2A1-02        ----------------------MTDSEFGYIHNLTQDYLQYVLQ------
F7HXW0_BCL2A1-01        ----------------------MTDSEFGYIHNLTQDYLQYVLQ------
                                                                          

A0A2R8MY14_BCL2-01      D-----A-GDVGAAPPGAAPAEGIFSS-----------------------
A0A8I3ZZI7_BCL2L1-      S-----QFSDVEENRTEAPEGTDSEME-----------------------
A0A8I3ZZI7_BCL2L1-      S-----QFSDVEENRTEAPEGTDSEME-----------------------
F7GTF7_MCL1-01          GEAGAVTGGSAGASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFA
U3CRF8_BCL2L2-01        G-----TG--PGEGPAADPLHQAMRAA-----GDEFETRFRRTFSDLAAQ
U3CRF8_BCL2L2-02        G-----AGGEAGEGAPGGAGDYGNGLE-----SEELEP------EELLLE
U3CRF8_BCL2L2-03        G-----AGGEAGEGAPGGAGDYGNGLE-----SEELEP------EELLLE
F7CT87_BCL2L10-01       ------------EPGTPESPPSTAEAA-----------------------
F7GTF7_MCL1-02          SGGATPPGGRLLATGAKDTKPMGRSGA-----------------------
F7HXW0_BCL2A1-02        ---------------------IPQSGM-----------------------
F7HXW0_BCL2A1-01        ---------------------IPQSGM-----------------------
                                                                          

A0A2R8MY14_BCL2-01      ---QPGHTPGPAAPRDPVARTSPPPPPA------------APAAAATGPT
A0A8I3ZZI7_BCL2L1-      ---TPSAING-----NPSWHLADSPVVN------------GATGHSSSLD
A0A8I3ZZI7_BCL2L1-      ---TPSAING-----NPSWHLADSPVVN------------GATGHSSSLD
F7GTF7_MCL1-01          PTRRAAPLEEMEAPAADAIM--------------------SPEEELDGYE
U3CRF8_BCL2L2-01        LHVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFGAALCAESVNKEME
U3CRF8_BCL2L2-02        PEPEPEPEEEPPRPRAPPGAPGPGPGSG------------APGSQEEEEE
U3CRF8_BCL2L2-03        PEPEPEPEEEPPRPRAPPGAPGPGPGSG------------APGSQEEEEE
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
F7HXW0_BCL2A1-02        --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
                                                                          

A0A2R8MY14_BCL2-01      LSPV------------------------------------------PPV-
A0A8I3ZZI7_BCL2L1-      AREV------------------------------------------IPMA
A0A8I3ZZI7_BCL2L1-      AREV------------------------------------------IPMA
F7GTF7_MCL1-01          PEPLGKRPAVLPLLELVGEPANGSSTDGSLPSTPPPAEEEEDELYRQSLE
U3CRF8_BCL2L2-01        PLV-------------------GQVQEWMVAYLETRLADWIHSSGGWELE
U3CRF8_BCL2L2-02        PGLVE------------GDPGDGAIED-------------------PELE
U3CRF8_BCL2L2-03        PGLVE------------GDPGDGAIED-------------------PELE
F7CT87_BCL2L10-01       -----------------------------------------------VLR
F7GTF7_MCL1-02          -----------------------------------------------ASR
F7HXW0_BCL2A1-02        -----------------------------------------------GPS
F7HXW0_BCL2A1-01        -----------------------------------------------GPS
                                                                          

A0A2R8MY14_BCL2-01      -VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP---------FTARGRFAT
A0A8I3ZZI7_BCL2L1-      AVKQALREAGDEFELRYRRAFSDLTSQLHITP---------GTAYQSFEQ
A0A8I3ZZI7_BCL2L1-      AVKQALREAGDEFELRYRRAFSDLTSQLHITP---------GTAYQSFEQ
F7GTF7_MCL1-01          IISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQG
U3CRF8_BCL2L2-01        AIKARVREMEEEAEKLKEL-QNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
U3CRF8_BCL2L2-02        AIKARVREMEEEAEKLKEL-QNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
U3CRF8_BCL2L2-03        AIKARVREMEEEAEKLKEL-QNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
F7CT87_BCL2L10-01       AVAASVRK----LYRSFFSAYLGY-------P--------GNRVELV-AR
F7GTF7_MCL1-02          KALETLRRVGDGVQRNHETAFQGMLRKLDIKN--------EDDVKSL-SR
F7HXW0_BCL2A1-02        KTSRVLQQVAFSVQKEVEKSLKSCLDNVDIAS--------IDNARTIFSQ
F7HXW0_BCL2A1-01        KTSRVLQQVAFSVQKEVEKSLKSCLDNVDIAS--------IDNARTIFSQ
                             :.                                           

A0A2R8MY14_BCL2-01      VVEELFRDGV--NWGRIVA-----FFEFG-----------------GVMC
A0A8I3ZZI7_BCL2L1-      VVNELFRDGV--NWGRIVA-----FFSFG-----------------GALC
A0A8I3ZZI7_BCL2L1-      VVNELFRDGV--NWGRIVA-----FFSFG-----------------GALC
F7GTF7_MCL1-01          MLRKLDIKNE--DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVA-KH
U3CRF8_BCL2L2-01        DARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAY
U3CRF8_BCL2L2-02        DARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAY
U3CRF8_BCL2L2-03        DARSIYVGNV--DYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAY
F7CT87_BCL2L10-01       MAEALLSDSPGPTWGNVVM----LLAFAGTLLERGPLVTARWKKWGFQSR
F7GTF7_MCL1-02          VMVHVFSDGV-TNWGRIVT----LISF-------GAFVAKHLKTINQESC
F7HXW0_BCL2A1-02        VMEKEFEDGI-INWGRIVT----IFAFEGILI---------------KKL
F7HXW0_BCL2A1-01        VMEKEFEDGI-INWGRIVT----IFAFEGILI---------------KKL
                                .               .                         

A0A2R8MY14_BCL2-01      VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGW--------DAFVE
A0A8I3ZZI7_BCL2L1-      VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW--------DTFVE
A0A8I3ZZI7_BCL2L1-      VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW-----------MK
F7GTF7_MCL1-01          LKTINQE--SCIEPLAESITDVLVRTKRDWLVKQRGW--------DGFVE
U3CRF8_BCL2L2-01        IEFSDKE--SVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
U3CRF8_BCL2L2-02        IEFSDKE--SVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
U3CRF8_BCL2L2-03        IEFSDKE--SVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
F7CT87_BCL2L10-01       LKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGWDG-----------
F7GTF7_MCL1-02          I-----------EPLAESITDVLVRTKRDWLVKQRGWDG-----------
F7HXW0_BCL2A1-02        LRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWGK-----------
F7HXW0_BCL2A1-01        LRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSG
                        :             :   :   :      .:  :  .             

A0A2R8MY14_BCL2-01      LYGPSMRPLFDFSWLSLKTL-LS---LVLVGACITLGAYLGHK
A0A8I3ZZI7_BCL2L1-      LYGNNAAAESRKGQERFNRWFLT---GMTVAGVVLLGSLFSRK
A0A8I3ZZI7_BCL2L1-      VIFQISSAEIQWDNGDYHLLSI---------------------
F7GTF7_MCL1-01          FFHVEDLEGRDCSELRSSHCTPAQGMVRDFVSKKKKS------
U3CRF8_BCL2L2-01        ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
U3CRF8_BCL2L2-02        ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
U3CRF8_BCL2L2-03        ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG----------
F7CT87_BCL2L10-01       FCYFFRTSSLLALWRKVLVQVFLSWLLTAVFIYFWTR------
F7GTF7_MCL1-02          FVEFFHVEDLEGGIRNVLL-AFAGVAGVGAGLAYLIR------
F7HXW0_BCL2A1-02        WHSLMLMLVSVAQKKRKMAL-----------------------
F7HXW0_BCL2A1-01        WMTFLEVTGKICEMLSLLKQYC---------------------
                                                                   

© 1998-2023Legal notice