Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8M4C0_BCL2L2-      --------------------------------------------------
F7GTF7_MCL1-01          ------MFGLQRNAVIGLNLY-----------------------------
F7HXW0_BCL2A1-01        --MTDSEFGYIHNLTQDYLQYVLQ--------------------------
A0A2R8MY14_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA-GDVGAAPPGAAPAEGIF
F7IT34_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSE
F7CT87_BCL2L10-01       --MADPLRQRTEQLVTDYLEY-----------------------------
F7GTF7_MCL1-02          ------MFGLQRNAVIGLNLY-----------------------------
                                                                          

A0A2R8M4C0_BCL2L2-      --------MATPASAPDTRALVADFVGYKLR-----QKGYVCGTGPG---
F7GTF7_MCL1-01          CGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGSAGASP
F7HXW0_BCL2A1-01        IPQSGMGPSK------------------------------------T---
A0A2R8MY14_BCL2-01      SSQPGHTPGPAAPRDPVARTSPPPPPAAPAAAATGPTLSPVPPV--V---
F7IT34_BCL2L1-01        METPSAING-----NPSWHLADSPVVNGATGHSSSLDAREVIPMAAV---
F7CT87_BCL2L10-01       CSR------------------EPGTPESPPSTAEAAVLRA------V---
F7GTF7_MCL1-02          CGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGAASRK------A---
                                                                          

A0A2R8M4C0_BCL2L2-      ----------------------------------------------EGPA
F7GTF7_MCL1-01          PAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPA
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
                                                                          

A0A2R8M4C0_BCL2L2-      ADPL----------------------------------------------
F7GTF7_MCL1-01          ADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDGSLPSTPP
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
                                                                          

A0A2R8M4C0_BCL2L2-      --------------------------------------------HQAMRA
F7GTF7_MCL1-01          PAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAASRKALETLRR
F7HXW0_BCL2A1-01        --------------------------------------------SRVLQQ
A0A2R8MY14_BCL2-01      --------------------------------------------HLTLRQ
F7IT34_BCL2L1-01        --------------------------------------------KQALRE
F7CT87_BCL2L10-01       --------------------------------------------AASVRK
F7GTF7_MCL1-02          --------------------------------------------LETLRR
                                                                       :. 

A0A2R8M4C0_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG--PNWGR
F7GTF7_MCL1-01          VGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGV-TNWGR
F7HXW0_BCL2A1-01        VAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFEDGI-INWGR
A0A2R8MY14_BCL2-01      AGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRDGV--NWGR
F7IT34_BCL2L1-01        AGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRDGV--NWGR
F7CT87_BCL2L10-01       ----LYRSFFSAYLGY-------P-GNRVELVARMAEALLSDSPGPTWGN
F7GTF7_MCL1-02          VGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGV-TNWGR
                            .                          .  :    : ..   .**.

A0A2R8M4C0_BCL2L2-      LVAFFVFGAAL------------------CAESVNKEMEPLVGQVQEWMV
F7GTF7_MCL1-01          IVTLISFGAFV------------------AKHLKTINQESCIEPLAESIT
F7HXW0_BCL2A1-01        IVTIFAFEGILIKK---------------LLRERIAPDVDTYKEISHFVA
A0A2R8MY14_BCL2-01      IVAFFEFGGVM------------------CVESVNREMSPLVDNIALWMT
F7IT34_BCL2L1-01        IVAFFSFGGAL------------------CVESVDKEMQVLVSRIAAWMA
F7CT87_BCL2L10-01       VVMLLAFAGTLLERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALLS
F7GTF7_MCL1-02          IVTLISF-------GAFVAKHLKTINQESCI-----------EPLAESIT
                        :* :: *                                     :   : 

A0A2R8M4C0_BCL2L2-      AYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
F7GTF7_MCL1-01          DVLVRTKRDWLVKQRGWD--------------------------------
F7HXW0_BCL2A1-01        EFIMNNTGEWIRQNGGWG--------------------------------
A0A2R8MY14_BCL2-01      EYLNRHLHTWIQDNGGWD--------------------------------
F7IT34_BCL2L1-01        TYLNDHLEPWIQENGGWD--------------------------------
F7CT87_BCL2L10-01       SRLVGQHRAWLEAQGGWD--------------------------------
F7GTF7_MCL1-02          DVLVRTKRDWLVKQRGWD--------------------------------
                          :      *:  . **                                 

A0A2R8M4C0_BCL2L2-      PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNR
F7GTF7_MCL1-01          --------------------------GFVEF-FHVEDLE------GGIRN
F7HXW0_BCL2A1-01        --------------------------KWHSL-M-----------------
A0A2R8MY14_BCL2-01      --------------------------AFVEL-YGPSM-------RPLFDF
F7IT34_BCL2L1-01        --------------------------TFVEL-YGNNAAAESRKGQERFNR
F7CT87_BCL2L10-01       --------------------------GFCYF-FRTSSLLALWR-------
F7GTF7_MCL1-02          --------------------------GFVEF-FHVEDLEGGIR-------
                                                                          

A0A2R8M4C0_BCL2L2-      VTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTN
F7GTF7_MCL1-01          VLLAFAGVAGVGAGLAYL-------IR-----------------------
F7HXW0_BCL2A1-01        -----LMLVSVAQKKRKMAL------------------------------
A0A2R8MY14_BCL2-01      SWLSLKTLLSLVLVGACITLGAYLGHK-----------------------
F7IT34_BCL2L1-01        WFLTGMTVAGVVL------LGSLFSRK-----------------------
F7CT87_BCL2L10-01       -----KVLVQVFLSWLLTAVFIYFWTR-----------------------
F7GTF7_MCL1-02          -----NVLL-AFAGVAGVGAGLAYLIR-----------------------
                               .                                          

A0A2R8M4C0_BCL2L2-      RPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
F7GTF7_MCL1-01          --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
                                                                          

A0A2R8M4C0_BCL2L2-      SWYSPY
F7GTF7_MCL1-01          ------
F7HXW0_BCL2A1-01        ------
A0A2R8MY14_BCL2-01      ------
F7IT34_BCL2L1-01        ------
F7CT87_BCL2L10-01       ------
F7GTF7_MCL1-02          ------
                              

© 1998-2020Legal notice