Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HXW0_BCL2A1-02        ----------------------MTDSEFGYIHNLTQDYLQYVLQIPQSGM
F7HXW0_BCL2A1-01        ----------------------MTDSEFGYIHNLTQDYLQYVLQIPQSGM
F7CT87_BCL2L10-01       ----------------------MADPLWQRTEQLVTDYLEY---------
F7GTF7_MCL1-02          --------------------------MFGLQRNAVIGLNLY---------
A0A2R8MY14_BCL2-01      --------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW
F7IT36_BCL2L1-02        --------------------------MSQSNRELVVDFLSYKLSQKGYSW
F7IT36_BCL2L1-01        --------------------------MSQSNRELVVDFLSYKLSQKGYSW
F7GTF7_MCL1-01          MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
U3CRF8_BCL2L2-01        ---------------------MATPASAPDTRALVADFVGYKLRQKGYVC
U3CRF8_BCL2L2-03        ---------------------MAAAAAAAAAAGAAGGRGSGPGRRRHLVP
U3CRF8_BCL2L2-02        ---------------------MAAAAAAAAAAGAAGGRGSGPGRRRHLVP
                                                                          

F7HXW0_BCL2A1-02        G-------------------------------------------------
F7HXW0_BCL2A1-01        G-------------------------------------------------
F7CT87_BCL2L10-01       ------CSR-----------------------------------------
F7GTF7_MCL1-02          ------CGGAGLGAGSGGATPPGGRLL-----------------------
A0A2R8MY14_BCL2-01      D-----A-GDVGAAPPGAAPAEGIFSS-----------------------
F7IT36_BCL2L1-02        S-----QFSDVEENRTEAPEGTDSEME-----------------------
F7IT36_BCL2L1-01        S-----QFSDVEENRTEAPEGTDSEME-----------------------
F7GTF7_MCL1-01          GEAGAVTGGSAGASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFA
U3CRF8_BCL2L2-01        G-----TG--PGEGPAADPLHQAMRAA-----GDEFETRFRRTFSDLAAQ
U3CRF8_BCL2L2-03        G-----AGGEAGEGAPGGAGDYGNGLE-----SEELEP------EELLLE
U3CRF8_BCL2L2-02        G-----AGGEAGEGAPGGAGDYGNGLE-----SEELEP------EELLLE
                                                                          

F7HXW0_BCL2A1-02        --------------------------------------------------
F7HXW0_BCL2A1-01        --------------------------------------------------
F7CT87_BCL2L10-01       ---EPGTPESPPSTAEA---------------------------------
F7GTF7_MCL1-02          ---ATGAKDTKPMGRSG---------------------------------
A0A2R8MY14_BCL2-01      ---QPGHTPGPAAPRDPVARTSPPPPPA------------APAAAATGPT
F7IT36_BCL2L1-02        ---TPSAING-----NPSWHLADSPVVN------------GATGHSSSLD
F7IT36_BCL2L1-01        ---TPSAING-----NPSWHLADSPVVN------------GATGHSSSLD
F7GTF7_MCL1-01          PTRRAAPLEEMEAPAADAIM--------------------SPEEELDGYE
U3CRF8_BCL2L2-01        LHVTPGSAQQRFTQVSDELFQG-GPNWGRLVAFFVFGAALCAESVNKEME
U3CRF8_BCL2L2-03        PEPEPEPEEEPPRPRAPPGAPGPGPGSG------------APGSQEEEEE
U3CRF8_BCL2L2-02        PEPEPEPEEEPPRPRAPPGAPGPGPGSG------------APGSQEEEEE
                                                                          

F7HXW0_BCL2A1-02        ------------------------------------------------PS
F7HXW0_BCL2A1-01        ------------------------------------------------PS
F7CT87_BCL2L10-01       ----------------------------------------------AVLR
F7GTF7_MCL1-02          ----------------------------------------------AASR
A0A2R8MY14_BCL2-01      LSPV------------------------------------------PPV-
F7IT36_BCL2L1-02        AREV------------------------------------------IPMA
F7IT36_BCL2L1-01        AREV------------------------------------------IPMA
F7GTF7_MCL1-01          PEPLGKRPAVLPLLELVGEPANGSSTDGSLPSTPPPAEEEEDELYRQSLE
U3CRF8_BCL2L2-01        PLV-------------------GQVQEWMVAYLETRLADWIHSSGGWELE
U3CRF8_BCL2L2-03        PGLVE------------GDPGDGAIED-------------------PELE
U3CRF8_BCL2L2-02        PGLVE------------GDPGDGAIED-------------------PELE
                                                                          

F7HXW0_BCL2A1-02        KTSRVLQQVAFSVQKEVEKSLKSCLDNVDIAS--------IDNARTIFSQ
F7HXW0_BCL2A1-01        KTSRVLQQVAFSVQKEVEKSLKSCLDNVDIAS--------IDNARTIFSQ
F7CT87_BCL2L10-01       AVAASVRK----LYRSFFSAYLGY-------P---------GNRVELVAR
F7GTF7_MCL1-02          KALETLRRVGDGVQRNHETAFQGMLRKLDIKN---------EDDVKSLSR
A0A2R8MY14_BCL2-01      -VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP---------FTARGRFAT
F7IT36_BCL2L1-02        AVKQALREAGDEFELRYRRAFSDLTSQLHITP---------GTAYQSFEQ
F7IT36_BCL2L1-01        AVKQALREAGDEFELRYRRAFSDLTSQLHITP---------GTAYQSFEQ
F7GTF7_MCL1-01          IISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQG
U3CRF8_BCL2L2-01        AIKARVREMEEEAEKLKEL-QNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
U3CRF8_BCL2L2-03        AIKARVREMEEEAEKLKEL-QNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
U3CRF8_BCL2L2-02        AIKARVREMEEEAEKLKEL-QNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
                             :.                                        .  

F7HXW0_BCL2A1-02        VMEKEFEDGI-INWGRIVT-----IFAFEGILIK---------------K
F7HXW0_BCL2A1-01        VMEKEFEDGI-INWGRIVT-----IFAFEGILIK---------------K
F7CT87_BCL2L10-01       MAEALLSDSPGPTWGNVVM-----LLAFAGTLLERGPLVTARWKKWGFQS
F7GTF7_MCL1-02          VMVHVFSDGV-TNWGRIVT-----LISF-------GAFVAKHLKTINQES
A0A2R8MY14_BCL2-01      VVEELFRDGV--NWGRIVA-----FFEF-G-----------------GVM
F7IT36_BCL2L1-02        VVNELFRDGV--NWGRIVA-----FFSF-G-----------------GAL
F7IT36_BCL2L1-01        VVNELFRDGV--NWGRIVA-----FFSF-G-----------------GAL
F7GTF7_MCL1-01          MLRKLDIKNE--DDVKSLSRVMVHVFSD-GVTNWGRIVTLISFGAFVA-K
U3CRF8_BCL2L2-01        DARSIYVGNV--DYGATAEELEAHFHGC-GSVNRVTILCDKFSGHPKGFA
U3CRF8_BCL2L2-03        DARSIYVGNV--DYGATAEELEAHFHGC-GSVNRVTILCDKFSGHPKGFA
U3CRF8_BCL2L2-02        DARSIYVGNV--DYGATAEELEAHFHGC-GSVNRVTILCDKFSGHPKGFA
                                .               .                         

F7HXW0_BCL2A1-02        LLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWGK----------
F7HXW0_BCL2A1-01        LLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKS
F7CT87_BCL2L10-01       RLKEPEGDVARDCQRLVALLSSRLVGQHRAWLEAQGGW--------DGFC
F7GTF7_MCL1-02          CI-----------EPLAESITDVLVRTKRDWLVKQRGW--------DGFV
A0A2R8MY14_BCL2-01      CVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGW--------DAFV
F7IT36_BCL2L1-02        CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW-----------M
F7IT36_BCL2L1-01        CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW--------DTFV
F7GTF7_MCL1-01          HLKTINQE--SCIEPLAESITDVLVRTKRDWLVKQRGW--------DGFV
U3CRF8_BCL2L2-01        YIEFSDKE--SVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFP
U3CRF8_BCL2L2-03        YIEFSDKE--SVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFP
U3CRF8_BCL2L2-02        YIEFSDKE--SVRTSLA--LDESLFRGRQIKVIPKRTNRPGISTTDRGFP
                         :             :   :   :      .:  :  .            

F7HXW0_BCL2A1-02        -WHSLMLMLVSVAQKKRKMAL------------------------
F7HXW0_BCL2A1-01        GWMTFLEVTGKICEMLSLLKQYC----------------------
F7CT87_BCL2L10-01       YFFRTSSLLALWRKVLVQVFLSWLLTAVFIYFWTR----------
F7GTF7_MCL1-02          EFFHVEDLEGGIRNVLL-AFAGVAGVGAGLAYLIR----------
A0A2R8MY14_BCL2-01      ELYGPSMRPLFDFSWLS-LKTL-LS---LVLVGACITLGAYLGHK
F7IT36_BCL2L1-02        KVIFQISSAEIQWDNGD-YHLLSI---------------------
F7IT36_BCL2L1-01        ELYGNNAAAESRKGQER-FNRWFLT---GMTVAGVVLLGSLFSRK
F7GTF7_MCL1-01          EFFHVEDLEGRDCSELR-SSHCTPAQGMVRDFVSKKKKS------
U3CRF8_BCL2L2-01        RARYRARTTNYNSSRSR-FYSGFNSRPRGRVYRGRARATSWYSPY
U3CRF8_BCL2L2-03        RARYRARTTNYNSSRSR-FYSGFNSRPRGRVYRSG----------
U3CRF8_BCL2L2-02        RARYRARTTNYNSSRSR-FYSGFNSRPRGRVYRGRARATSWYSPY
                                                                     

© 1998-2022Legal notice