Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7HXW0_BCL2A1-01        --MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSK----------------
A0A5F4WGS2_BCL2L10      --MADPLR-----VVADYLECCFR------------------EP------
F7CT87_BCL2L10-01       --MADPLRQRTEQLVTDYLEYCSR------------------EP------
F7GTF7_MCL1-02          ------MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT------
A0A2R8MY14_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDA-GDVGAAPPGAAPAEGIF
F7IT36_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSE
F7GTF7_MCL1-01          -------------MFGLQRNAVIGLNLYCGGAGLGAGSGGATPP------
U3CRF8_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGYVCGTG--PGEGPAADP------
U3CRF8_BCL2L2-02        -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGA------
                                                                          

F7HXW0_BCL2A1-01        ----------------------------------------------TSRV
A0A5F4WGS2_BCL2L10      -----------------------------GTPESPPSTAEAAVLRAMAAG
F7CT87_BCL2L10-01       -----------------------------GTPESPPSTAEAAVLRAVAAS
F7GTF7_MCL1-02          -----------------------------GAKDTKPMGRSGAASRKALET
A0A2R8MY14_BCL2-01      SSQPGHTPGPAAPRDPVARTSPPPPPAAPAAAATGPTLSPVPPV--VHLT
F7IT36_BCL2L1-01        METPSAING-----NPSWHLADSPVVNGATGHSSSLDAREVIPMAAVKQA
F7GTF7_MCL1-01          ----------------------------------------------GGRL
U3CRF8_BCL2L2-01        ----------------------------------------------LHQA
U3CRF8_BCL2L2-02        ----------------------------------------------GDYG
                                                                          

F7HXW0_BCL2A1-01        LQQVAFSVQKEVEKSLKSCLDNVDIASIDNARTIFSQVMEKEFEDGI-IN
A0A5F4WGS2_BCL2L10      VRK----LYRSFFSAYLLY-------P-GNRGELVARMAEALLSDSPGPT
F7CT87_BCL2L10-01       VRK----LYRSFFSAYLGY-------P-GNRVELVARMAEALLSDSPGPT
F7GTF7_MCL1-02          LRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGV-TN
A0A2R8MY14_BCL2-01      LRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRD--GVN
F7IT36_BCL2L1-01        LREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRD--GVN
F7GTF7_MCL1-01          LATE------------KEASAQREVGG-GEAGAVTGGSAGASPPA-----
U3CRF8_BCL2L2-01        MRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQG--GPN
U3CRF8_BCL2L2-02        NGLESEELEP------EELLLEPEPEP-EPEEEPPRPRAPPGAPG-PGPG
                                                                          

F7HXW0_BCL2A1-01        WGRIVTIFAFEGILIKKLLRERIAPDVDTY--------------------
A0A5F4WGS2_BCL2L10      WGNVVMLLAFAGTL------------------------------------
F7CT87_BCL2L10-01       WGNVVMLLAFAGTL------------------------------------
F7GTF7_MCL1-02          WGRIVTLISF----------------------------------------
A0A2R8MY14_BCL2-01      WGRIVAFFEFGGVMCVESVNREMSPLV-------DNIALWMTEYLNRHLH
F7IT36_BCL2L1-01        WGRIVAFFSFGGALCVESVDKEMQVLV-------SRIAAWMATYLNDHLE
F7GTF7_MCL1-01          ------------ALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRA
U3CRF8_BCL2L2-01        WGRLVAFFVFGAALCAESVNKEMEPLV-------GQVQEWMVAYLETRLA
U3CRF8_BCL2L2-02        SG------------APGSQEEEEEPGLVEGDPGDGAIED-----------
                                                                          

F7HXW0_BCL2A1-01        --------------------------------------------------
A0A5F4WGS2_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2R8MY14_BCL2-01      TWIQDNGGWDA--------------------------FVELYGPSM----
F7IT36_BCL2L1-01        PWIQENGGWDT--------------------------FVELYGNNAAAE-
F7GTF7_MCL1-01          APLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSS
U3CRF8_BCL2L2-01        DWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAG-
U3CRF8_BCL2L2-02        --------PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAG-
                                                                          

F7HXW0_BCL2A1-01        --------------------------------------------------
A0A5F4WGS2_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2R8MY14_BCL2-01      -----------------------------------------RPLFDFSWL
F7IT36_BCL2L1-01        -------------------------------------SRKGQERFNRWFL
F7GTF7_MCL1-01          TDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGAA
U3CRF8_BCL2L2-01        ---------PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSV
U3CRF8_BCL2L2-02        ---------PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSV
                                                                          

F7HXW0_BCL2A1-01        --------------------------------------------------
A0A5F4WGS2_BCL2L10      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
A0A2R8MY14_BCL2-01      SLKTLLSLV-----------------------------------------
F7IT36_BCL2L1-01        TGMTVAGVV-----------------------------------------
F7GTF7_MCL1-01          SRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
U3CRF8_BCL2L2-01        NRVTILCDK-------------FSGHPKGFAYIEFSDKESV---------
U3CRF8_BCL2L2-02        NRVTILCDK-------------FSGHPKGFAYIEFSDKESV---------
                                                                          

F7HXW0_BCL2A1-01        -------------------------------------------KEISHFV
A0A5F4WGS2_BCL2L10      ------------LERGPLVTARWKKWGFRSWLKEPEGDVARDCQRLVALM
F7CT87_BCL2L10-01       ------------LERGPLVTARWKKWGFQSRLKEPEGDVARDCQRLVALL
F7GTF7_MCL1-02          ---------------GAFVAKHLKTINQESCI-----------EPLAESI
A0A2R8MY14_BCL2-01      -------LVGACITLGAYLGHK----------------------------
F7IT36_BCL2L1-01        -------L------LGSLFSRK----------------------------
F7GTF7_MCL1-01          DGVTNWGRIVTLISFGAFVAKHLKTINQESCI-----------EPLAESI
U3CRF8_BCL2L2-01        -------RTSLALDESLFRGRQIKVIPKRTNR-----------PGISTTD
U3CRF8_BCL2L2-02        -------RTSLALDESLFRGRQIKVIPKRTNR-----------PGISTTD
                                                                          

F7HXW0_BCL2A1-01        AEFIMNNTGEWIRQNGGWGKWHSLMLMLVSVAQKKRKMAL----------
A0A5F4WGS2_BCL2L10      SPRLVGQHRAWLEAQGGWDGFCYFFRTSYSLALWRKLLVQVFLSWLLTAA
F7CT87_BCL2L10-01       SSRLVGQHRAWLEAQGGWDGFCYFFRTSSLLALWRKVLVQVFLSWLLTAV
F7GTF7_MCL1-02          TDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLL-AFAGVAGVGA
A0A2R8MY14_BCL2-01      --------------------------------------------------
F7IT36_BCL2L1-01        --------------------------------------------------
F7GTF7_MCL1-01          TDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLL-AFAGVAGVGA
U3CRF8_BCL2L2-01        RGF---PRARYRARTTNYNSSRSRF----------------YSGFNSRPR
U3CRF8_BCL2L2-02        RGF---PRARYRARTTNYNSSRSRF----------------YSGFNSRPR
                                                                          

F7HXW0_BCL2A1-01        -----------------
A0A5F4WGS2_BCL2L10      FIYFWTR----------
F7CT87_BCL2L10-01       FIYFWTR----------
F7GTF7_MCL1-02          GLAYLIR----------
A0A2R8MY14_BCL2-01      -----------------
F7IT36_BCL2L1-01        -----------------
F7GTF7_MCL1-01          GLAYLIR----------
U3CRF8_BCL2L2-01        GRVYRGRARATSWYSPY
U3CRF8_BCL2L2-02        GRVYRGRARATSWYSPY
                                         

© 1998-2022Legal notice