Dataset for protein Bcl-w of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : . ...  .   *..  * *:*  .***.....   .    .:*:*.      .:*  :    * . :: 
MAtpAsApdtrglvggrvsyplRrrhyVpGtG--pGEGppggplhygnrleseElEt------seLllqphvtPgseqqr
  aa a aaaaaaaadfgggkg qkgl c a gea   aaadagdqamgaagd f prfrrtfed aaelepe epaeep

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :     * **. *            .. * ::* ** :       * :::                    ******
ptqvspplfqG-GPnwG------------cpgSvnkEmEPlv-------Gqvqe-------------------wELEAIK
frpradegap p  gs rlvaffvfgaalaae qee e  glvegdpgd aiedwmvayletrladwihssggp      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTI
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSG
                                                                                

       330       340   
....:....|....:....|...
***********************
FNSRPRGRVYRGRARATSWYSPY
                       
© 1998-2020Legal notice