Dataset for protein Bcl-w of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3CRF8_BCL2L2-02      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
U3CRF8_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGYVCGTG--PGEGPAADPLHQAMRA
                      **:.*:*. : . ...  .   *..  * *:*  .***.....   .   

U3CRF8_BCL2L2-02      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
U3CRF8_BCL2L2-01      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
                       .:*:*.      .:*  :    * . ::     :     * **. *   

U3CRF8_BCL2L2-02      ---------APGSQEEEEEPGLVEGDPGDGAIED----------------
U3CRF8_BCL2L2-01      AFFVFGAALCAESVNKEMEPLV-------GQVQEWMVAYLETRLADWIHS
                               .. * ::* ** :       * :::                

U3CRF8_BCL2L2-02      ---PELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
U3CRF8_BCL2L2-01      SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSI
                          **********************************************

U3CRF8_BCL2L2-02      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
U3CRF8_BCL2L2-01      EEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
                      **************************************************

U3CRF8_BCL2L2-02      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
U3CRF8_BCL2L2-01      GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPR
                      **************************************************

U3CRF8_BCL2L2-02      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
U3CRF8_BCL2L2-01      ARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                      *******************************************

© 1998-2020Legal notice