Dataset for protein Bcl-xL of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSAINGNPSWHLADSPVVNGATGHSSSLDAREV
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
****************************   :::  : ::** ...:  ::   :                  
VLVSRIAAWMATYLNDHLEPWIQENGGW---vkvygqnssAEsrwgqgrynrwsl------------------
                            dtfmelifniaa  iqkdnedfhllfitgmtvagvvllgslfsrk
© 1998-2022Legal notice