Dataset for protein Bcl-xL of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8I3ZZI7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSA
A0A8I3ZZI7_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSA
                        **************************************************

A0A8I3ZZI7_BCL2L1-      INGNPSWHLADSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A8I3ZZI7_BCL2L1-      INGNPSWHLADSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                        **************************************************

A0A8I3ZZI7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A8I3ZZI7_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        **************************************************

A0A8I3ZZI7_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A8I3ZZI7_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW---MKVIFQISS
                        **************************************   :::  : ::

A0A8I3ZZI7_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A8I3ZZI7_BCL2L1-      AEIQWDNGDYHLLSI------------------
                        ** ...:  ::   :                  

© 1998-2023Legal notice