Dataset for protein Bcl-xL of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7IT36_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSA
F7IT36_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTDSEMETPSA
                      **************************************************

F7IT36_BCL2L1-02      INGNPSWHLADSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
F7IT36_BCL2L1-01      INGNPSWHLADSPVVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

F7IT36_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
F7IT36_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

F7IT36_BCL2L1-02      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW---MKVIFQISS
F7IT36_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                      **************************************   :::  : ::

F7IT36_BCL2L1-02      AEIQWDNGDYHLLSI------------------
F7IT36_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                      ** ...:  ::   :                  

© 1998-2022Legal notice