Dataset for protein BCL-2-like of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
               : :                          :              :  *      .    .     
mensynrnlvlkyirhklsvtlfvwnprvvqessny---sv---t--dpeptvvttkrmtrt vtpststhsktrryqsp
  meq  ei ef-mi g fq gyplihnhdntpdartn giavvaslhe hrlpsrcngafg tshgspaelcrq qrrd
              c          gfi  h ea and  a     f    didhhaie    pdgean ag q  p q 

        90       100       110       120       130       140       150       160
.                                                                .:.    :.   :  
 httdldgckc  qsdiagrkmk cg        wk  lv aedy s cctsph appppsesaev  dlan i lq ap
         h                                                      a    a d f  l  a

       170       180       190       200       210       220       230       240
 :  :   : :            * ..:. *   ****::.:: * ..:.               .:   .      : :
rftnlssqfhvtsstayrrs-rn mdevvr g-v    viglfe tatlcvecveqkpgldprqqsne-mspqscrriae
d se hrt liqpgpdqql lek i       hl      a      a arkil           qkl qesm  gnlvd
  dd aq     ca  hc   ae                              a           e      l  d    

       250       260       270       280       290       300       310 
 :: **    . *: .:..*: * ::       .  :    :  :       .                  
wmtv  nnplqs lqdqga er cklygs-revsrdavssrswpsiktvllvamlvvtvv-sgayl-qkrl
t ae  gghknp  ls   a a isdr    qqa smkkaqf a kwg l l glasrviwstit    
   d  de ik                 q      ef c  e     f a   f  gltg dl f    
                                                            rc  a a    
© 1998-2022Legal notice