Dataset for protein BCL-2-like of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8P0F1_BCL2L1-      --MSQNRELVLFYIRYKLSQRNYPLNHIVLNEPSNRTDGGA---AGLDEE
A0A3P8QVM8_BCL2-01      MENEYNRNIVEKYICHKLSKRGFVWGFRVVQEEDAANNGSI---T--DPP
A0A3P8NP63_MCL1-02      ------------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSP
A0A3P8NP63_MCL1-01      ------------MANYMMLKRNQCTLMEYLIPQNGVLEGPMHYGSGNSSP
A0A3P8PVZ8_BCL2L10      -------------MIYGLFVTLFCTIPNHDHTSAGY---SVAVVSSFHSP
                                       : :                          :     

A0A3P8P0F1_BCL2L1-      QRIDTHANGTFNGTSPGTPPASPQRRQQQPPSTTDLDAVK----------
A0A3P8QVM8_BCL2-01      PTLVHRCREASTGPDGESNTHLCRRLPQSDPHA----GIH----------
A0A3P8NP63_MCL1-02      QNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPS
A0A3P8NP63_MCL1-01      QNATGSSKDSSNGIVSNGTPKRPDNLEVTSTNGYKTKAIRDREEDGSLPS
A0A3P8PVZ8_BCL2L10      HDVPSTKIMSRGGVTHSASAEGKTQLYRRSPSA----VCMCREQSDIAGR
                                 :  *      .    .     .                   

A0A3P8P0F1_BCL2L1-      --------------------------------------------EALRDT
A0A3P8QVM8_BCL2-01      --------------------------------------------RVLREA
A0A3P8NP63_MCL1-02      TPEFHSDSESDEQLERETKLLIHSFLG-DFIGLSQPQRKETKALKTMKRV
A0A3P8NP63_MCL1-01      TPEFHSDSESDEQLERETKLLIHSFLG-DFIGLSQPQRKETKALKTMKRV
A0A3P8PVZ8_BCL2L10      KMKFCG-------LWKETLVLAEDYLSFCCTSPHQAPPPPSESAAAMRRL
                                                                     .:.  

A0A3P8P0F1_BCL2L1-      ANEFELRYARAFSDLHSQLHITPATAYQSF-ENVMDEVFRDG-VNWGRIV
A0A3P8QVM8_BCL2-01      GDELERLYQPDFTEMSRQLHLTSSTAQRRF-AEVIDELFRDG-VNWGRII
A0A3P8NP63_MCL1-02      VADVLEKHRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIV
A0A3P8NP63_MCL1-01      VADVLEKHRYAYNGMINKLSLDERDEDMSFVGAVAKSLFGDHTTNWGRIV
A0A3P8PVZ8_BCL2L10      GWDIERQHQARFDNLAQTFLVQCGPDHCLSLRKVMKELVGDGHLNWGRVV
                          :.   :   :  :   : :            * ..:. *   ****::

A0A3P8P0F1_BCL2L1-      GLFAFGGALCVECV-----------EKE-MSPL-VGRIVEWMTVYLDNHI
A0A3P8QVM8_BCL2-01      AFFEFGGTVCVECA-----------SNEGMSSQ-VDNIADWMTEYLNGPL
A0A3P8NP63_MCL1-02      SFMAFGAVVSQHL------------KEKGRDNY-VALVSQEISAYLLSEQ
A0A3P8NP63_MCL1-01      SFMAFGAVVSQHL------------KEKGRDNY-VALVSQEISAYLLSEQ
A0A3P8PVZ8_BCL2L10      SLFAFTGVLARKILEQKPGLDPRQQQELGQEPMSCRRLAETIADYLGEEK
                        .:: * ..:.               .:   .      : : :: **    

A0A3P8P0F1_BCL2L1-      QPWIQSQGGWERFAEIFGQ----DAAAESRRSQESFKKWLLVGMTVVTGV
A0A3P8QVM8_BCL2-01      NSWIQDNGGWDAFVELYDR----QRDSVFSCSWPSIKTVFGLAALGAASL
A0A3P8NP63_MCL1-02      RDWIVKNNAWDGFVEFFRVA---DPESIVRHTLMAFAGFAGIGATLALLI
A0A3P8NP63_MCL1-01      RDWIVKNNAWDGFVEFFRVA---DPESIVRHTLMAFAGFAGIGATLALLI
A0A3P8PVZ8_BCL2L10      KDWLLDNDGWEGFCKFSRSAREVSQDSSMKKALFAAAGVGLAGLTFLLVR
                        . *: .:..*: * ::       .  :    :  :       .       

A0A3P8P0F1_BCL2L1-      VAGALIAQKRL
A0A3P8QVM8_BCL2-01      TIGAYLTQK--
A0A3P8NP63_MCL1-02      RS-STIF----
A0A3P8NP63_MCL1-01      SCWDALL----
A0A3P8PVZ8_BCL2L10      -----------
                                   

© 1998-2020Legal notice