Dataset for protein Bcl-2 of organism Apteryx owenii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAALAAAGTSSDHTGLVSPHPEPPGSAAASNAA
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PGDGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGSVMCVES
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************************:  *    :  * ::*:       :* **                 
VNREMSPLVDSIATWMTEYLNRHLHTWIQDNGGWq--VtpyrnsrRpvlDl-------sWrSLp----------------
                                  daf elsghhm dlf frqtlrspa i  ktilslvlvgacitlga

         
....:....
   *.    
---Hr----
ylg kdvgv
© 1998-2022Legal notice