Dataset for protein Bcl-2 of organism Apteryx owenii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9PRT7_BCL2-02      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAA
A0A8B9PRT7_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAASGDRAPASPGLSPPAAAA
                        **************************************************

A0A8B9PRT7_BCL2-02      LAAAGTSSDHTGLVSPHPEPPGSAAASNAAPGDGLRPAPPVVHLALRQAG
A0A8B9PRT7_BCL2-01      LAAAGTSSDHTGLVSPHPEPPGSAAASNAAPGDGLRPAPPVVHLALRQAG
                        **************************************************

A0A8B9PRT7_BCL2-02      DEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFF
A0A8B9PRT7_BCL2-01      DEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFF
                        **************************************************

A0A8B9PRT7_BCL2-02      EFGSVMCVESVNREMSPLVDSIATWMTEYLNRHLHTWIQDNGGWQ--VTP
A0A8B9PRT7_BCL2-01      EFGSVMCVESVNREMSPLVDSIATWMTEYLNRHLHTWIQDNGGWDAFVEL
                        ********************************************:  *  

A0A8B9PRT7_BCL2-02      SRHHRRDVLDLRQTLRSPAWRSLP-------------------HRDVGV
A0A8B9PRT7_BCL2-01      YGNSMRPLFDF-------SWISLKTILSLVLVGACITLGAYLGHK----
                          :  * ::*:       :* **                    *.    

© 1998-2023Legal notice