Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------r-lvady-gy-l---g---g---------------------gpg--s
mpllvrnpyihlslsslpliaarmatpasfpdt-l-r-afl--k-yqk-yvc-lfsdvgenrtgappatgskst---gre
 fg qlcav gan ycggaglgmgmggctagmfgaq-n--irlngripwgsasa g  eaappe aegpdifmskamtq-
            h         aasddrmsyynhnitqnvvsav scgp pwdq                aedettshtr
                        ha leqrtiveaavklah c qar  erlt                    q  app
                            rpqsqmv  tga e a a e   k s                    e   in
                             g gg    m   a                                      
                               fe    l                                          
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g--------------------------------pa--p----lr-agd-vggrlrrtfsellaqlhitpgdavqsftqvv
-paaprnpvwrtspsppvngptghstspdlspv--ts-lhqa--a---efetnyek--kd-s--rdvknkengkrisrsa
s     d sshladp apaaaaaaasglaare gpapkvssvmqkvafs-qrmflaal--m-sn-e-ggitdqrvlggqs
r                                tgsdatlrtsntmltgspklv--seqpaarmv-nvsesryemvfs-m
e                                atpv aaeyn rkirtq--eh twrpgctdk nly fn aalae-m-
                                 rhvt sqmwk qgcepcsl-- sf aaypg    a    rvg atg 
                                 i nr nklc  p  ad r  i md   v            g  y   
                                   ma e a   l     k                         p   
                                   l        g                                   
                                            e                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :                                                       
gelf-d--gpnwgrivtffsfgaalck--------------esvtkemeplvg---------riaewmvfylvtrlad--
v---sgdgvts-----al----gfvaprgplvtarwkkwgfhlrrinq-scietlaevpdytqvqyrvtafaprtrreqh
dhveraspsvp  nl --iv eeimvv              dakn---q-d-da   sirvkplssslaevinnhkga  
ndklqeg iit   v misa a v ia              kel-vvrpv- -p       setpgfildlreentep  
maygf-  l-        le   t te              q -deriagp s         a-ca--wt emdpe--  
e   n    e             e l                  lr ps   a         -w-- cel  ssd vt  
-                        e                                    nsdq          pg  
                                                              gd l          h   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--wiee--------------------------------------------------------------------------
raplvspglvegdpgdgameapaadaimspeeeldgyepeplgkrpavlpllelvpepgngsstdgslpstppvimsiee
  --qk            sggwele  karvr meeeaeklkelqne ekqmnmsgp   ag           paeee d
   ehq            i d              r                   e    d                   
    s-                                                                          
    -d                                                                          
     a                                                                          
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .                                                                          
---nggwdi-----------fvelygvgatgeer----r-eg-----r-vltgl--vg----------------------
kmyqrsleggfvkkfepksgisrflreqdlegklvytk-frrsgasv-ta-l--rv--apkgfayiefsdkdgvqrnlvl
elesqarat           ytayfhye--aa-dlsrlpmk-nwsaslk-i-taaraavlekt gpg pvmesnrtshlt
   rd isn           wrgnvdn-ga--s-kgqahvhncirvnkwtfecmvfs hm           vv ssi ag
   at  ve           mm----dnmvrvgiaalslrgyqllwl vl saftcl gg                  ia
   -   rs           llt al-t kltas  epkqdmgegn  lf qldlag i                     
   e    k            hs  eps  ictm  aie -fa  f     advkl  c                     
        a                  a    d    e  y              g                        
                                        n                                       
                                        a                                       

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lgtaf---------------------------------------------------------------------------
-esl-rgkqikvdiknfiyvsstsvvmvhlpkrtprrwgrivtlisfgafvakhlktinistcdrgfprcrtdyrarttn
h---yqsrvrgl f aeddskllqr    ifcdgntpg                     hqktaaplceac  vlv  kr
vslilsrwlc                   v s rv n                      qes ie  a si         
ddafilim                                                                        
a  yhavf                                                                        
     ih                                                                         
     g                                                                          
                                                                                
                                                                                

       490       500       510       520         
....:....|....:....|....:....|....:....|....:....
                                                 
-------------------------------------------------
ywssrsrswsgfnsrprgrvyrgraratswyspyvagvgaglalslihi
dnlvkq fyf ivnkihvedle gi nvllafag               
       g d  seffal                               
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
© 1998-2022Legal notice