Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------r-l--------------------------------------------
mfglqrnaviglnlyclpaglgrmsggatppgg-l-vtdkeayklrqvgygeagaviggsagasppaalvpdarrvvrpp
 pl vlcpy has ssggliaaagatptsaydt eiaaefvgsaqsek gswsqvsdveenrtgaspgttsfsstpshtn
        l   h   ew    tahd rrsrtn a  vkyls     r  e dafg   a ppe ae pgiemeq gai 
                      m  a lmqqse    m  ih                           d          
                             g           e                                      
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------e-p----------------------------------------------
pigaevppvtatpsrplffaptrraappgem-a-aadaimspeeeldgyepeplgkrpavlpllelvgepgngsstdgsl
gpa prndswrsspslwvngaavcstgletspvipvtpvh       r                   e    d      m
      d  shlcgpcppa   ghgss dlr g  sa lk                                        
          g ad  a     aa qe aap s  m  ea                                        
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------etlr-vgdgvqrrherafsgmlrq------
pstppgyihnltqlyrryleiisrylreqatgakdtkpmgrsgaasskal----raafsfeknyrttlqdlasnwrppvp
tdcefpaeeeededllqsvlq ppgp ll          dq etgpr tsqvmqa--aeystlvlksskpc-dk      
   m  fqvvirln  t cga                        n    ra  kms-mwrnefispq---va-      
                                                  l   q nqdcpltkcmfcpvyt-r      
                                                  a   g  e  n pg fd aewsgg      
                                                      e     k  a     a ic       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               *                                                
--lhitpgdavqs-fsqvmeelfsd--Gv-nWgrivtlfsfggflck--------------esvtkemepcvep------
smvd-kn-tn-kril-r----vprrsprptr ----afia--aavavrgplvtarwkkwgfhlkninqqslidrlaesir
  --v--k-dy--f-t-mvvhe-qg   irt  nl ---- e-----              ------iavdaat      
   nnvsis-qrm yet snk-le-    i    v misv a imia              k lrerhsk  sq      
    ly enragl va  ada  c              le   v le              q rdr p g  gg      
       f  re           -                   t                    l        n      
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . .                                                   
---iaewmteylvrtl-d----Wi--nggWdg-fvelyg------------------l--ftvltgvlagga--------
ykelcysvadv-n-rkr-qhra-lvksrsiatg------vealeggrrnrlrfngnw-svralva--gv-l-ylirryyg
 srvsrfivafi-th-gp     -qsq   fn mtaffhpndaaesikgqelverwvala-l---la--l-vlskkqkpa
   fqacc---rmn-tee      sqe   ve isnkiengs r a   vs affsgwwll-gasvsvleslsqrtagm 
   wdqrletl edn at      he    rs  rk  adsm   t   ap  dagigttmwc qdmttamimele    
   d l   f  ssd vg      ed    ek       lk            a  f msk f g liihicf       
     g       e  h        a     a                          hgg e   k cda a       
                                                          g                     

       410       420 
....:....|....:....|.
                     
---------------------
lpvmvvnssihvtlgaffask
f          llvdtylsrf
           i   slirh 
                i g  
                     
                     
                     
© 1998-2020Legal notice