Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------r-l--------------------------------------------
mfglqrnaviglnlyclpaglgrmsggatppgg-l-vtdkeayklrqvgygeagaviggsagasppaalvpdarrvvrpp
 pl vlcpy has ssggliaaagatptsaydt eiaaefvgsaqsek gswsqvsdveenrtgaspgttsfsstpshtn
        l   h   ew    tahd rrsrtn a  vkyls     r  e dafg   a ppe ae pgiemeq gai 
                      m  a lmqqse    m  ih                           d          
                             g           e                                      
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------e-p----------------------------------------------
pigaevppvtatpsrplffaptrraappgem-a-aadaimspeeeldgyepeplgkrpavlpllelvgepgngsstdgsl
gpa prndswrsspslwvngaavcstgletspvipvtpvh       r                   e    d      m
      d  shlcgpcppa   ghgss dlr g  sa lk                                        
          g ad  a     aa qe aap s  m  ea                                        
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------etlr-vgdgvqrrherafsgmlrq------
pstppgyihnltqlyrryleiisrylreqatgakdtkpmgrsgaasskal----raafsfeknyrttlqdlasnwrppvp
tdcefpaeeeededllqsvlq ppgp ll          dq etgpr tsqvmqa--aeystlvlkssk-c-dk      
   m  fqvvirln  t cga                        n    ra  kms-mwrnefispq-p-va-      
                                                  l   q nqdcpltkcmfcpeyt-r      
                                                  a   g  e  n pg fd aawsgg      
                                                      e     k  a       ic       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--lhitpgdavqs-fsqvmeelfsdg-vtnwgrivtlfsfggflck--------------esvtkemeplvep-------
smvd-kn-tn-kril-r---------pg-------afia--aavavrgplvtarwkkwgfhlkninq-scidrlaesiry
  --v--k-dy--f-t-mvvhvlrgs -pt  nl ---- e-----              -------q-d---       
   nnvsis-qrm yet snke q   iv    v misv a imia              k lreriav- st       
    ly enragl va  ada  e    i        le   v le              q rdr psg  gq       
       f  re                              t                    l       an       
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         .                                                      
--iaewmteylvrrlrd----Wi-kqggwdg-fvelyg--a-eg------------l--ftvltgvlagga---------
kel--svadvpnttkgrqhra-lvsnrcaatg----f-ve-l--grrnrlrfngnw-svralva--gv-l-ylirryygl
sr-syfivalimnhtep     -qqsk ivn mtrf-hsrswfesikgqelverwvala-l---la--l-vlskkqkpaf
  vqa----frednpae      she   re  caccwpndaa asnkvs affsgwwll-gasvsvleslsqrtagm  
  wdqrlet  csg --      he    es  rkk engm r t   ip  dagigttmwc qdmttamimele     
  dcl   f  sed vt      e-     k       ds    i   aa  a  f msk f g liihicf        
    g          hg       d     a        k                 hgg e   k cda a        
                        a                                g                      

       410       420
....:....|....:....|
                    
--------------------
pvmvvnssihvtlgaffask
          llvdtylsrf
          i   slirh 
               i g  
                    
                    
                    
© 1998-2020Legal notice