Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      ---------------------------------MAAAAAAAAAAGAAGG-
A0A2K5C7L5_MCL1-01      -------------------------------MFGLQRNALIGLNLYCEW-
A0A2K5CFB8_MCL1-03      -------------------------------MFGLQRNAVIGLNLYCGG-
A0A2K5CFB8_MCL1-01      -------------------------------MFGLQRNAVIGLNLYCGG-
A0A2K5EB04_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A2K5EBP4_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K5CFB8_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGA----------
A0A2K5F974_BCL2L10      -----------------------MADPLRQRTER-LVADYLEY-------
A0A2K5CWY6_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5DMS4_MCL1-01      ----------------------------MFGFQVVIRLNL--YCGAIPPG
A0A2K5D2I1_BCL2A1-      ------------------------MTDCEFGYIHNLTQDYLRYVLQIP--
A0A2K5D2I1_BCL2A1-      ------------------------MTDCEFGYIHNLTQDYLRYVLQIP--
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      VCGA--------------------GPG--EG-------------------
A0A2K5CWY6_BCL2L2-      -RGS--------------------GPG--RR-------------------
A0A2K5C7L5_MCL1-01      -AGL--------------------GTG--SG-------------------
A0A2K5CFB8_MCL1-03      -AGL--------------------GAG--SG-------------------
A0A2K5CFB8_MCL1-01      -AGL--------------------GAG--SG-------------------
A0A2K5EB04_BCL2-01      EWDA-GDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVSRTSPPPPPAA
A0A2K5EBP4_BCL2L1-      SWSQFSDVEENRTEAPEGTDSEMETPSAING-----NPSWHLADSPAVNG
A0A2K5CFB8_MCL1-02      -KDT--------------------KPMGRSG-------------------
A0A2K5F974_BCL2L10      -CSQ--------------------EPGTPES-------------------
A0A2K5CWY6_BCL2L2-      VCGA--------------------GPG--EG-------------------
A0A2K5CWY6_BCL2L2-      VCGA--------------------GPG--EG-------------------
A0A2K5DMS4_MCL1-01      PRLL-------------ATGAKDTKPMGRSE-------------------
A0A2K5D2I1_BCL2A1-      ----------------------------QSG-------------------
A0A2K5D2I1_BCL2A1-      ----------------------------QSG-------------------
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPG
A0A2K5EPX0_MCL1-02      ------------------SQSYNNLKITTC--MLRK--------LDIKNK
A0A2K5EPX0_MCL1-01      ------------------NASCSRPACFSSPGMLRK--------LDIKNK
A0A2K5CWY6_BCL2L2-      -------------PAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
A0A2K5CWY6_BCL2L2-      -------------RHLVP------------G----------------AGG
A0A2K5C7L5_MCL1-01      -------------GTTPP------------GGRLLATEKEASAQREVGGG
A0A2K5CFB8_MCL1-03      -------------GATPP------------GGRLLATEKEASAQREVGGG
A0A2K5CFB8_MCL1-01      -------------GATPP------------GGRLLATEKEASAQREVGGG
A0A2K5EB04_BCL2-01      PAAAATGPALSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
A0A2K5EBP4_BCL2L1-      ATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPG
A0A2K5CFB8_MCL1-02      -------------AASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
A0A2K5F974_BCL2L10      -------------PPSTAEAAVLRAMAAGVRKLYRSFFSAYLG----YPG
A0A2K5CWY6_BCL2L2-      -------------PAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
A0A2K5CWY6_BCL2L2-      -------------PAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
A0A2K5DMS4_MCL1-01      -------------AANSKALETLRGVGEGVPRNHEMALQGMLRNLDNKNE
A0A2K5D2I1_BCL2A1-      -------------TGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSI
A0A2K5D2I1_BCL2A1-      -------------TGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSI
                                                                          

A0A2K5EBP4_BCL2L1-      TAYQSFEQVVNELFRD-GV-NWGRIVAFFSFGGALCV-------------
A0A2K5EPX0_MCL1-02      DDVKSLSRVMVHVFSD-GVTNWGRIVTLISFGAFVAK-------------
A0A2K5EPX0_MCL1-01      DDVKSLSRVMVHVFSD-GVTNWGRIVTLISFGAFVAK-------------
A0A2K5CWY6_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5CWY6_BCL2L2-      EAGEGAPGGAGDYGNG--LES-----------EELEP-------------
A0A2K5C7L5_MCL1-01      EAGVVIGGSAG----A--SPS-----------AALTP-------------
A0A2K5CFB8_MCL1-03      EAGAVIGGSAG----A--SPP-----------AALVP-------------
A0A2K5CFB8_MCL1-01      EAGAVIGGSAG----A--SPP-----------AALVP-------------
A0A2K5EB04_BCL2-01      TARGRFATVVEELFRD--GVNWGRIVAFFEFGGVMCV-------------
A0A2K5EBP4_BCL2L1-      TAYQSFEQVVNELFRD--GVNWGRIVAFFSFGGALCV-------------
A0A2K5CFB8_MCL1-02      DDVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK-------------
A0A2K5F974_BCL2L10      NRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGPLVTARWKKWG
A0A2K5CWY6_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5CWY6_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5DMS4_MCL1-01      DNVKSFY----------GVTNWGRIVTLSSFGAFVAK-------------
A0A2K5D2I1_BCL2A1-      DNARMIFSQVMEKEFEDGIINWGRIVTIFAFEGILIK-------------
A0A2K5D2I1_BCL2A1-      DNARMIFSQVMEKEFEDGIINWGRIVTIFAFEGILIK-------------
                                                          :               

A0A2K5EBP4_BCL2L1-      -ESVDKEMQVLVS---------RIAAWMATYLNDHLEP----WIQE----
A0A2K5EPX0_MCL1-02      -HLKTINQESCIE---------PLAESITDVLVRTKRD----WLVK----
A0A2K5EPX0_MCL1-01      -HLKTINQESCIE---------PLAESITDVLVRTKRD----WLVK----
A0A2K5CWY6_BCL2L2-      -ESVNKEMEPLVG---------QVQEWMVAYLETRLAD----WIHS----
A0A2K5CWY6_BCL2L2-      -EE-------------------------LLLEPEPEPE----PEEEPGLV
A0A2K5C7L5_MCL1-01      -DAR------------------GSCGRCWFFAPTRRAA----PLEE----
A0A2K5CFB8_MCL1-03      -DARRVVRPPPIGA--EVPDVTATPSRLLFFAPTRRAA----PLEE----
A0A2K5CFB8_MCL1-01      -DARRVVRPPPIGA--EVPDVTATPSRLLFFAPTRRAA----PLEE----
A0A2K5EB04_BCL2-01      -ESVNREMSPLVD---------NIALWMTEYLNRHLHT----WIQD----
A0A2K5EBP4_BCL2L1-      -ESVDKEMQVLVS---------RIAAWMATYLNDHLEP----WIQE----
A0A2K5CFB8_MCL1-02      -HLKTINQESCIE---------PLAESITDVLVRTKRD----WLVK----
A0A2K5F974_BCL2L10      FQSRLKEPEGDVA---------RDCQRLVALLSSRLVGQHRAWLEA----
A0A2K5CWY6_BCL2L2-      -ESVNKEMEPLVG---------QVQEWMVAYLETRLAD----WIHS----
A0A2K5CWY6_BCL2L2-      -ESVNKEMEPLVG---------QVQEWMVAYLETRLAD----WIHS----
A0A2K5DMS4_MCL1-01      -HLKTINQESCIEPLAESIRYSRWDGFVEFFRVEDL--------------
A0A2K5D2I1_BCL2A1-      -KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQ----
A0A2K5D2I1_BCL2A1-      -KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQ----
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------SGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K5CWY6_BCL2L2-      EGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K5C7L5_MCL1-01      --------MEAPAADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEPGN
A0A2K5CFB8_MCL1-03      --------MEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGN
A0A2K5CFB8_MCL1-01      --------MEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGN
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5CFB8_MCL1-02      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      -----------------------NGGWDT-----------FVELYGNNAA
A0A2K5EPX0_MCL1-02      -----------------------QRGWDG-----------FVEFFHVEDL
A0A2K5EPX0_MCL1-01      -----------------------QRGWDG-----------FVEFFHVEDL
A0A2K5CWY6_BCL2L2-      AG----------PVIMSIEEKMEADARSI-----------YVGNVDYGAT
A0A2K5CWY6_BCL2L2-      AG----------PVIMSIEEKMEADARSI-----------YVGNVDYGAT
A0A2K5C7L5_MCL1-01      DSSTDGSLPSTPP-----------TSLEI-----------ISRYLREQAT
A0A2K5CFB8_MCL1-03      GSSTDGSLPSTPPPAEEEEDELYRQSLEI-----------ISRYLREQAT
A0A2K5CFB8_MCL1-01      GSSTDGSLPSTPPPAEEEEDELYRQSLEI-----------ISRYLREQAT
A0A2K5EB04_BCL2-01      -----------------------NGGWDA-----------FVELYGPSM-
A0A2K5EBP4_BCL2L1-      -----------------------NGGWDT-----------FVELYGNNAA
A0A2K5CFB8_MCL1-02      -----------------------QRGWDG-----------FVEFFHVEDL
A0A2K5F974_BCL2L10      -----------------------QGGWVS-----------MR--------
A0A2K5CWY6_BCL2L2-      -----------------------SGGWAE-----------FTALYGDGAL
A0A2K5CWY6_BCL2L2-      -----------------------SGGWAE-----------FTALYGDGAL
A0A2K5DMS4_MCL1-01      -----------------------EGGIRN----------GLLAFAGVAGV
A0A2K5D2I1_BCL2A1-      -----------------------NGGWAK-----------WHSLLLV---
A0A2K5D2I1_BCL2A1-      -----------------------NGGWENGFVKKFEPKSGWMTFLEVTGK
                                                 .                        

A0A2K5EBP4_BCL2L1-      AESR------KGQERFNRWFLTGMTVAGV-------------------VL
A0A2K5EPX0_MCL1-02      EGGI------RN-------VLLAFACVAG-------------------VG
A0A2K5EPX0_MCL1-01      EGGI------RN-------VLLAFACVAG-------------------VG
A0A2K5CWY6_BCL2L2-      AEEL--EAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLAL
A0A2K5CWY6_BCL2L2-      AEEL--EAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLAL
A0A2K5C7L5_MCL1-01      GAKD--TKPMDRSGAASRKALETLRRVG-------------DGVQRN---
A0A2K5CFB8_MCL1-03      GAKD--TKPMGRSGAASRKALETLRRVG-------------DGVQRN---
A0A2K5CFB8_MCL1-01      GAKD--TKPMGRSGAASRKALETLRRVG-------------DGVQRN---
A0A2K5EB04_BCL2-01      ------RPLFDFSWLSLKTLLSLALVGAC-------------------IT
A0A2K5EBP4_BCL2L1-      AESRKGQERFN------RWFLTGMTVAGV-------------------VL
A0A2K5CFB8_MCL1-02      ----------EGGIRNVLLAFAGVAGVGAG------------------LA
A0A2K5F974_BCL2L10      RGTR--ASRVAGNIGWLLLLLQDLLLAGIMEKTAGPGFPVMVVNSSIHLL
A0A2K5CWY6_BCL2L2-      EEAR--RLR-EGNWASVRTVLTGAVALGAL------------------VT
A0A2K5CWY6_BCL2L2-      EEAR--RLR-EGNWASVRTVLTGAVALGAL------------------VT
A0A2K5DMS4_MCL1-01      GTDLAYLIR-----------------------------------------
A0A2K5D2I1_BCL2A1-      LVESVAQKERKMAL------------------------------------
A0A2K5D2I1_BCL2A1-      ICEMLSLLKQYY--------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      LGSLFSRK------------------------------------------
A0A2K5EPX0_MCL1-02      AGLAYLIR------------------------------------------
A0A2K5EPX0_MCL1-01      AGLAYLIR------------------------------------------
A0A2K5CWY6_BCL2L2-      DESLFRGRQIKVDFKAFIYSSLTQV----IPKRTNRPG------------
A0A2K5CWY6_BCL2L2-      DESLFRGRQIKV-----------------IPKRTNRPG------------
A0A2K5C7L5_MCL1-01      HETAFQV----------------------LPCRRPRRW------------
A0A2K5CFB8_MCL1-03      HETAFQGWVCGV-----------------LPCRGPRRW------------
A0A2K5CFB8_MCL1-01      HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAF
A0A2K5EB04_BCL2-01      LGAYLGHK------------------------------------------
A0A2K5EBP4_BCL2L1-      LGSLFSRK------------------------------------------
A0A2K5CFB8_MCL1-02      LSLIHI--------------------------------------------
A0A2K5F974_BCL2L10      LDTIIRSF------------------------------------------
A0A2K5CWY6_BCL2L2-      VGAFFASK------------------------------------------
A0A2K5CWY6_BCL2L2-      VGAFFASK------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      ---------ISTTDRGFPRAR--YRARTTNYNSSRSRFYSGFNSRPRGRV
A0A2K5CWY6_BCL2L2-      ---------ISTTDRGFPRAR--YRARTTNYNSSRSRFYSGFNSRPRGRV
A0A2K5C7L5_MCL1-01      ---------HQKCAAGFCRCC----------W---SRSWFGISNKIAL--
A0A2K5CFB8_MCL1-03      ---------HQKCAAGFCRCC----------W---SRSWFG---------
A0A2K5CFB8_MCL1-01      VAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVED
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5CFB8_MCL1-02      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      -----------------------------
A0A2K5EPX0_MCL1-02      -----------------------------
A0A2K5EPX0_MCL1-01      -----------------------------
A0A2K5CWY6_BCL2L2-      YRGRARATSWYSPY---------------
A0A2K5CWY6_BCL2L2-      YRGRARATSWYSPY---------------
A0A2K5C7L5_MCL1-01      -----------------------------
A0A2K5CFB8_MCL1-03      -----------------------------
A0A2K5CFB8_MCL1-01      LEGGIRNVLLAFAGVAGVGAGLALSLIHI
A0A2K5EB04_BCL2-01      -----------------------------
A0A2K5EBP4_BCL2L1-      -----------------------------
A0A2K5CFB8_MCL1-02      -----------------------------
A0A2K5F974_BCL2L10      -----------------------------
A0A2K5CWY6_BCL2L2-      -----------------------------
A0A2K5CWY6_BCL2L2-      -----------------------------
A0A2K5DMS4_MCL1-01      -----------------------------
A0A2K5D2I1_BCL2A1-      -----------------------------
A0A2K5D2I1_BCL2A1-      -----------------------------
                                                     

© 1998-2022Legal notice