Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFH3_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
A0A2K5C7L5_MCL1-01      MFGLQRNALIGLNLYCEWAGLGTGSGGTTPPGGRLLATEKEASAQREVGG
A0A2K5CFH3_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
A0A2K5EB04_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A2K5EBP4_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K5F974_BCL2L10      -----------------------MADPLRQRTER-LVADYLEY-------
A0A2K5CWY6_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      GEAGAVIGGSAGASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFA
A0A2K5C7L5_MCL1-01      GEAGVVIGGSAGASPSAALTPDAR----------------GSCGRCWFFA
A0A2K5CFH3_MCL1-03      GEAGAVIGGSAGASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFA
A0A2K5EB04_BCL2-01      EWDA-GDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVSRTSPPPPPAA
A0A2K5EBP4_BCL2L1-      SWSQFSDVEENRTEAPEGTDSEMETPSAING-----NPSWHLADSPAVNG
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEP
A0A2K5C7L5_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEP
A0A2K5CFH3_MCL1-03      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEP
A0A2K5EB04_BCL2-01      PAAAATGPALSPVPPV--VH------------------------------
A0A2K5EBP4_BCL2L1-      ATGHSSSLDAREVIPMAAVK------------------------------
A0A2K5F974_BCL2L10      ---CSQEPGTPESPPSTAEA------------------------------
A0A2K5CWY6_BCL2L2-      --VCGAGPG--EGPAADPLH------------------------------
A0A2K5CWY6_BCL2L2-      --VCGAGPG--EGPAADPLH------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      GNGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5C7L5_MCL1-01      GNDSSTDGSLPSTPP-----------TSLEIISRYLREQATGAKDTKPMD
A0A2K5CFH3_MCL1-03      GNGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      -------------MFGFQVVIRLNL--YCGAIPPGPRLLATGAKDTKPMG
A0A2K5D2I1_BCL2A1-      ---------MTDCEFGYIHNLTQDYLRYVLQIP-----------------
A0A2K5D2I1_BCL2A1-      ---------MTDCEFGYIHNLTQDYLRYVLQIP-----------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQGMLRK--------LDIKNEDD
A0A2K5C7L5_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQ-------------V-------
A0A2K5CFH3_MCL1-03      RSGAASRKALETLRRVGDGVQRNHETAFQGWVCG--------V-------
A0A2K5EB04_BCL2-01      ----------LTLRQAGDDFSRRYRRDFAEMSSQ--------LHLTPFTA
A0A2K5EBP4_BCL2L1-      ----------QALREAGDEFELRYRRAFSDLTSQ--------LHITPGTA
A0A2K5F974_BCL2L10      ----------AVLRAMAAGVRKLYRSFFSAYLG------------YPGNR
A0A2K5CWY6_BCL2L2-      ----------QAMRAAGDEFETRFRRTFSDLAAQ--------LHVTPGSA
A0A2K5CWY6_BCL2L2-      ----------QAMRAAGDEFETRFRRTFSDLAAQ--------LHVTPGSA
A0A2K5DMS4_MCL1-01      RSEAANSKALETLRGVGEGVPRNHEMALQGMLRN--------LDNKNEDN
A0A2K5D2I1_BCL2A1-      QSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDN--------VNIVSIDN
A0A2K5D2I1_BCL2A1-      QSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDN--------VNIVSIDN
A0A2K5EBP4_BCL2L1-      ------------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTA
A0A2K5EPX0_MCL1-02      ----------------SQSYNNLKITTC--MLRK--------LDIKNKDD
A0A2K5EPX0_MCL1-01      ----------------NASCSRPACFSSPGMLRK--------LDIKNKDD
                                                                          

A0A2K5CFH3_MCL1-01      VKS-LSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK--------------
A0A2K5C7L5_MCL1-01      --------------------------------------------------
A0A2K5CFH3_MCL1-03      --------------------------------------------------
A0A2K5EB04_BCL2-01      RGR-FATVVEELFRD--GVNWGRIVAFFEFGGVMCV--------------
A0A2K5EBP4_BCL2L1-      YQS-FEQVVNELFRD--GVNWGRIVAFFSFGGALCV--------------
A0A2K5F974_BCL2L10      VEL-VARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGPLVTARWKKWGF
A0A2K5CWY6_BCL2L2-      QQR-FTQVSDELFQG--GPNWGRLVAFFVFGAALCA--------------
A0A2K5CWY6_BCL2L2-      QQR-FTQVSDELFQG--GPNWGRLVAFFVFGAALCA--------------
A0A2K5DMS4_MCL1-01      VKSFY----------G-VTNWGRIVTLSSFGAFVAK--------------
A0A2K5D2I1_BCL2A1-      ARMIFSQVMEKEFEDG-IINWGRIVTIFAFEGILIK--------------
A0A2K5D2I1_BCL2A1-      ARMIFSQVMEKEFEDG-IINWGRIVTIFAFEGILIK--------------
A0A2K5EBP4_BCL2L1-      YQS-FEQVVNELFRDG-V-NWGRIVAFFSFGGALCV--------------
A0A2K5EPX0_MCL1-02      VKS-LSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK--------------
A0A2K5EPX0_MCL1-01      VKS-LSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK--------------
                                                                          

A0A2K5CFH3_MCL1-01      HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGWD
A0A2K5C7L5_MCL1-01      -----------------------------LPCRRPRR----W--HQKCAA
A0A2K5CFH3_MCL1-03      -----------------------------LPCRGPRR----W--HQKCAA
A0A2K5EB04_BCL2-01      ESVNREMSPLVDN---------IALWMTEYLNRHLHT----WIQDNGGWD
A0A2K5EBP4_BCL2L1-      ESVDKEMQVLVSR---------IAAWMATYLNDHLEP----WIQENGGWD
A0A2K5F974_BCL2L10      QSRLKEPEGDVAR---------DCQRLVALLSSRLVGQHRAWLEAQGGWV
A0A2K5CWY6_BCL2L2-      ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGWA
A0A2K5CWY6_BCL2L2-      ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGWA
A0A2K5DMS4_MCL1-01      HLKTINQESCIEPLAESIRYSRWDGFVEFFRVEDL----------EGGIR
A0A2K5D2I1_BCL2A1-      KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQNGGWA
A0A2K5D2I1_BCL2A1-      KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQNGGWE
A0A2K5EBP4_BCL2L1-      ESVDKEMQVLVSR---------IAAWMATYLNDHLEP----WIQENGGWD
A0A2K5EPX0_MCL1-02      HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGWD
A0A2K5EPX0_MCL1-01      HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGWD
                                                                     .    

A0A2K5CFH3_MCL1-01      G-FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSLIHI----------
A0A2K5C7L5_MCL1-01      G-FCRCCWSRSWFGISNKIAL-----------------------------
A0A2K5CFH3_MCL1-03      G-FCRCCWSRSWFG------------------------------------
A0A2K5EB04_BCL2-01      A-FVELYGPSM-------RPLFDFSWLSLKTLLSLALVGAC---------
A0A2K5EBP4_BCL2L1-      T-FVELYGNNAAAESRKGQERFN------RWFLTGMTVAGV---------
A0A2K5F974_BCL2L10      S-MR--------RGTR--ASRVAGNIGWLLLLLQDLLLAGIMEKTAGPGF
A0A2K5CWY6_BCL2L2-      E-FTALYGDGALEEAR--RLR-EGNWASVRTVLTGAVALGAL--------
A0A2K5CWY6_BCL2L2-      E-FTALYGDGALEEAR--RLR-EGNWASVRTVLTGAVALGAL--------
A0A2K5DMS4_MCL1-01      N------------------------GLLAFAGVAGVGTDLAYLIR-----
A0A2K5D2I1_BCL2A1-      K-------------------------WHSLLLV---LVESVAQKERKMAL
A0A2K5D2I1_BCL2A1-      NGFVKKFEPKS--------------GWMTFLEVTGKICEMLSLLKQYY--
A0A2K5EBP4_BCL2L1-      T-FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-----
A0A2K5EPX0_MCL1-02      G-FVEFFHVEDLEGGIRN-------VLLAFACVAGVGAGLAYLIR-----
A0A2K5EPX0_MCL1-01      G-FVEFFHVEDLEGGIRN-------VLLAFACVAGVGAGLAYLIR-----
                                                                          

A0A2K5CFH3_MCL1-01      --------------------
A0A2K5C7L5_MCL1-01      --------------------
A0A2K5CFH3_MCL1-03      --------------------
A0A2K5EB04_BCL2-01      ----------ITLGAYLGHK
A0A2K5EBP4_BCL2L1-      ----------VLLGSLFSRK
A0A2K5F974_BCL2L10      PVMVVNSSIHLLLDTIIRSF
A0A2K5CWY6_BCL2L2-      ----------VTVGAFFASK
A0A2K5CWY6_BCL2L2-      ----------VTVGAFFASK
A0A2K5DMS4_MCL1-01      --------------------
A0A2K5D2I1_BCL2A1-      --------------------
A0A2K5D2I1_BCL2A1-      --------------------
A0A2K5EBP4_BCL2L1-      --------------------
A0A2K5EPX0_MCL1-02      --------------------
A0A2K5EPX0_MCL1-01      --------------------
                                            

© 1998-2020Legal notice