Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5C7L5_MCL1-01      MFGLQRNALIGLNLYCEWAGLGTGSGGTTPPGGRLLATEKEASAQREVGG
A0A2K5CFH3_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
A0A2K5CFH3_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
A0A2K5EB04_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A2K5EBP4_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K5F974_BCL2L10      -----------------------MADPLRQRTER-LVADYLEY-------
A0A2K5CWY6_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWY6_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5C7L5_MCL1-01      GEAGVVIGGSAGASPSAALTPDAR----------------GSCGRCWFFA
A0A2K5CFH3_MCL1-03      GEAGAVIGGSAGASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFA
A0A2K5CFH3_MCL1-01      GEAGAVIGGSAGASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFA
A0A2K5EB04_BCL2-01      EWDA-GDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVSRTSPPPPPAA
A0A2K5EBP4_BCL2L1-      SWSQFSDVEENRTEAPEGTDSEMETPSAING-----NPSWHLADSPAVNG
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5C7L5_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEP
A0A2K5CFH3_MCL1-03      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEP
A0A2K5CFH3_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEP
A0A2K5EB04_BCL2-01      PAAAATGPALSPVPPV--VH------------------------------
A0A2K5EBP4_BCL2L1-      ATGHSSSLDAREVIPMAAVK------------------------------
A0A2K5F974_BCL2L10      ---CSQEPGTPESPPSTAEA------------------------------
A0A2K5CWY6_BCL2L2-      --VCGAGPG--EGPAADPLH------------------------------
A0A2K5CWY6_BCL2L2-      --VCGAGPG--EGPAADPLH------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5C7L5_MCL1-01      GNDSSTDGSLPSTPP-----------TSLEIISRYLREQATGAKDTKPMD
A0A2K5CFH3_MCL1-03      GNGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5CFH3_MCL1-01      GNGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5EB04_BCL2-01      --------------------------------------------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5F974_BCL2L10      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5CWY6_BCL2L2-      --------------------------------------------------
A0A2K5DMS4_MCL1-01      -------------MFGFQVVIRLNL--YCGAIPPGPRLLATGAKDTKPMG
A0A2K5D2I1_BCL2A1-      ---------MTDCEFGYIHNLTQDYLRYVLQIP-----------------
A0A2K5D2I1_BCL2A1-      ---------MTDCEFGYIHNLTQDYLRYVLQIP-----------------
A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5C7L5_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQV--------------------
A0A2K5CFH3_MCL1-03      RSGAASRKALETLRRVGDGVQRNHETAFQGWVCG--------V-------
A0A2K5CFH3_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQGMLRK--------LDIKNEDD
A0A2K5EB04_BCL2-01      ----------LTLRQAGDDFSRRYRRDFAEMSSQ--------LHLTPFTA
A0A2K5EBP4_BCL2L1-      ----------QALREAGDEFELRYRRAFSDLTSQ--------LHITPGTA
A0A2K5F974_BCL2L10      ----------AVLRAMAAGVRKLYRSFFSAYLG------------YPGNR
A0A2K5CWY6_BCL2L2-      ----------QAMRAAGDEFETRFRRTFSDLAAQ--------LHVTPGSA
A0A2K5CWY6_BCL2L2-      ----------QAMRAAGDEFETRFRRTFSDLAAQ--------LHVTPGSA
A0A2K5DMS4_MCL1-01      RSEAANSKALETLRGVGEGVPRNHEMALQGMLRN--------LDNKNEDN
A0A2K5D2I1_BCL2A1-      QSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDN--------VNIVSIDN
A0A2K5D2I1_BCL2A1-      QSGTGPSKTSRVLQKVAFSVQKEVEKSLKPCLDN--------VNIVSIDN
A0A2K5EBP4_BCL2L1-      ------------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPGTA
A0A2K5EPX0_MCL1-02      ----------------SQSYNNLKITTC--MLRK--------LDIKNKDD
A0A2K5EPX0_MCL1-01      ----------------NASCSRPACFSSPGMLRK--------LDIKNKDD
                                                                          

A0A2K5C7L5_MCL1-01      -----------LPCR--RPRRW----------------------------
A0A2K5CFH3_MCL1-03      -----------LPCR--GPRRW----------------------------
A0A2K5CFH3_MCL1-01      VKS-LSRVMVHVFSD--GVTNWGRIVTLISFGAFVAK-------------
A0A2K5EB04_BCL2-01      RGR-FATVVEELFRD--GV-NWGRIVAFFEFGGVMCV-------------
A0A2K5EBP4_BCL2L1-      YQS-FEQVVNELFRD--GV-NWGRIVAFFSFGGALCV-------------
A0A2K5F974_BCL2L10      VEL-VARMAEALLSDSPGP-TWGNVVMLLAFAGTLLERGPLVTARWKKWG
A0A2K5CWY6_BCL2L2-      QQR-FTQVSDELFQG--GP-NWGRLVAFFVFGAALCA-------------
A0A2K5CWY6_BCL2L2-      QQR-FTQVSDELFQG--GP-NWGRLVAFFVFGAALCA-------------
A0A2K5DMS4_MCL1-01      VKSFY------------GVTNWGRIVTLSSFGAFVAK-------------
A0A2K5D2I1_BCL2A1-      ARMIFSQVMEKEFED--GIINWGRIVTIFAFEGILIK-------------
A0A2K5D2I1_BCL2A1-      ARMIFSQVMEKEFED--GIINWGRIVTIFAFEGILIK-------------
A0A2K5EBP4_BCL2L1-      YQS-FEQVVNELFRD--GV-NWGRIVAFFSFGGALCV-------------
A0A2K5EPX0_MCL1-02      VKS-LSRVMVHVFSD--GVTNWGRIVTLISFGAFVAK-------------
A0A2K5EPX0_MCL1-01      VKS-LSRVMVHVFSD--GVTNWGRIVTLISFGAFVAK-------------
                                             *                            

A0A2K5C7L5_MCL1-01      -------HQKCAAG---------FCRCC--------------W---SRSW
A0A2K5CFH3_MCL1-03      -------HQKCAAG---------FCRCC--------------W---SRSW
A0A2K5CFH3_MCL1-01      -HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGW
A0A2K5EB04_BCL2-01      -ESVNREMSPLVDN---------IALWMTEYLNRHLHT----WIQDNGGW
A0A2K5EBP4_BCL2L1-      -ESVDKEMQVLVSR---------IAAWMATYLNDHLEP----WIQENGGW
A0A2K5F974_BCL2L10      FQSRLKEPEGDVAR---------DCQRLVALLSSRLVGQHRAWLEAQGGW
A0A2K5CWY6_BCL2L2-      -ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGW
A0A2K5CWY6_BCL2L2-      -ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGW
A0A2K5DMS4_MCL1-01      -HLKTINQESCIEPLAESIRYSRWDGFVEFFRVEDL----------EGGI
A0A2K5D2I1_BCL2A1-      -KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQNGGW
A0A2K5D2I1_BCL2A1-      -KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQNGGW
A0A2K5EBP4_BCL2L1-      -ESVDKEMQVLVSR---------IAAWMATYLNDHLEP----WIQENGGW
A0A2K5EPX0_MCL1-02      -HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGW
A0A2K5EPX0_MCL1-01      -HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGW
                                                                      . . 

A0A2K5C7L5_MCL1-01      FG-ISNKIAL----------------------------------------
A0A2K5CFH3_MCL1-03      FG------------------------------------------------
A0A2K5CFH3_MCL1-01      DG-FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSLIHI---------
A0A2K5EB04_BCL2-01      DA-FVELYGPSM-------RPLFDFSWLSLKTLLSLALVGAC--------
A0A2K5EBP4_BCL2L1-      DT-FVELYGNNAAAESRKGQERFN------RWFLTGMTVAGV--------
A0A2K5F974_BCL2L10      VS-MR--------RGTR--ASRVAGNIGWLLLLLQDLLLAGIMEKTAGPG
A0A2K5CWY6_BCL2L2-      AE-FTALYGDGALEEAR--RLR-EGNWASVRTVLTGAVALGAL-------
A0A2K5CWY6_BCL2L2-      AE-FTALYGDGALEEAR--RLR-EGNWASVRTVLTGAVALGAL-------
A0A2K5DMS4_MCL1-01      RN------------------------GLLAFAGVAGVGTDLAYLIR----
A0A2K5D2I1_BCL2A1-      ENGFVKKFEPKS--------------GWMTFLEVTGKICEMLSLLKQYY-
A0A2K5D2I1_BCL2A1-      AK-------------------------WHSLLLV---LVESVAQKERKMA
A0A2K5EBP4_BCL2L1-      DT-FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK----
A0A2K5EPX0_MCL1-02      DG-FVEFFHVEDLEGGIRN-------VLLAFACVAGVGAGLAYLIR----
A0A2K5EPX0_MCL1-01      DG-FVEFFHVEDLEGGIRN-------VLLAFACVAGVGAGLAYLIR----
                                                                          

A0A2K5C7L5_MCL1-01      ---------------------
A0A2K5CFH3_MCL1-03      ---------------------
A0A2K5CFH3_MCL1-01      ---------------------
A0A2K5EB04_BCL2-01      -----------ITLGAYLGHK
A0A2K5EBP4_BCL2L1-      -----------VLLGSLFSRK
A0A2K5F974_BCL2L10      FPVMVVNSSIHLLLDTIIRSF
A0A2K5CWY6_BCL2L2-      -----------VTVGAFFASK
A0A2K5CWY6_BCL2L2-      -----------VTVGAFFASK
A0A2K5DMS4_MCL1-01      ---------------------
A0A2K5D2I1_BCL2A1-      ---------------------
A0A2K5D2I1_BCL2A1-      L--------------------
A0A2K5EBP4_BCL2L1-      ---------------------
A0A2K5EPX0_MCL1-02      ---------------------
A0A2K5EPX0_MCL1-01      ---------------------
                                             

© 1998-2020Legal notice