Dataset for protein BCL-2-like of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          *       : :  .        
--------------------------------------------------meysnreyV----qdyvsyklsq-gy-w--
ggwgteswrntswpskgparsdhlgsvlwkseassqgparidhfmsvpwrsstgpfyv yylhlkslqwvsqes--s-sq
                                            gah gnrgsde gl gtaaigfil earpwg gg
                                                    aa   i     f   h     k  d aa

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       ..  *:                                   
-e--------p--t-la--aaav-l-g-p----------swhrPaqtrvph------aa-------------r---g-h-
t-hfgavfre-ss-i--sp----p-n-t-rgrggdltilgrlp tgqvs--peprrs--ppaagcctfkkvs-ssp-v-p
lde     pdenrgefsre rtnaagss            hfh   llaae agpng             ckefrlepgl
g d     ea ap a  pa      a a              g   k        gd             ah apa e e

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :   .. :                         :  .: :.        .  *    * **  ****:
-p--pavr---alrtagdefsvryrrafs---------------qmlsqlhitpvt-ayqsfvqVvnelFrDGv-NWGRi
r-qs----qfwvftqpasslqrqtqkplrgeqggvtvedlgrslpltrrielssgevdrrrvng mehk s  nt    v
lvhpavghl  g  ni qi gllaeedha               gfsgk d kkfd  lgi ge ad   a         
f ah    d     e     ed                      d  d      e   k a ea  a             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.::: **. :     .            :   :*  :      *:  :***                             
vtffsFGgvlcvesvsvemsvl---vgsiaawmTeylvshlreWiqsnGGWergv-f-----------------------
talit  alvtrklqnrkvrptgekkerlvyii taisrskhp lveq   vnffs-ygnsmtplgdlswiwpltilslt
  i e   fmakh kekgqqls   idq srf   nnn dn  dd    dg celf   cr  f fg  slksa qi 
        a      dh  ek                id  a    a     a  d                        

       330       340       350     
....:....|....:....|....:....|....:
                :  .    *   :      
-------l----r--llsfslvttLgaylgy----
ppprvpp-ttsp-rv-vpvgkpps pvsvfsmire
    pedprkpi pspmlpagiig fpg ahlf  
        egfe nl   acad   a  fk   
© 1998-2020Legal notice