Dataset for protein BCL-2-like of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A493SSZ7_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL2A1 (length=172 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDISSVDVAKRIFNGVMDEKFA
DGNTNWGRITTIFTFGGLLTKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DLFVAVFSLFRE
>gnl|bcl2dbpro|A0A493T1X3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEA
PPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A493TIA6_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BCL2L1 (length=238 residues).
MSSGNRELVIDFVSYKLSQKGYSWSQLEEEDENRTELASEAAAVLNGSPSWHPPAGQVVNGAAVHRSSLEVHELVQSAAV
RQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI
VAWMTTYLSDHLDPWIQENGGWVRGCSFCTPLGDLGWIWPLSALQITPPPRPPPPRTPPRPLPLPPSLPPSLPPGLGF
>gnl|bcl2dbpro|A0A493U0E8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=MCL-1 (length=325 residues).
GGWGTESWRNTSWPSKGPARSDHLGSVLWKSEASSQGPARIDHFGSVPWNSEASPRGVVGTAHFGSVLWNSEASPWGWGG
TDHFGAVFPEPSSGIFSRPARTNPLGSAPRGRGGDLTILGWFHPTQKRAPEPAGRRDAAPPAAGCCTFKKCKRFRAGPHP
FPHHPAGRDFWGFTTPGQIFGVLARKPHSGEQGGVTVEDLGRSLGMLRKLEIKKEEDLQAVGEVAAHLFSDGVTNWGRVV
TLISFGAFVARHLKSVKQEKSIGSLARIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGASL
AYMIR
© 1998-2020Legal notice