Dataset for protein BCL-2-like of organism Amphilophus citrinellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
         mameqknnldeklptpgvwqgs-hy        daiglpkp  r dggaagfdgeqridthnkgtidgts-
           g    ei    mqn  vdenmgw             ne             e  de a a  sf  pp 
                       ch     g af                                           a  

        90       100       110       120       130       140       150       160
                                                   .    .           :   :       
y-vrr-ts-s-v--gttathlvrrlp             qsdkpadsmrvrnesanslqeqlhrdise hrt lihpgpd
ttslcsrqrqnq d es  dackea                  h  ihpel dl i i  l aa  dd aq     c   
  p a      g                                   aaa   a d f  g                   

       170       180       190       200       210       220       230       240
       * ..:. *   ****: .:: * ..:.     ::                    : : :: **    . *: .
yrss-rn mdevvr -gv    vvgffe tatlavecvsqepgldpgqqqelgqmtsscrriaewmtv  nnplqs iqd
qqr lek i  g ghl     ia      a  rkrle            eespq gnlv t ae  gghknp  ls
hc   ae                              a                 pil de      d  deeik     

       250       260       270       280       290  
:..*: * :        :       ::     :.            : .   
qga er ckyyg-rrrvavsssswtslktwllvamlgvtsvvigfyivqkrl
   a a ls sqqea qf rmqp ifkvf l lavlaglta    t    
         i     a  ed c ke   aa       a         a    
© 1998-2022Legal notice