Dataset for protein BCL-2-like of organism Amphilophus citrinellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------i--klskrtypl----------------sn-t-----nlgvvstngyapnnitndved
mntctmrncrmnsynrvmvlfy-vyg----slhygsgnsspqnhtvtspd--g-pkrpng-d--q--d---kg--d-tsp
         mameqknnldeklptp-vwqgnmgw        daiglpkp  r dggaa-f-ge-ri-thn--ti-gpp 
           g    ei    mqn  vdeg af             ne             e  de a a  sf  a  
                       ch                                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .  . .                                      .    :.   :   :  :   :       
gslpstpephsdppsdenleretksl----------------pesealktmrrvvadverkhryafngmvnqlslterte
ylvrrctsfsqvse---a--------itsffrdftglsqrrwk--------ketgqelleryqrrytnlsskfhrdsaga
ttslcsrqrqnq dgtt-thlvrrlp             qsd-padshrvl dlan i lq apd de hrt lihpgpd
  p a      g   es  dackea                  h  iaaa   a d f  l  a   d aq     c   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       * ..:. *   ****: .:: * ..:.     ::                    : : :: **    . *: .
dvtf-saVmkelfrD-tvNWGRivslfaFggvvcvrlk-ek------------grdncvelvsewittYLlsdqrdWlvk
yrssvrn adsvva kgt    vagfme tatlaqecvsqepgldpgqqqelgqmtsscrriaqemsv  nnplqs iqd
qqr lek i  g ghl     ia      a  rkrle            eespq gnlv t ae  gghknp  ls
hc   ae                              a                 pil de      d  deeik     
                                                                                

       250       260       270       280       290  
....:....|....:....|....:....|....:....|....:....|..
:..*: * :        :       ::     :.            : .   
nngWdgFveffr-adpestvrntlmafkgfagvgatl-------allir---
qga er ckyygvrrrvavsssswtslatwlliamlgvtsvvigfyivqkrl
   a a ls sqqea qf rmqp ifkvf l lavlaglta    t    
         i     a  ed c ke   aa       a         a    
                                                    
© 1998-2020Legal notice