Dataset for protein BCL-2-like of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0S9R1_BCL2L10      ----------------------MVPGLWKETLGL----------------
A0A3Q0S5Z7_BCL2-01      ---------MANEYNRNIVEKYICHKLSKRGYAW----------------
A0A3Q0RTF8_BCL2L1-      -----------MSQNRELVLFYITYKLSQRNYPL--------NHIVLNEP
A0A3Q0R633_MCL1-01      ------------------------------SLPF------------TSPD
A0A3Q0R633_MCL1-03      MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYGSGNSSPQDATGTPKD
                                                                          

A0A3Q0S9R1_BCL2L10      ---------------------------AEDYLSLCCTSPHQVPP------
A0A3Q0S5Z7_BCL2-01      ---------GFDGVQDEDAANNGSINDPPPTLVRRCREPSNGPDGESNTH
A0A3Q0RTF8_BCL2L1-      SNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTNLD
A0A3Q0R633_MCL1-01      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
A0A3Q0R633_MCL1-03      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
                                                             .  . .       

A0A3Q0S9R1_BCL2L10      ----------------------PPSESAAAMRRLGQDIERQHQARFDNLA
A0A3Q0S5Z7_BCL2-01      LCRRLP-------------QSDPHADIHRVLREAGDELERLYQPDFTEMS
A0A3Q0RTF8_BCL2L1-      AVKEAL-------------------------RDTANEFELRYARAFNDLH
A0A3Q0R633_MCL1-01      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
A0A3Q0R633_MCL1-03      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
                                                       .    :.   :   :  : 

A0A3Q0S9R1_BCL2L10      QTFLRHCGPDHCSSLRKVMEELVGDGHLNWGRVVSLFAFTGVLARKRLEQ
A0A3Q0S5Z7_BCL2-01      RQLHLTSATAQRRF-AEVIDELFRD-GVNWGRIIAFFEFGGTVCVECASN
A0A3Q0RTF8_BCL2L1-      SQLHITPATAYQSF-ENVMDEVFRD-GVNWGRIVGLFAFGGALCVECV-E
A0A3Q0R633_MCL1-01      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLK-E
A0A3Q0R633_MCL1-03      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLK-E
                          :              * ..:. *   ****: .:: * ..:.     :

A0A3Q0S9R1_BCL2L10      KPGLDPGQQQELGQEPISCRELAETIADYLGEEKKDWLLDNDGWEGFCKY
A0A3Q0S5Z7_BCL2-01      E------------GMTSQVDNIAEWMTEYLNGPLNSWIQDNGGWDAFVEL
A0A3Q0RTF8_BCL2L1-      K------------EMSPLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEI
A0A3Q0R633_MCL1-01      K------------GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEF
A0A3Q0R633_MCL1-03      K------------GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEF
                        :                    : : :: **    . *: .:..*: * : 

A0A3Q0S9R1_BCL2L10      SRSAREVSQDSSMKTALFAAAGVGLAGLT-----FLLVR---
A0A3Q0S5Z7_BCL2-01      YG-RQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK--
A0A3Q0RTF8_BCL2L1-      FG-QDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
A0A3Q0R633_MCL1-01      FRVADPESTVRNTLMAFAGFAGIGATL-------ALLIR---
A0A3Q0R633_MCL1-03      FRVADPESTVRNTLMAFAGFAGIGATL-------ALLIR---
                               :       ::     :.            : .   

© 1998-2020Legal notice