Dataset for protein Bak1 of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
  :. ..  * *  .* .                             *:*.    *:   ..    :.:    :. .   
mglchswel r ggs pslmaaplscwaptpiqdlvsflfspclplv e sihvl hcrgsprrgaqghgqlgqkpsamm

        90       100       110       120       130       140       150       160
:. *..* *     : .. ************************************************             
qal pt w pahlpasrsh                                                rypdh-----n--
                                                                    p   lpa l  s

       170       180       190       200       210       220       230       240
                                                      :    .       :            
lscpvttspwp                      ay m swpg hllatpsa ce ac g llff  a ad fpfcalaaa

s qh 
© 1998-2020Legal notice