Dataset for protein Bak1 of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :. ..  * *  .* .                             *:*.    *:   ..    :.:    :. .   
--masgqgpGpPrqeCge-----------------------------PdPpsaseEqvardteevfhsyvfyrhrqeqea
mglchswel r ggs pslmaaplscwaptpiqdlvsflfspclplv e sihvl hcrgsprrgaqghgqlgqkpsamm
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:. *..* *     : .. ************************************************             
egaAapAdPemvslslqpsSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIAS-------------
qal pt w pahlpasrsh                                                slfesginwgrvv
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *                                           :    .       :               
-------Rlalhvyqrgltgflgqvtrfvvdfmlhhciarwiaqrggwvaaldlgngpilnvlvvlgvvllgqfvvrrff
allgfgy ----------------------------------psvstvclrvtstlavwwlswrlptswvytstshs---
        ypd lpaglwslscpvt spwpay m swpg hllatpsa ce ac g llff  a ad fpfcalaaas q

  
..
  
k-
-s

© 1998-2020Legal notice