Dataset for protein Bak1 of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|F7ICC2_BAK1-02 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callithrix jacchus GN=BAK1 (length=242 residues).
MGLCHSWELGRPGGSCPSLMAAPLSCWAPTPIQDLVSFLFSPCLPLVPEPSIHVLEHCRGSPRRGAQGHGQLGQKPSAMM
QALAPTAWPPAHLPASRSHSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVV
ALLGFGYRLALHVYQRGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVRRFF
KS
>gnl|bcl2dbpro|F7ICC2_BAK1-04 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callithrix jacchus GN=BAK1 (length=190 residues).
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASRYPDHLPAGLWSLSCPVTTSPWPAYMMHSWPGRHLLSVSSVCCE
LTCGLGLLFFSLRVPDSFVFCALAHSSFQH
>gnl|bcl2dbpro|F7ICC2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callithrix jacchus GN=BAK1 (length=211 residues).
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVVD
FMLHHCIARWIAQRGGWVAALDLGNGPILNVLVVLGVVLLGQFVVRRFFKS
>gnl|bcl2dbpro|F7ICC2_BAK1-03 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callithrix jacchus GN=BAK1 (length=152 residues).
MASGQGPGPPRQECGEPDPPSASEEQVARDTEEVFHSYVFYRHRQEQEAEGAAAPADPEMVSLSLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIASRPATPTACLRVASTGAVWWLSWALATVWPYTSTSAA
© 1998-2020Legal notice