Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      :                                         
--------mdgsgeqprgggstsseqimktgalllqgfiqdRa-------grmggetPelgleqvpqdastkklsecLkr
masgqgpgpp-qdcdepdpspptekevardteevfrsyvfy-hqqeqeaesaaaptd-vmvtlhpepsstmgqvgrq-av
 evlrrss--a----dafdr---d--lvaqaka-gpem ha llraglsw--peraa -p-grla-vc-vllr-ade el
        vf aeim-----dsv-p -rsh--- -    -- -         -----  - ---- -- ---- --- --
               m ph                                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       :*     *  :*:            .. *   *                        
Igdel----dsnmelqrmiaavdtDsprevFfrvAa----------emFsdGnfnWGrVVaLfyfaskLvlkalctkvpe
-rpdinrryaaefqamlqhlqpta nay-y tki srpaaaptaclslves -it -k--s-ysvgyr-avhvyrrgqtg
 --svy nv-rqln-s--set v  a-- - la  t          qi  a  aa  -  - lg--ag --dcvqqal-a
   --     ---- -  -                           ra  t           --  --   ------- -
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    *:     *                                                    
lirtimgwtldF-lRerllgWiqdqGGWdglLs--------------------------g--------------------
fvhqvvrfvge-mv-rtiat lrrr-- vrattpphsptplgplglsvptigvppspyf-hmsdqplihrvpndlsmtld
-lgaltdcla-  - ks--r  aq-   tdv k                        fw                     
 ---------     --  -  c-    aap d                                               
                             l  a                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------tptwqtvtifvagv-----------------------tasltiwkk------------------
llvtsdllvtpdpmprc--stnpplrsvwlkfydnpltsplvgpcpylcpltlvlavvslgrgcplaeslkcllslspgr
                -vvlglggtplhsi                      ppc--mlfpq                  
                  p cdts kaea-                       --  cc---                  
                    ps   s  -                            --                     

       330       340       350       360       370       380        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                                    
-------------------------------------------------------mg-----------
pplllwdthmadsdhlcgwsahrlahhleedglrpstaldffcinygifqgggadfvvrrffmllper
                                                       llkme  lsf   
                                                       --aaa  k     
                                                                    
© 1998-2020Legal notice