Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .         ..:.:::      : . ::  *  .                    : .  : .:. :*  
--------mdgsgeqprgggstsseqimktgalllrgfvqdRagrmggetpelgleqvpqdastkklseclkrigdeL--
mevlrrssvpaqeimepfpspptekevvrqtkevgqsyihy lqqeqlswsapertdpvpvtrlpevcsvmlqvarq ev
 asgqgpgpf adcddaddr   d  laadaea f e  fa hl a eaeg aapaa emgglha p at g l    al
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :::         :*     *  :*:.:*. * :.**.**:*  ..  *.:       . ::  :     
---------dsnmelqrqiaavdtDsprevFfrvAaemFsdG-inWGrVVaLfyfaskLvlkalctkvpelirtimgwtl
irpsvyrryarqlqaslmsltpva n---- tki tsl es nft  k  s ysvgyr avhvyrrgqtgfvhqvvrfvg
 gddin nv aefn m  heq t  aay y la  sqi  a           lg  ag   dcvqqal a lgaltdcla
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:* :*  :  *:  .***   *                                                          
dF-lRerllgWiqdrGGWvrvLt------------------------------------------------------l--
e mv rtiat lrrq   tgp spphsptplgplglsvptigvppspywghmsdqplihrvpndlsmtldllvtsdl-vv
     ks  r  aq    ddl k                        ff                            c t
                   aa d                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .     .:   .                                                             
----p-tsvwqvvaivllgv------------------------------------------------------------
stpp-rrptaltptvpvfsrkfydnpltsplvgpcpylcpltptcsltiwprgcplaeslkcllslspgrpplllwdthm
pgnmglk p illplfse q                      lpa  mc kk                            
 ddg ic h c a  c a l                                                            

       330       340       350       360       370        
....:....|....:....|....:....|....:....|....:....|....:...
                                             :            
---------------------------------------------fg---ff-l----
adsdhlcgwsahrlahhleedglrpstaldffcinygifqgggadmvvrr--m-lper
                                             llkme  lsf   
                                               aaa  k     
© 1998-2020Legal notice