Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W2CIX3_BAX-02       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGMI-----------
A0A4W2DBK8_BOK-01       MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSW
A6H6W7_BOK-01           MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSW
A0A4W2BYG9_BAK1-02      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAE
A0A4W2BYG9_BAK1-01      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAE
Q05KI7_BAK1-01          MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAE
O02703_BAX-02           --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRA-------
A0A4W2H091_BAX-01       ---------------MRPHSDSVSPQLRSH-----PSFIQDRA-------
A0A4W2CIX3_BAX-01       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRA-------
O02703_BAX-01           --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRA-------
                                             . . ::           :           

A0A4W2CIX3_BAX-02       -------------------------------------------------A
A0A4W2DBK8_BOK-01       SAPERAAPVPGGRLAEVCAVLLRLADELELIRPSVYRNVARQLNLSLQSE
A6H6W7_BOK-01           SAPERAAPVPGGRLAEVCAVLLRLADELELIRPSVYRNVARQLNLSLQSE
A0A4W2BYG9_BAK1-02      GAAAPTDPEMVTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHL
A0A4W2BYG9_BAK1-01      GAAAPTDPEMVTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHL
Q05KI7_BAK1-01          GAAAPTDPEMVTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHL
O02703_BAX-02           GRMGGETPELGLEQVPQDASTKKLSECLKRIGDEL----DSNMELQRMIA
A0A4W2H091_BAX-01       GRMGGETPELGLEQVPQDASTKKLSECLKRIGDEL----DSNMELQRMIA
A0A4W2CIX3_BAX-01       GRMGGETPELGLEQVPQDASTKKLSECLKRIGDEL----DSNMELQRMIA
O02703_BAX-01           GRMGGETPELGLEQVPQDASTKKLSECLKRIGDEL----DSNMELQRMIA
                                                                          

A0A4W2CIX3_BAX-02       AVDTDSPREVFFRVAA----------EMFSDGNFNWGRVVALFYFASKLV
A0A4W2DBK8_BOK-01       TVVTDA----FLAVAT----------QIFSAG-ITWGKVVSLYSVAAGLA
A6H6W7_BOK-01           TVVTDA----FLAVAT----------QIFSAG-ITWGKVVSLYSVAAGLA
A0A4W2BYG9_BAK1-02      QPTADNAYEYFTKIASRPAAAPTACLRAVSTG-AAW--------------
A0A4W2BYG9_BAK1-01      QPTADNAYEYFTKIAS----------SLFESG-INWGRVVALLGFGYRLA
Q05KI7_BAK1-01          QPTADNAYEYFTKIAS----------SLFESG-INWGRVVALLGFGYRLA
O02703_BAX-02           AVDTDSPREVFFRVAA----------EMFSDGNFNWGRVVALFYFASKLV
A0A4W2H091_BAX-01       AVDTDSPREVFFRVAA----------EMFSDGNFNWGRVVALFYFASKLV
A0A4W2CIX3_BAX-01       AVDTDSPREVFFRVAA----------EMFSDGNFNWGRVVALFYFASKLV
O02703_BAX-01           AVDTDSPREVFFRVAA----------EMFSDGNFNWGRVVALFYFASKLV
                           :*     *  :*:            .. *   *              

A0A4W2CIX3_BAX-02       LKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLS-------
A0A4W2DBK8_BOK-01       VDCVRQAQPALVHALVDCLGEF-VRKTLATWLRRRGGWTDVLK-------
A6H6W7_BOK-01           VDCVRQAQPALVHALVDCLGEF-VRKTLATWLRRRGGWTDVLK-------
A0A4W2BYG9_BAK1-02      ------------------------------WLC----WALATA-------
A0A4W2BYG9_BAK1-01      LHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAALD-------
Q05KI7_BAK1-01          LHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAALD-------
O02703_BAX-02           LKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVRPLTPPHSPTP
A0A4W2H091_BAX-01       LKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLS-------
A0A4W2CIX3_BAX-01       LKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLS-------
O02703_BAX-01           LKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDGLLS-------
                                                      *:     *            

A0A4W2CIX3_BAX-02       -----------------YFG------------------------------
A0A4W2DBK8_BOK-01       --------------------------------------------------
A6H6W7_BOK-01           --------------------------------------------------
A0A4W2BYG9_BAK1-02      --------------------------------------------------
A0A4W2BYG9_BAK1-01      --------------------------------------------------
Q05KI7_BAK1-01          --------------------------------------------------
O02703_BAX-02           LGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVT
A0A4W2H091_BAX-01       -----------------YFG------------------------------
A0A4W2CIX3_BAX-01       -----------------YFG------------------------------
O02703_BAX-01           -----------------YFG------------------------------
                                                                          

A0A4W2CIX3_BAX-02       ------TPTWQTVTIFVAGV----------------------LTASLTIW
A0A4W2DBK8_BOK-01       ------CVVSTDPGLRSHWL-----------------------VAALCSF
A6H6W7_BOK-01           ------CVVSTDPGLRSHWL-----------------------VAALCSF
A0A4W2BYG9_BAK1-02      ---------WPSTSTSAA--------------------------------
A0A4W2BYG9_BAK1-01      ---------LGNGPIKSVAI-----------------------VLAVVLL
Q05KI7_BAK1-01          ---------LGNGPIKSVAI-----------------------VLAVVLL
O02703_BAX-02           PDPMPRCPPWCLPPIPLESLKFYDNPLTSPLVGPCPYLCPLTPPCSLMCW
A0A4W2H091_BAX-01       ------TPTWQTVTIFVAGV----------------------LTASLTIW
A0A4W2CIX3_BAX-01       ------TPTWQTVTIFVAGV----------------------LTASLTIW
O02703_BAX-01           ------TPTWQTVTIFVAGV----------------------LTASLTIW
                                                                          

A0A4W2CIX3_BAX-02       KK------------------------------------------------
A0A4W2DBK8_BOK-01       GR------------------------------------------------
A6H6W7_BOK-01           GR------------------------------------------------
A0A4W2BYG9_BAK1-02      --------------------------------------------------
A0A4W2BYG9_BAK1-01      GQ------------------------------------------------
Q05KI7_BAK1-01          GQ------------------------------------------------
O02703_BAX-02           PRGCPLAESLKCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEE
A0A4W2H091_BAX-01       KK------------------------------------------------
A0A4W2CIX3_BAX-01       KK------------------------------------------------
O02703_BAX-01           KK------------------------------------------------
                                                                          

A0A4W2CIX3_BAX-02       -------------------------MG-----------
A0A4W2DBK8_BOK-01       -------------------------FLKAAFFMLLPER
A6H6W7_BOK-01           -------------------------FLKAAFFMLLPER
A0A4W2BYG9_BAK1-02      --------------------------------------
A0A4W2BYG9_BAK1-01      -------------------------FVVRRFFKS----
Q05KI7_BAK1-01          -------------------------FVVRRFFKS----
O02703_BAX-02           DGLRPSTALDFFCINYGIFQGGGADLGAMEFFLLF---
A0A4W2H091_BAX-01       -------------------------MG-----------
A0A4W2CIX3_BAX-01       -------------------------MG-----------
O02703_BAX-01           -------------------------MG-----------
                                                              

© 1998-2020Legal notice