Dataset for protein BAX-like of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O02703_BAX-02       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQ
O02703_BAX-01       --------MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQ
A6H6W7_BOK-01       MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVP
Q05KI7_BAK1-01      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEM
                              .         ..:.:::      : . ::  *  .               

O02703_BAX-02       DASTKKLSECLKRIGDEL-----------DSNMELQRMIAAVDTDSPREVFFRVAAEMFS
O02703_BAX-01       DASTKKLSECLKRIGDEL-----------DSNMELQRMIAAVDTDSPREVFFRVAAEMFS
A6H6W7_BOK-01       GGRLAEVCAVLLRLADELELIRPSVYRNVARQLNLSLQSETVVTDA----FLAVATQIFS
Q05KI7_BAK1-01      VTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFE
                         : .  : .:. :*             :::         :*     *  :*:.:*.

O02703_BAX-02       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVR
O02703_BAX-01       DGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWDG
A6H6W7_BOK-01       AG-ITWGKVVSLYSVAAGLAVDCVRQAQPALVHALVDCLGEF-VRKTLATWLRRRGGWTD
Q05KI7_BAK1-01      SG-INWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVA
                     * :.**.**:*  ..  *.:       . ::  :     :* :*  :  *:  .***  

O02703_BAX-02       PLTPPHSPTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLVTSDLLVT
O02703_BAX-01       LL-----------------------------------------------------SYF--
A6H6W7_BOK-01       VL-----------------------------------------------------KCVVS
Q05KI7_BAK1-01      AL-----------------------------------------------------DL---
                     *                                                     .    

O02703_BAX-02       PDPMPRCPPWCLPPIPLESLKFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESL
O02703_BAX-01       GTPTWQTVTIFVAGVLTASLTIWKKMG---------------------------------
A6H6W7_BOK-01       TDPGLRSHWLVAALCSFGRFLKAAFFMLLPER----------------------------
Q05KI7_BAK1-01      GNGPIKSVAIVLAVVLLGQFVVRRFFKS--------------------------------
                         .      .      :                                        

O02703_BAX-02       KCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQ
O02703_BAX-01       ------------------------------------------------------------
A6H6W7_BOK-01       ------------------------------------------------------------
Q05KI7_BAK1-01      ------------------------------------------------------------
                                                                                

O02703_BAX-02       GGGADLGAMEFFLLF
O02703_BAX-01       ---------------
A6H6W7_BOK-01       ---------------
Q05KI7_BAK1-01      ---------------
                                   

© 1998-2020Legal notice