Dataset for protein BAX-like of organism Bos mutus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                    . * .   .       .:     .  .             .::  ::.  *  ***::: 
m-----------dcde---hpd vspqmkt----lqgfvfyapnslapt---------rsdasmgklgec ar   didr
 md s eq r g    mr g   s  il sgallhp  e e e aa asd  mvtlhpep                    

        90       100       110       120       130       140       150       160
  : *:* *:  ::  :*.. * * .:*:.:*..* :********: *. .*.*:.    :. ::  :  :. ** **  
ryda f a iaaldpta nar v fki ael ed nf        fg ask a halcrglpefigqimgfta  m  er

       170       180       190       200       210       220       230       240
:  ** :.***                                                                     
iag  adq   drpltpphsptplgplglsvptigvppspfwghmsdqplihrvpndlsmtldllmtsdllvtpdpmprc

       250       260       270       280       290       300       310       320

       330       340       350       360       370       380       390       400
                     *. :         *     :: :.:: :: .                            
gwsahrlahhleedglrpstl syfcinygifqg tptwqtmtvfvtglitavgqgreawswgvgtinlfrttlwslshw
                   g   f           gadlgg    f  i                             

       410       420       430       440       450
                                        pl i gkeaa
© 1998-2020Legal notice