Dataset for protein BAX-like of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8IM55_BAX-01       ----------------MRPHSDSVSPQLRS----HPSFIQDRAGRMGGETPELGLEQVPQ
L8IM55_BAX-02       -MDGSGEQPRGG-------GPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQ
L8IT09_BAK1-01      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYEQEAEGAAAPTDPEMVTLHPEP
L8IT09_BAK1-02      MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRPNSLAAS---------RS
                                        . * .   .       .:     .  .             

L8IM55_BAX-01       DASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREVFFRVAAEMFSDGNFNWG
L8IM55_BAX-02       DASTKKLSECLKRIGDELDS--NMELQRMIAAVD--TDSPREVFFRVAAEMFSDGNFNWG
L8IT09_BAK1-01      SSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESG-INWG
L8IT09_BAK1-02      SSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESG-INWG
                    .::  ::.  *  ***:::   : *:* *:  ::  :*.. * * .:*:.:*..* :***

L8IM55_BAX-01       RVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWVRPLTPPHS
L8IM55_BAX-02       RVVALFYFASKLVLKALCTKVPELIRTIMGWTLDF-LRERLLGWIQDQGGWD--------
L8IT09_BAK1-01      RVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWV--------
L8IT09_BAK1-02      RVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWV--------
                    *****: *. .*.*:.    :. ::  :  :. ** **  :  ** :.***         

L8IM55_BAX-01       PTPLGPLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLMTSDLLVTPDPMPRC
L8IM55_BAX-02       ------------------------------------------------------------
L8IT09_BAK1-01      ------------------------------------------------------------
L8IT09_BAK1-02      ------------------------------------------------------------
                                                                                

L8IM55_BAX-01       PPWCLPPIPLESLKFYDNPLTSPLVGPCPYLCPLTPPCSLMCWPRGCPLAESMKCLLSLS
L8IM55_BAX-02       ------------------------------------------------------------
L8IT09_BAK1-01      ------------------------------------------------------------
L8IT09_BAK1-02      ------------------------------------------------------------
                                                                                

L8IM55_BAX-01       PGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFFCINYGIFQGGGADLG
L8IM55_BAX-02       ---------------------------------------GLLSYF---------GTPTWQ
L8IT09_BAK1-01      ---------------------------------------AALD-L---------GNGPIK
L8IT09_BAK1-02      ---------------------------------------AALD-L---------GNGPIK
                                                             *. :         *     

L8IM55_BAX-01       AMGVFLTFLIIGVGQGREAWSWGVGTINLFRTTLWSLSHWARFLAVAGDQASCADPSFSE
L8IM55_BAX-02       TVTIFVAGVLTA------------------------------------------------
L8IT09_BAK1-01      SVAIVLAVVLLG------------------------------------------------
L8IT09_BAK1-02      SVAIVLAVVLLG------------------------------------------------
                    :: :.:: :: .                                                

L8IM55_BAX-01       GNQCPLWVSGELNCGSALKEPTVLRGTEAA
L8IM55_BAX-02       --------------------SLTIWKKMG-
L8IT09_BAK1-01      --------------------QFVVRRFFKS
L8IT09_BAK1-02      --------------------QFVVRRFFKS
                                          .:.     

© 1998-2020Legal notice