Dataset for protein Bax of organism Bos mutus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        *  . : * *: .       .***************************************************
-------pRphsptvSpQlrst-----qsFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
mdgsgeqm gggdss e imkhgalllpg                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************************************************  
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWvr
                                                                              dg

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *:                                                                             
pLt-----------------------------------------------------------------------------
l spphsptplgplglsvptigvppspfwghmsdqplihrvpndlsmtldllmtsdllvtpdpmprcppwclppiplesl

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ::..*                                                                          
-yygtP--------------------------------------------------------------------------
kffdn ltsplvgpcpylcpltppcslmcwprgcplaesmkcllslspgrpplllwdthmadsdhlcgwsahrlahhlee

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               :* . ** :  .   **: * .:          
-----------------------------------------------tWqvvTInvfrvttwSLtiWkrml---------
dglrpstaldffcinygifqgggadlgamgvfltfliigvgqgreaws gtg  flagtlla  sh akfgavagdqasc

       410       420       430       
....:....|....:....|....:....|....:..
                                     
-------------------------------------
adpsfsegnqcplwvsgelncgsalkeptvlrgteaa
© 1998-2020Legal notice