Dataset for protein Bax of organism Bos mutus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|L8IM55_BAX-02 BCL2-associated X protein OS=[Eukaryota] Bos mutus GN=BAX (length=192 residues).
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|L8IM55_BAX-01 BCL2-associated X protein OS=[Eukaryota] Bos mutus GN=BAX (length=425 residues).
MRPHSDSVSPQLRSHPSFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVF
FRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLTPPHSPTPLG
PLGLSVPTIGVPPSPFWGHMSDQPLIHRVPNDLSMTLDLLMTSDLLVTPDPMPRCPPWCLPPIPLESLKFYDNPLTSPLV
GPCPYLCPLTPPCSLMCWPRGCPLAESMKCLLSLSPGRPPLLLWDTHMADSDHLCGWSAHRLAHHLEEDGLRPSTALDFF
CINYGIFQGGGADLGAMGVFLTFLIIGVGQGREAWSWGVGTINLFRTTLWSLSHWARFLAVAGDQASCADPSFSEGNQCP
LWVSGELNCGSALKEPTVLRGTEAA
© 1998-2020Legal notice