Dataset for protein BAX-like of organism Astyanax mexicanus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            :::  .  :  .::  *:            .    .    .     :   * 
-----------------mavggrdvvdkqlveqgalllrdyiysRlsregpdwsvvtvnl-g-pdevpdpsikvvvqvLl
mmadsgdsggnedselvgstfqgspyedeilslskvvckgfvlr vqttnlsvrksrsdql-rt--gdggqlgrlseq q
 kgmevlrrssvfamfl-mlmkengta-n  ri ys  in  sq it hlinnalaers gdgsvp--  nh k gsr  
              ae ceaae g s v     r      he  n a eid a dkg   e e lc  a  e amc  
                  d  d e n       i              dg     h      a        d      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.:.*:*:        :.  :  *.      ..:.*: :*  *::   ..**.:*::: .*                    
rigDeLn-------rnvelqlmIsvvqlsvvqdvFltvAreIfsdg-inWGrvValfyvAyqlv----------------
qla d eymrpyvysdtarkhl nts-enptsea mki yt lttwkft  ki siyhl grsigglcpagssshdthys
wf    d l  ni n  qk ss tn-vaqcak   vs     l          af cgfg                
k                 en  das m       a                      e a                
                          a                                a                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                         ..               .   .       .                         
--ynavrtehpdiistiiswt-leyvrvhvvawiseqggwtgitssv-------pswrtvtvfaagvtt-----------
gq---l-qnvlmsvrntvrrlpgrfmkts-i---rtrrhyewvrtylcssvntttrf--h----gvclveavavntapgv
  vkt-tpmtigmnqqelnnv vqlqcl-sivkrt flfsfqrqi   i lestcts-wyvvdkafl          l
  pgg lkkl ealke edcm rdhka sn ldq    dd pldf     gdap qd vllp e  i           
  idc  hge a  h          e   e   g     a lkc      ea   e  gail a  c           
       e      a            d               i                                    

       250     
....:....|....:
               
-----tvlvmwke--
hylksvaflyrsmsy
el galrayvnrrlr
     cl ill  kk
     a   fi  a 
          f    
© 1998-2020Legal notice