Dataset for protein BAX-like of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1IPM7_BOK-01      MKGMEVLRRSSVFAAEVMEVFERSPTDKELVSQSKVLCRDYIHSRLNRAG
W5KF74_BOK-01          -----------------MDLMDRGPSEKELVFQSKILCRDFIYSRITREG
A0A3B1J1X1_BAX-02      -MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTEN
A0A3B1J1X1_BAX-01      -MADSGDSGGNEDSELLGATGGEDVVDDQIVEQGALVLRGYVLRRLSTEN
A0A3B1JGN3_BAX-01      ------------------MAAQGEGYAVNLLRIGYRLLINFISERLQRTL
W5KCK0_BAX-01          --------------MFVCSVFKGNGNE-QLLDLGASLLKDFIYQRVQRHG
                                                   :::  .  :  .::  *:    

A0A3B1IPM7_BOK-01      IGWSKADHGL---SA---GGSLGEVSSVLLWLGDELEYLRPNVYRNVARQ
W5KF74_BOK-01          LNWSKVESSL---PVPVPDGALGDVSMVLLKLGDELEYMRPYIYRNVAKQ
A0A3B1J1X1_BAX-02      PDVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLN-------RNTELQ
A0A3B1J1X1_BAX-01      PDVRVSRVDLGGRPDEGDDPQIKVVVEQLLRIADDLN-------RNTELQ
A0A3B1JGN3_BAX-01      EIDAAVTKNLLDETEEVPDPNIKKVGQRLQQFGDELD-------NDTKLK
W5KCK0_BAX-01          DSNALVTRNQLGGT-ELCDPSHKRLAQCLQQIGDELD-------SNVQLQ
                               .    .    .     :   * .:.*:*:        :.  :

A0A3B1IPM7_BOK-01      LNITVASESVVSDAFLAVAAEIFSTG-VTWGKVVSLYAVAGALA------
W5KF74_BOK-01          LSISVSVESVVSDAFLSVATEILSLG-ITWGKVVAIFAVAGGSGGGLCPA
A0A3B1J1X1_BAX-02      HLISTVQANCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLI------
A0A3B1J1X1_BAX-01      HLISTVQANCAQDVFMTVARTIFTDG-INWGRIVALFHLAYQLI------
A0A3B1JGN3_BAX-01      EMINN--LMPTKEVFLKIAYEIFSDWKFNWGRVVALFYFACEFV------
W5KCK0_BAX-01          SMINDSALQPTQDVFVKVACEIFSDGKFNWGRVVALFYFACRLV------
                         *.      ..:.*: :*  *::   ..**.:*::: .*          

A0A3B1IPM7_BOK-01      ------------VDCVRHGHPAMVHTIVDCM-GEFVRKSLVSWLKRRGGW
W5KF74_BOK-01          GSSSHDTHYSGQPGGVRPEEPGALAEEERRL-GRHFKVC-----DERGHY
A0A3B1J1X1_BAX-02      ------------YNTLREETIMSNQQTLSNLPRELVRTAVVEIVSTTRFL
A0A3B1J1X1_BAX-01      ------------YNALTQNHLEIIKNIISWV-LQYIRQHVSAWIRQQGGW
A0A3B1JGN3_BAX-01      -----------------KMVPDIISNIISWT-LEFMRDHVIAWISGQGGW
W5KCK0_BAX-01          ------------IKAVLTKLPDIIRTIINWT-VDYLREHVINWIREQGGW
                                                          ..             

A0A3B1IPM7_BOK-01      TDITKCV---VNTDPSFRSHWLVAAACTC----------VHYLKAVVFYL
W5KF74_BOK-01          TSVPLDVCSSINLEARCEDHVYLPDEVTVEAVAVNTAPGLELLGSLRLLM
A0A3B1J1X1_BAX-02      FWFQTSL-------TPW-------GKCFL----------------CLLLF
A0A3B1J1X1_BAX-01      EGVIRSV-------SRWRTVTVIAAVAFI----------------AAAVY
A0A3B1JGN3_BAX-01      DAILSQI-----EAPSWTTVTAFVAGVLT----------------TALIV
W5KCK0_BAX-01          EGIRSYF-----GTPTWQTVGVFLAGVLT----------------TVLVM
                         .   .       .                                   

A0A3B1IPM7_BOK-01      LREK-
W5KF74_BOK-01          ISELY
A0A3B1J1X1_BAX-02      FSEAK
A0A3B1J1X1_BAX-01      WKRSR
A0A3B1JGN3_BAX-01      NKM--
W5KCK0_BAX-01          RKM--
                            

© 1998-2020Legal notice