Dataset for protein Bax of organism Astatotilapia calliptera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------------ma---gg--
mmvrteylncgrtqsktdkyssvgrflgeylhlwdfceaclrtagpvatilpyhfrvlllkggfpqtrfgs--dgr--gd
                                                                         shp    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .  .:        .   ... :: . :    ::  .:: : : .  ** *:*.*  .:  **: *::.: *.:*.*
----qnpsqlpsvylglsdvvgdsilevgtvvlrgfiyervqrq-dgnraVTrEqLgG--sqltDPkhKklaqcLqqIgD
mliyshlehemrgaacgdwnsdgqpidedailfqdyviahintegepskh  s d d rpdeqq  qv evveq rk a 
qgss yrq ikyi fd- gs       t n ---a         r                             h   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.*: *.****:**: .   ...*** ** :**:*** *********::**.*: *.  :   :     :.*.:: :*  *
eLdgNvELQRmINqsslcptreVFMrVAyeIFsDGIfNWGRVVALFyfACrLviKalvtqipdnirtiisWvldylReqV
s nr a    l  dvqgncvqd   a  rn  a   -         hl  k ih vitanhlei-qmpfe tiqvi -h 
             n       k      s                           re a a - -s       fv  - 

       250       260       270       280    
....:....|....:....|....:....|....:....|....
 .::                               .:       
ynwlreqggwegvrs--gtstwrtvgvvlsvvlvvvlvyyrm--
isfiva------iiryf-fpr-q-aamfaag--ttafdirkkvr
l  v -      ---   --- - -------  --   fatv  
© 1998-2020Legal notice