Dataset for protein Bax of organism Astatotilapia calliptera

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8N5H5_BAX-01      MMVRTEYLNCGRTQSKTDKYSSVGRFLGEYLHLWDFCEACLRTAGPVATI
A0A3P8N5H5_BAX-02      --------------------------------------------------
A0A3P8NNH7_BAX-01      --------------------------------------------------
A0A3P8NNH7_BAX-03      --------------------------------------------------
A0A3P8NNW3_BAX-01      --------------------------------------------------
                                                                         

A0A3P8N5H5_BAX-01      LPYHFRVLLLKGGFPQTRFGSMADGRGG------QNPEQEPRGAAGGDDV
A0A3P8N5H5_BAX-02      ---------------------MADGRGG------QNPEQEPRGAAGGDDV
A0A3P8NNH7_BAX-01      ---------------------MASHPGGGDQGSSSYRQQIKYIYFD-SDS
A0A3P8NNH7_BAX-03      ------------------------------MLIYQHLSHLMSVYLCLSGN
A0A3P8NNW3_BAX-01      ------------------------------MLIYQHLSHLMSVYLCLSWN
                                                         .  .:        .  

A0A3P8N5H5_BAX-01      VDDSILEEGAVVFRGYVIAHINTE-EPSRHVTSEDLGGRPDEQQDPQVKE
A0A3P8N5H5_BAX-02      VDDSILEEGAVVFRGYVIAHINTE-EPSRHVTSEDLGGRPDEQQDPQVKE
A0A3P8NNH7_BAX-01      VGGSPIDTDNV---AFIYERVQRQGDGNKAVTREQLGG--SQLTDPKHKK
A0A3P8NNH7_BAX-03      SGDQILEVGTILLQDFIYERVQRQGDGNKAVTREQLGG--SQLTDPKHKK
A0A3P8NNW3_BAX-01      SGDQILEVGTILLQDFIYERVQRQRDGNSAVTREQLDG--SQLTDPKHKK
                        ... :: . :    ::  .:: : : .  ** *:*.*  .:  **: *:

A0A3P8N5H5_BAX-01      VVEQLRKIADSLNRNAELQRLINQVQGNCVQDVFMAVARNIFADGI-NWG
A0A3P8N5H5_BAX-02      VVEQLRKIADSLNRNAELQRLINQVQGNCVQDVFMAVARNIFADGI-NWG
A0A3P8NNH7_BAX-01      LAQCLQQIGDELDGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWG
A0A3P8NNH7_BAX-03      LAQCLQQIGDELDGNVELQRMINDSSLCPTREVFMRVAYEIFSDGIFNWG
A0A3P8NNW3_BAX-01      LAQCLQHIGDELDGNVELQRMINNSSLCPTRKVFMRVASEIFSDGIFNWG
                       :.: *.:*.*.*: *.****:**: .   ...*** ** :**:*** ***

A0A3P8N5H5_BAX-01      RVVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQGGW
A0A3P8N5H5_BAX-02      RVVALFHLACKLIHKAITANHLENIQMIISWVLQVIREQVYSWLVAQGGW
A0A3P8NNH7_BAX-01      RVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGGW
A0A3P8NNH7_BAX-03      RVVALFYFACRLVIKALVTQIPDIIRTIISWTIDYLREHVINWIREQGGW
A0A3P8NNW3_BAX-01      RVVALFYFACRLVIKVRETAIAD---SPFEWVLDFVR--VLNFVR-----
                       ******::**.*: *.  :   :     :.*.:: :*  * .::      

A0A3P8N5H5_BAX-01      EGVIR--GFSRWRTAAMVASVVLVVAFVYYRKVR
A0A3P8N5H5_BAX-02      EGVIR--GFSRWRTAAMVASVVLVVAFVYYRKVR
A0A3P8NNH7_BAX-01      EGIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM--
A0A3P8NNH7_BAX-03      EGIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM--
A0A3P8NNW3_BAX-01      -------------------------VLDFATV--
                                                .:       

© 1998-2020Legal notice