Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
    a                          gg p  rgfglgsaracpcqvpr r  mdrpsylmeppqcveeakfmfq
                                      k       g   s  g    srs pgeegrssslmacqstis
                                                              nrsksdarnadggncsvp
                                                               qasfgyplsrdqm ge 
                                                                 r slghisw p qd 
                                                                 n  v   tr s    
                                                                    t   gq r    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----akqpsdvssec-------dreggqlq-paerp-------------q-----------------------------
iledm----ee----pfp esdeg---rpslrsgdlf      lgrlv p-sgk           gg       gep   
spdfdvfss--degd-l   g l-tgp-s--ptta--            agpvs                          
rmsseeppedgegdsan     qpsqla-mp a-pqe            ssasa                          
hvpgasermqrslegvq     dedpapraw -cfgh            gpg                            
gagmvrahqrqidppth     sqaasqhcr kr-er            tdn                            
dskegtdtac lnrrg      nveseskpc esgsl            vrl                            
 gtcqisgga tcmtr      pamrtkeqt lpqfg            la                             
 t ap qvvp paaqe      tsgt tnde rqmpq            e                              
   tt wa n kkfhl       yvl ngvg gnnik                                           
      td    tlad       kp  etev fvkvs                                           
      ci    rc s       hl   lts  ltta                                           
       l       k       lk   ak   esat                                           
                        n   vg    lh                                            
                            if                                                  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
s        qsldcplsrlqlfpl                                                        
         lrrpal gafppgas                                                        
         ppysfs p rhvr q                                                        
                d                                                               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
    l           gsvlrplrarpa rprrp paarc                  lplrphrptrrhrrpggpplaw
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------lrpgapgslqte---qq----------------
gspqpaprpapgr         ssalalaggaapga        apa-hccg-tlrppspaqp-gnpegnhglaseegds
       s                      p    v          qt----r------lhl-eqqgmlscrvnegprpl
                                               ikrqdhptqtaasrpagpsatsrshtcgpsaar
                                               hggrrsaatldgastrlnasarpayayadgqvp
                                               vssetdsrpsepgdsvplgdsdald vr qhgf
                                               qlltsqnvvwsdiqitrdfqp eg  sq tlry
                                               cpaleadqaggcrpmssr ng lv  k      
                                               sqhvhnlgsavnqt gdh  l gi  g      
                                               rvykk  ficltcg m s    tr         
                                               gwqfq  i hhq   c       t         
                                               k isp    eir   y                 
                                               a fa     vrv                     
                                               p        r                       
                                               f                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------dr------spapmscdkst
cphgalghgrga     gspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdt--elqarg----l-p-lps
avqs   gp wp      avetrsrhfygnagprlhfsprfemvdcdvspspllsprgdeeakrqdgseatqtag-ase-
t va       t      gmrs p gssygsdmqpslaahlali   s    pal  rsqseeqpestleeergmee-de
s tt                 i g a resd l    trgykcl             pvrmvvsvgeprgarn-eare-g
  sn                       mpdi a     sqkpsa             lrlassdfaratvrgardtqtqq
  r                        t               f              htdplvhlv  pdpsslqsdrv
                           p                              emgq  e    cstlpqlhgaa
                                                           hn        tqsevpggrgd
                                                           pr        dcyvtavtal 
                                                           f         m dgerspph 
                                                                        dct iw  
                                                                          n     
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qtpspp------------------------------------------------------------q--p-alrpeiwia
------              etrgcqafnhyqrlalqa fygnagyrlplqlsampaglpaserps-gq-ad--a----g
ggvmlr                  agvteepr h   r ylapmepashvppasfalvphlgmqqpsaasp-mp-avqy-
eaepea                  ra vsqgg         sagtnk rr vvgp ed nvqgssresewrsawgnlkae
dmaefc                   m  p             h  a  s   qdw  s girralfrprtqqhsvvkred
avqlae                                              ina  p  gvleeeavprverglractl
pdlvtq                                                      diplgqvlviglwqttrgsh
reda g                                                      pnitragedlsgemepqlv 
mnhr s                                                        wiaki gqhtvesfmep 
trg  k                                                        fg dh lfevtlrsfsr 
lls  d                                                        ad lp hmmrdfqitaq 
n    t                                                        sp g  cal i k dil 
     l                                                        v     tg    i nf  
                                                                     v      e   
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qe--------lrri--------------------g---------defnaly-r---------------------------
rkygreigaq-q-m                    svlrsfmdgf---hr--dqremkrvlsaggt g ng vayrslnta
--waasaatet-c-                    al   lflrrtql--yhlkgnliskkfcsql        wl   pn
eqten   irfkll                    -         qdwdqslp-lrprkgrnrl               at
pral    vkecar                    d         ckyvsefklqvv aas pr               ss
ld      lfdyif                    t         vt rfrqapt     i tp               l 
st      d  dt                     p         l  qeqimsf       g                g 
hg         ps                               f  edhreav                          
ap         eg                                  atwvvh                           
 h         gm                                  kgnsie                           
                                               ywteqd                           
                                                pgac                            
                                                hfpt                            
                                                nd                              
                                                l                               
                                                v                               

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hqnqgsprpksagtatqqqrpsw               w  v     vfwrnrnrvwlaqallsr s pgalptysllwp
rrmhrnqglrgrqeeqhmrqsll               l        lslfrlqaarreaswwdp         laycfs
kgswhlrs trllltlprh qpr               r        eppnvyaysealtlpal           nf hq
pkevvpkt il rghrglg kv                f        pmqtlvylqadtp  rp           cv ld
sclptale m   r klws ia                         makqpnpglqssd  vt              pl
qpi q hl        eyd  h                          qi hqdqmsk l                  ag
g r a  a        r a  m                          g  gkipppv r                  ve
                                                e  aaffi g s                  ia
                                                h  qfrvr p g                   r
                                                    hle                         
                                                    es                          
                                                     h                          
                                                                                
                                                                                
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qllilgllalngglvrpgqgpresagdflctm      l                                         
hmvfarnvrairrrnarshernatqip r v                                                 
rgeaeheggygveerwnmastel                                                         
iqftmaginslahhslhrrnqgn                                                         
lncldvr pdpnasengemrgl                                                          
wktspqq tfesdwlsllsdlt                                                          
afavgtv  gsqnggmstppav                                                          
psirv d   qisahtapvv s                                                          
vep   i    k qp eakl                                                            
dc    a    f td  nt                                                             
sp         l  a  hl                                                             
           t  y                                                                 
              i                                                                 
                                                                                
                                                                                

     
....:
     
-----
     
     
     
     
     
     
     
     
     
     
     
     
     
     
     
© 1998-2021Legal notice