Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                    a p    psp l     l g gmararqegsspepveglardgp
                                                               rr  r r rgmr gass
                                                                        s k p aq
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------sd-s--------secdr--------egdqlqpae--rppq----------------------
rmfqpmaapfipemakqp-ev- twvpcqi--veeglgpspalddpvfes--hr---grrggd   rggi          
spapfcqgsrtidfepseq-pp   p    qc---aaramddg--r-gsgedllgag-p q                   
arsc gdvkalsrsvdgsmvdc        esaggsepsarteprgsa--dhwhqelas e                   
   k  sqn smslpqvdaasy        gppskkrarkslqls-pppqkpyetrhc                      
       hm pacrlspleqtt        rlmkpvgngpnsagqla-aasarvlqnr                      
        t mgnpcwyatsaa        mmlrarssveeppqastrlygqpgcgas                      
        r kdqhted rgln        cdr ddkllvlriheermgrcrasatst                      
          a  dsnr ct g        pkt stdd rtncnmtltckvtq fsel                      
          r    t  g  f        agg qe t lc takknsh rsf ddrv                      
                  n  e        nas t       stlngdv h   s vp                      
                  p            rk          sva vt t   e  k                      
                                e          kt  ef        e                      
                                f           h                                   
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------lrp-g---------q------------------------------------------------
                 --- -aptslqtep-gnpegnhgplrgegdscphgspqgplappaspgpfatrsplfifrrrs
                 wqt dsslqadlfaasssldvlrg trsharrsqspsps   l hgaralppgggavetmsph
                 tlg relhpqgqrqtvqggsgrl  garpklslrr rsa     l hasrwqvalrsrrvgtr
                 apw ergagtegqrpnllynmq     aa  l            r  etqv   vfrvppifq
                 ggq ngmsarpiatrqaqi        gk               p  sc d    sphistst
                 stl spar parsslpt                           c   e       mlvy l 
                 p s atq  irsd slf                                        sc    
                 e r   t  sna  cag                                              
                 h         sp    i                                              
                                 r                                              
                                 p                                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------------spap
eiw                                                  sllsrsssgyfsfdtdr      g-r-
                                                     cpprplqlfplthccgp      -l-e
                                                     rvrg fgpplawgssqs      tsss
                                                      t   gh       pe       pfya
                                                      h            a        lepq
                                                                            avgh
                                                                            vdek
                                                                            ratt
                                                                            ctlr
                                                                            qmfi
                                                                            mq  
                                                                             i  
                                                                             y  
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
msce-ks----t-------qtpsp--------l----------a-l----a--------------------app------
--qddra    -lrltatl-----pcqafnhy-s samvteep-s-fygq-gyrlpvppasgppgggrsrs--alseleq
tptls-p    etsdall relglaspsqsvmst pcgsaqdeqrmrqsneefgshltatpfalfdrs geea- aqesr
aks-tdg    giatp   asgrvrlnpeggara qsrdrna rpeegeegdalalflsgfelarrpl trqqr r gqe
vg-qea-    qd rk   gnadaspavndqvv  vralsg  elraeagstekrsrggrdsdfalhp qqvre   apg
ilarcle    rs q    pgetitgsgmqdgq  etlrmd  deqgrppd pe rhhvhgpsevsvg llrgg      
phvpast    np      spvptdavldaplc  ln  v   mhalsdsp lv gq lplqrvmple avghs      
qegcgpi    v        a l vvteiflp   rg      vvism vv vc  a  eelvsp ai kplid      
rcevlhl    d            ldycprnt   a       gdpdl dl n      ciw dd qv v dlq      
lqdshe     a             kmrht             tqfia a  d      sma  s t  m p l      
sdpanv     s             eg a              pnsvv i  q      vr     n  p n        
evy  g     l              r                nidht r         la     f    s        
gar                       k                 fwt            d                    
 r                                          g              k                    
                                                           q                    
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------r-ei-igq-e--------lrrigdefnaly-r-----------------------
ngmerlp          eg qaedm-pa-w-arak  flrrct-q-ms-qlhr--dqremrrklsaggtpar ggvavpg
va hs g          nl wglalsa-aqy--v-        p-c-al----yhp-gnlkkvkfcsrast     ly  
rr  q            gq rwvehwwfvrlta q        fkll-edwdtsleklrwisrarsras g     vl  
g   p            rv lpaqrqvvqkvrg r         aafmvkyvsefklqlqlahrdrlv         m  
                 qp gqyregtgkered v         ysap g tqrqlntma ngs pp          a  
                 la frpgqts rctll d         sg e r efqrasivp  ti ft          w  
                 ah cfglwfr dad n p         eq   t adhvmpv    a  t           s  
                 vd siqsamg mdp c s         h    f qnwsvd        l           i  
                 tt pe vt l tga                    rggaie                       
                  e tl  d k ef                     cwmwca                       
                          q ll                     yhnpqh                       
                          e                         c  t                        
                                                    l                           
                                                    p                           
                                                    v                           
                                                    e                           

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
altthqnqrsqgwaaaqvaalaawplwlnnylaselprpgsagtathqqnrnrvwpqmsilrllwyivrllllrlswwpr
  parrmhhnrsc           rvfrwsfqfagdetekerqeerqmrrstqrhrlavavls rtrlwqvwrfglplda
  ankki wpwl            lfgwralpwphkwadrrerinngreqpqhpreelpsfav arvaynifdmqpvqsh
  s yp  q kr            gaaqfhhrpvtqllhlgltrtqlhhphsvlatdtal vt lfgiipfimghalryp
    s   v pt            sglvsd vn pa s alqlghsevsgep mlwrilp    paaflf aelrrfpq 
        t                nqapr  e rg p t  esvkplgaql atsv tg     cltp   tes rf  
                         mes      sp e i   pgl ww la  pah im        f   sqe i   
                         r        as   m     a yd d                 a     k     
                         e        nf                                            
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
fiaggggalpgrr   hnlalngeegrngagprqqlgltqipfrc   q                               
hgtpallhglqq      v   anlnagesaqsasgl                                           
q  t srqhslk           gsrqpsmeans                                              
l    etd   s           dh  hrvldgp                                              
a          v           tr   hpr a                                               
           l            a    rm                                                 
                             tp                                                 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                  gactrpvdvrdsggrplpppdtla                                   l  
                     pa                af                                       
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
g m                   sagdflctmw        r                                       
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

     
....:
     
-----
     
     
     
     
     
     
     
     
     
     
     
     
     
     
     
     
© 1998-2021Legal notice