Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
  p                                                                          g  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
  rg   g prl           g r   g s prgg   a  g                                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
        rr      r   rl  vl pl aspa        a rcl      rp  par h apg              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
   a         a prga altlag  apg rparrgiqpakqpspgssggdreggqlgpgrdlg rpggsrrsppanm
               r                ag  mpdpmggssasvppespgqs avq a     e arrssprqpap
                                    kk g  p   daha c  k  re  t          dgnldltl
                                                                        e g aqra
                                                                            r l 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------v--pa--er--------p------------------------------------
aamfqriepmakqesdvssecdledd-fq--  --p qppglr-gapt            slqlfpqsqkl      ggg
gskmtempesecvpeedvrmdgrdggqlese  dg   elqpqarsdl            ladteagggph         
qdgpalasdfqpssqvea leee  rspged  pn   gastsgaglp            agrpvssanse         
lhnsskvdqpgsegggpp  g    seqhag  gh   lqragttesr            ctgqaqmplrr         
dtatgisrrergdtpayd       er  gv  at   krasahqpfg            rspiqgdnvvc         
  p n qt adylarsan        p  ms  ss   skpdnlsrrq            g netvvfeaq         
  r    q gsqt m lg        g  tp  kl   dslkkvkdqs              hgrtalkgy         
          hta   g         t   k  rk   qghgtsp mk               rmlers g         
                              t  qf   nhvrlee va                 rrht p         
                              r   v   a n d l g                   p d           
                                  d           n                   l p           
                                                                    h           
                                                                    a           
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------l------------
gg g g rgepdsdsppcs    vs pasldvfrsrsifrpprrsssgyf           dcplpg-qscphgspqgpl
           ep                                                gltasrglrs q       
                                                             srqggefd           
                                                             hnsedsvp           
                                                             pfhraimr           
                                                             tsakftam           
                                                             ricc vpg           
                                                             aqls hia           
                                                             nvdv d h           
                                                             wmmq   k           
                                                                t               
                                                                p               
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------drsp-aqes--------katqtpspa--s-g---l--------
lfplthccgptrsplfifvrrssllsrsssgyfsfdglaptfspmd   f cdd-p-sslg-pcqaqnv m-pcgvteep
apraspgpfa  aaylcaptappavtaalgaprwpgt-pthkqrik     qehrss-gs-hgsp-f-h yesamlsrhn
sa ga all         m    v            cw-gsrrelq        lgae--hsslspadg vsespeasa 
 s  c sqv         r                 wtslrag--r        v-gdmeqa-gvgreq hmtrampgd 
    p                               eml-- -wgp        enlrkhtqtpalnaa k lpecqam 
                                    rsmca pkv-        arptraavlalttse f nhw rqs 
                                    sptak esql        ctigiqptvqicsts         l 
                                    keehy cmsh        sqfclgvrrhgeg k         f 
                                    dahqn t rc        qdel tm   fqh w           
                                    mgn l d de        dy p ir   y v t           
                                     vg g v h         gk v      m               
                                     r  q   t                                   
                                     h  i   f                                   
                                        f                                       

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------r----------------
qr                               lfygnagyrlplpeagfptvcystgdpfrg-sp seeeqngmerlp 
rp                                ssepqafeehflpgsgeld   lllaageqps rtaqrrr  q   
ga                                aealsergddvvdvhtaae    aahlsreqe       s  p   
sy                                plyhgrtkseq vpmeseg    qsqeamtgr              
h                                  vnspspmqa  qsrpgsq    vpspevieq              
                                    pdddgltr  glda mp     gliqs ak              
                                     fm khgl  stal rs     eimvd ra              
                                        aa s    tv gl     nfdda hg              
                                        sp g    cs va     fnvlq dl              
                                        nv      lr dm     rrt t  f              
                                        ld      em  i     ygs p  d              
                                                            w i  v              
                                                            r    n              
                                                            y    t              

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------saqp--wraeayigrk--------Lr------------------------rigdefhrly-qr--------
         egpwal-a-ave-aqe  vecatq-q                        cma-qlnashmrgllnlinkl
         qee-sqh-pkrql--q      i  -                        a-sl-----llk-vgfflsny
         rp-rndmsvqiwtea-      l  a                        ll-tdmdsyfd-qraiekahh
         nqglvards--lvnlr         k                        -fkvkwvge-pwln  svl n
         --vecesgrdk-rlvp         e                        ksp cyrvrtelk        
         dllfrpaptpqcpvhn         t                            tiqqnrrat        
         psrtemeqlrmv  g                                         edqvvpp        
         lhcqpvlnentr  m                                         angqke         
         hfaadgt ildf                                             phpig         
         avdgg q   ld                                             ldwa          
         vms q c   es                                             tw t          
         idm l i                                                  wc c          
         g i                                                      e  q          
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qaset   hpqmvilrllryihrqrprsagrarqmgapapqqplwwgalpty  tpvwwqillflahslswlnlalsrie
fcagd   q  lil  v   lyqrnrklhrtqtnqrm hi  epvam        wsplrvayrvraaplphlflrghed
lrvqg                elpvwqqrnntksall      v  l         ph cafanmiqgaaswsydfngra
 gt a                vmlevtmqqlsevl        m            a   l  qrhmlsgltrrgqraqn
  p                  rakkesgthavpgr        s            m      l mrcktifpvihqfpg
                     ipaaqhrpaspgpw                     l        tlhrvvafifdawdp
                     fvetgpvlpfeski                              gtnvngqaaywltws
                      ggsl hvdqnlrn                              vsrcfa g rv pkr
                        gc fgvphqlh                              lykic  y vp llm
                         n a  gy ey                              sv yr    ck qt 
                              il                                 q  t     nt vf 
                                                                          ei mv 
                                                                              g 
                                                                                

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nrggagsraphenhlrrnemrfwrs  pnpgswvsreqvllalllllalllalls         gglhlllk        
generrpsnhsqsggqetivflc l  l sr  l p  a gq  p  l   l                 q q        
rnpnlhrnmdgsttthtq psrl v                                                       
mglrqtgvsaafqnassd   s                                                          
lddvvsqflsllvvslpa                                                              
tasagdnltlv asfk                                                                
itq n  pq p   rp                                                                
ala t   i                                                                       
p e k   h                                                                       
v r e   g                                                                       
s                                                                               
y                                                                               
                                                                                
                                                                                

       890       
....:....|....:..
                 
-----------------
                 
                 
                 
                 
                 
                 
                 
                 
                 
                 
                 
                 
                 
                 
© 1998-2020Legal notice