Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
  p                                                                          g  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
  rg   g prl  s p     cg r   gps prgg   ag g                                    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
        rr      r   rl  vl pl aspa        a rcl      rp  par hgapg              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
             paprg  altlag  a glrga rsssrppnpsdgstevtpaggtggpppsagsartgrssspserp
               r                    kpgqpakqll v pgsdree alqdaap  ahasparrkhalas
                                     kdgmggrr    s cpg   qv  gl   tep   pkprtqlg
                                     h      s            ip   s     g   d glr g 
                                                                        e   q   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------dvfqps--s-e----------a---------------------------------
gapmarmeppqcveedgsmmdmfed---e--dv-g-cdtepgqlls-erp qppqlrpgapt            flqtep
rsrpggarqsgyl ggytsaadlqimak-edeqesspgrqgrssqpedl     gdgsspag            sapsqg
cgaqsegdrerrr spagglgketvpedssespdecwragvspfslggq     lpqtatte            drsass
 r trlqstas    as tpegsdrssphrvplpdtaadp  emvetrg     naelllgq            eplrlq
   r   tgra       aqsnkgqrpagdkiamnlrhgs  rppglse     tqshprms            agggvd
   a   p g         etegaaeqldqgvtahdlvs   gvaaynv     skkaesdk            vqrnpr
       a           dh ms gni atlsrfg tk     t sak     dshg gvp            gvk gy
                   g   r krv thafgcp          p i      nd  qs             qtf i 
                       n  dq  a  nak          v s       l   l              s  a 
                           s     lqa          h p           e                   
                           e       q          q h                               
                                              d                                 
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------p--------------------------------------s-edrgtqt-spa------
qgcplsrlpgllddcshqqpqf-lthccgpggrfalesplfsfhstsrdegprwpmglrptrq-pka-e-legssspqgd
ldnheggaqleggsapegsglgraapphsgsypgrvrtrsairvvfaalgl ss gpfkei-rs-a-s-spga-lpsdtv
sskchrqhgkttwrtgqedeaaatsssahstpaactnaedeasl vdgesa    ltgpkaklas-ldrgs--yfafteg
cqllsqnptsvvrpv ss ldsselrrllaeelvymspsthvat i s        sasspecqclqpdedrsgtqlede
p qvfptqh apee   p  stqmpdattdasfeqycg rqpps y c        rpehrpsyaipespaqvlaeennq
y verdsga s         i  veltsvhn tlsiad nmlya l          dv rvttknseqmmtvtmgvaasr
e pmktpfe m         p  pcnkqftl qiw yr evcem            ar tsaegewrrllelrpvd sqa
m  spflvs              srk gar  stf  n wstgd             s   vwvicsicdqpltel h l
g   wahrn              gg  rp   mq     p r               i   gfngndktqmd eq  g s
     l mk              f    e                                dmrhgkap  t q     p
     k  r                   r                                q pvvv a    c      
     h  d                                                      mrq  g           
                                                               dmd              
                                                               fl               

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-mlpcpvs--------eepqs--------------------------------------------------appac-a--
r-p-agfr     cd grsrt                               lfygnagyrlplppa    pf-llw-ag
es-esalt        kst-r                                hgappefkshfvgs    ssap-qpfn
aevgpqmq        --ak-                                   s rp vrvhsv    --e-vldlq
shrlgttp        sa-ga                                   g  t  ga  h    gggtgacpk
gvcahsia        rvgmp                                      l  l        hlknqgise
ppesd--h        amnlh                                                  resvafrid
lamnqlpl        lq sg                                                  dmnssssga
  svleed        pf vy                                                     itynql
  d - rg        dl ee                                                     hirtyr
  i v q-         i h                                                      fdpqhs
    r ce         d n                                                       mvhr 
    f                                                                      yi   
                                                                            c   
                                                                            m   

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-y-ge------------------------------------lrrml-defndqf-rr--q--------------------
h-lsamseeeqasmrqsqaepadmrpeiwigqwvahraeaqiaqkglqcigasyhkghm-lksaggaagmrqshpqmvil
erpprqrtaqrngrerlpsv p lq  qrqapeaqrsigvc-gaisf--l---ld--llrqvnsltttqtmrtpswtil 
kqg--e   d rri egvfd e t   mlhqcfqemevaqev---- rl-asl-pqlvpnrirkaqcseqidkslre   
rerqqk     v l paiv         qperrlrwws irrtgva kkwdgyvraeerkplgnyfrlrdg atapf   
vsqedd     d    e e           php dlqr ds edlr ldmveepepkrvwerarrrskkgl rnfkl   
anaalg                        r   va t  f kkft vs epg nnttitftkltlhv w   qg q   
qk rgf                        m    q l      ap ha mtn kedakekqphpspn p   r      
g  tvr                               p      qf  r rnd awsyalggiihagg a          
s  ns                                       pe  t qvw qlhqtfna  d fp k          
l  ht                                       c   q irk ct pgvm        y          
i                                           e     h r    i a                    
                                            s              g                    
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------ww--------------------
rllryivrlvhrmq   qqnrrnsrpap      galptyplnwpwlcaaaqvaalas--srllgrgesegeqqvnlrll
 v    i   y lh   hraqhhqn          l rivr rlmphiqqept m  vprdynfshqstapsssggnqve
          w r    rmrhsirq            q                   allpftsnprglvsrlc lshia
          e      ghqgnvig            t                   lrfap p qknwdaaev cglhi
          v       lpegrak            n                   mfpn  w shpam pg  p amf
          g       ghaqaha                                f         avl l   s vqt
                   e dlmc                                t          pg       tpv
                     aqfd                                n          m        p d
                      fvp                                g                      
                      ylh                                                       
                      tct                                                       
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lflirgealls         gglhlllk                                                hnla
yatlmtll  g                q                                                lsvl
ahrall                                                                      vlip
snghpn                                                                      rimy
nlvr a                                                                      qy v
tviq r                                                                       t  
ptac                                                                            
imss                                                                            
g  f                                                                            
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       810       820       830       840       850       860         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                     
---------------------------------------------------------------------
lnreenrngagprgrr                                                     
fdgggfiaegega q                                                      
rpadhraprmsqn l                                                      
 qvrtgsedv rv                                                        
 r nrlvhhh  g                                                        
 l  as d t                                                           
 e                                                                   
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
                                                                     
© 1998-2020Legal notice