Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                           p                    g pgr ragagsarac
                                                                      k s  r    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------q-sdvssecdr--------eg--------dqlqpa--erp--------pq---------
pcqrpgagsamaamfaidmak-p-e----vee       edd        rvfergd -gepgtqpgsp-g         
 psvrrssaspwtpatmqsmfsip-ppeps--       l--        ssagsep l--wratfrell-         
 r k lnrhgrrvrcqvfgpsgdmgfrqc-ad       ggs        --ph--s plllaglkariks         
 s t qlq ngsptlsesrideetpsepsmgq       qrm        gmr-kd  qaqepprmeamac         
   a pv   t cknkkrtsrymewdgraerg       rke        et-lav  sncqvlagsgstp         
      r   s h glapdeedlhatntgrsv       saa        armcts  ahraqspatkvda         
          d     ncpdthvd amddlks       ppl        qaddyc  rehs  sslqtrv         
                s  va ra lymqgca       tln        pptshp  tfgg   lqtrqe         
                g   p s   agla k       ksr        kkstqr  ksk    r pqgr         
                    l q   fati         a p        mnepgt  gtd    t icsn         
                      a    crk         i           gga     vs    e  e l         
                            v          d           lnn     qa       g f         
                                                    w      c          y         
                                                                      t         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                          algrvlrplr            
                                                             sl    v            
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------rp---------------------------------------------------------------
             el--fhtlplprlrrlvggaptslqteapgpqgnpegnhgqppgegdscphgafaqsqsldcplsrs
             pdggrpa teleqslttppgrgrhhsqsqallwdashqqelrqhaaadlaqt ptrplgysslpgsl
             vqsqtlg avgm g f asssvksnrcehsrpaagarpelevavrptri p  hs ngdpplawavf
             qpdhqas giid t   redalacplttsvstrplgacrpda  s ygr     r  ppsn vftpt
             stvs q       l    aklsqrsggrlrqasv rsiadps    pls        a     aqar
             gkqd         a    t ki vghrqgtysqe lqhl s     s                 rhp
             thhr                 a iyal r fg g qdgs       r                  gq
              ap                    pr     c  t cmed                            
              s                      w     a  l    g                            
                                     t     g  s    c                            
                                     k                                          
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------scdkstqt------------------
pqgplappaspgpfatrsplfifmrrssllsrsssgyfsfdtdrsppapmedkatqt--p-sps   g         qgv
qlf rthccg       hggg  v agavetfgrhssyrpsspglrhtsqqggs---lg-a-ep             nng
shs fprtsr       l ap    twpsgplafprgsl ggalpsrpegpsrrpaepeldeae             gda
aaa  farl                  rgsy  ldcdpa  veqaq lgtm   lvgtdeelqr             lqd
lr      g                   r a   a ea     sv  sdla   gssrhaspvv             dft
hp                          m i   t         i   v     rpaqrdggsl             pss
 s                          t                          lpeagpdmw             rrp
 i                                                     hqanstadg             h  
                                                       ecg rh i                 
                                                         s qc                   
                                                         v                      
                                                         y                      
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--ps---pp-----------------------------------------------------------------------
ml-cgvteeprrlfygnagyrlhpcqafn              etrgaaa pplalegpvqshhgtpaltqgpqs     
rge-eaa--lqppaaasgdflslflapas                                                   
leggrlgtsd gasmedseppa rpprie                                                   
aqavmnsgaq m elrppnlkq hvvhvg                                                   
vslm thdle     hgrarg  latcra                                                   
p de i at          av  yq vld                                                   
e  a   rg           t  q  sd                                                    
s  t   h               a                                                        
   p   v                                                                        
   d   q                                                                        
   n                                                                            
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------asgrp-qgrp-sar----------p----a-----------l-------------------------
  hylsamparlp---a-fraesadmp          -elwi-aqeyereiark-                         
  lvgdvfalgrhlgmqqpe-v-eql-          aaigaedksagvqcgqqf                         
  dem le vspqedeslsgrqmr--e          gnrrpv rkwaqctraep                         
  ra  qs pvqrgrreee-sawqehg          rqmqer ervvalr gr                          
      hp  dantpp-gaan-tkapa          tvqfll lqtlidv dv                          
      rr  ps veslalpvprlrsq          ltdaqg sdlsdrs it                          
       g  q  dqldsqspgchlwv          qrpssp gtf ctm tp                          
       w  l  rlatddvlcaspts          di vty ahi tgl l                           
       v     iiigrrtelqggvm          sf  v      eky v                           
       d     hvvp gitslpcrf          es  g      n   c                           
             pnwi md dfv dk          vh         f                               
              kq   l nim ew           c                                         
              yf     tvt                                                        
               t     ig                                                         

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----rrigdefn---------------------------------aly-r------------------------------
    q-ms-qlh                                 r--lqrvmrrvaslgrsgt  g vaygalptahqn
    -c-al---                                 -yhdkgllkliskafcapa      p   qsyrrm
    kll-edwd                                 sslp-qewnkrkrsr t        m    atkkl
    yafpvkyv                                 qefaplmp  gr pl               qnspi
    lspm t a                                 tnrenkrv  ki t                 lqae
    sp e g e                                 dwsmltig  an g                  g  
    hg   r t                                 nhvrsi     l                       
    eq   a q                                 gqqvds                             
           r                                 htake                              
           y                                 wgwia                              
                                             cdpch                              
                                             pr q                               
                                             e  t                               
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qrsqgwaaqvaalhqqnrnrrwlnlysaaedggprpksagtatqrrrsrlaaallslctmwplllflrllrlivearrng
hhnlsamgl  graawlplwvfsynfqhqsteleenrrrqheqemhqpsvltlval  v hwqmvirhnmaynglenggl
wpwrcl       lmailgqwnafpwppspatarnahnehetrhqtete ts  vt    pqirflngivgqsfwpgshr
pq kak        l gqr mlhkdllgkwgdpqssthlnvskgsvplp  l        slrvadglvrirlwidpaep
na pqf           if ssvrhhrrvrsi  t gdmrrhnpwglaa           l tfiyqsr  fapfqa rh
 v mr             v avn  n ep l     agf  ng t  e            g vgpv q   kqldg    
 g  l             m  e     l  k      an   s l               a fq a e     ars    
    t             h  r        h      l    p                 q d  e t     rvt    
                              e           l                   a          ipr    
                                          h                   s          e n    
                                                              h                 
                                                                                
                                                                                
                                                                                

       810       820       830       840       850       860       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                   
-------------------------------------------------------------------
agprrr        rlvwrmnlgrgss l    apsqsggltqipfrc                   
hlqgq         p    lhrrapem      eans                              
grllk              rqs qhgv      l a                               
rs v                gh k la      m                                 
v                   t            g                                 
t                   r                                              
p                                                                  
                                                                   
                                                                   
                                                                   
                                                                   
                                                                   
                                                                   
                                                                   
© 1998-2021Legal notice