Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
   g                         g              g      g                            
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                            r                                    p        a     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
   g                  p     mptpraps asthaqgarkssrppnlldgstevtraegsggdmaakmfqmak
                            sg lk l      gp l g g   pgrrslgargpsrrtepappqsftiipe
                            g   e                    r   ar asgrgp ds tsgnkdrksd
                                                            l at t s   rtpartpns
                                                                       dsmraasra
                                                                        r gs gdr
                                                                        p       
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------p------------------------------------------------------
qpsdvseecee p  mddregrqle-                                aergdrpsgsgkfghpqlrpga
fepseqsdsgg    leseadggmqg                                spgdqsapdqsg eqhrqardl
sdqepmaradp      rsgedvfgs                                ggaagglaspa  argetlgsg
akgparngv s      gqtpsspdr                                vktptqsgtl    iqmsqefq
dqhtspdqr        ppsaeets                                 rtsnlt rvk     slgpvpt
  tgtgc d        eg  ar a                                 elnlhp teg     rgagles
   vrn            d   l r                                 tslskl nq      w  s  k
    l                                                       pq h         e  v  f
                                                             k k                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------s-----------------------------------------------------------------
pt            -  lqteqqgqpeisleddgfqcpdgeprgqpg slpspgpfaqrs                    
lr            p  qcvhettnrpgksshhvdspegpslglpss mpaaadlestsq                    
rh            d  palwpdefsgtncpgertgtgavrtqsrla pylcgralepdp                    
gq            g  dtsgrsssllalhgeravrashcavatnne amsevvtvprnl                    
eg            w  fpcdsrpp srgvdpssplsalsvfvaghr rstptsqsis d                    
 s            t  rngqhlya asrprlllshgdqegippaaw ehvgsarivw a                    
              r  shp   a  rd rkvak tdhsmqssvyr  ifryltsata e                    
              k  eya      kv t  v  p terk  msg  yqctwcvyl  i                    
              n  aek      d  q  i  a  tfp  rhd  gvg eligq  r                    
              a  gs       c     q     pdd   et  vr   hg r                       
                 kl                   n     t    t                              
                  r                                                             
                  g                                                             
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------gpgs-ppaprs----------ks-----------tqtps--p--
           llfcplsrlqlfpfplthcgyfefc-drlr-teqmd       cdqra          rqpplara-ac
           pfdifagfslh  lsrslsadrsadttetdgrsfeg       per--          ksasst  lps
           eyygnvrersa  aefeseceewpeegp-eee---a       mfplp          qrsrvc  qse
           amltlptaqpv  vhaqagvpsltrrqsgsa-pen-       lc gg          ll-aa-  gtg
           g esamysphr  grpamvssddesmmcpmsagklr       a  an          ppd--g    d
           s s s dhfrp  etslfrptlrvvsavkctlhrsl       i  q            -rmme    q
           t       hv   sdepvdm qqgglslekdsvltp                       agvkv     
           f            qa vda  atsqde-rlldrvqq                       hlq q     
                           mei  pamaqhdvthwqdcv                       g l l     
                            gt  h r p-ana qtgg                                  
                                g   crqmn vdaa                                  
                                    a mfp f                                     
                                    v   v m                                     
                                          h                                     

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qaqgvmlpcgvfnhylsampqrlfygnagyrlplppasfpa             smrqgqappedqwqp           
ps d       lespvteeagahaaaptqpkslv vvgpal             glplseqeeagmr q           
ln         m  a psasee gg   e lghh g d np             vaapqvrgaqetf a           
se         i    qr  r   d       r                     yrtiaievqgpcq e           
 h                  v   v                             dsere na psl  s           
 v                                                     p e  sd r g              
 t                                                     i    v    i              
 i                                                     g    f                   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-lwa---igr----------------------------------------------------------------Lrrig-
 e--evqyaqr s            a                                       eaadltalk-qcma 
 hrwaqr-eam                                                      qgsqml aq alls 
 riigkkl--v                                                      sdp av mr -a-- 
 -svfaecpls                                                      kne qc  e k-ft 
 dervgcarcl                                                      d   e   p ekcp 
 acsdrpv t                                                       a       f  f   
 watsdss n                                                                      
 cml lhr i                                                                      
 qtq ilp s                                                                      
 fqe   t d                                                                      
  gf   m g                                                                      
   g                                                                            
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
def--nr-hy-rr-------r-p---g-------a---------------------------------------------
-ql  hall-q--lisklfq-n-rsa-a     r-evamhslglaf      iydqttdpspvlrsfmeghpqmvilrll
ld-  d-rylkqh  a  llqrrknqn      tvgm  y  afty         sqdgard    liddftnlrenivw
h-m  -sesmplg      vpqqernr      pp                    n   ivg       alatfild mr
vkw  vvsqdegy      magelqhq      qr                        v         sq   k     
 ty  eqw-flke      rskvslry      ll                        l         p          
     qfqtkwan      hkafvgpp      hs                                             
     rddrvapt      cmltqvgd      am                                             
     yg girev      aetsgada      gt                                             
     at whmv       plsatpte      sn                                             
      l  p         g mnhilh      eq                                             
      e              vlihec      vg                                             
      n              fg           h                                             
      p              e            e                                             
      w                           d                                             

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
fwrslnpr                     swvam   twwqqsre   h lqvvrvlllllsllsllfslalnaeegrng
nlspptsg                     ep      kqmrvkpd      lplgqirrfvarwlrfhnswfarglnpgs
l mfhiqq                      r      sglgr         scpkymynsiwwmtyvlrrgwiengeeal
i    sh                              ley           pawllvhhaamgfqpapqhqrdptmagwr
      f                                              rsa vtyrpsphwmcdghqvgdssaha
                                                     qci pqvkgaipatigargsvaa qv 
                                                       p iattlivffpqavpsphsv kd 
                                                       k fvistfrag wkpkng  h  e 
                                                       f tpmcn  v  aent e  d    
                                                         qs pk  n  v  l    r    
                                                         sm     k  t  e    q    
                                                         nf     i               
                                                                m               
                                                                r               

       890       900       910       920       930       940       950    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                          
--------------------------------------------------------------------------
agprsqrhlhrtepfrc                                                         
rrallenntstni                                                             
lslphrsggrps                                                              
qnnhgkgsaq q                                                              
whmaas  nl a                                                              
vvssql  r                                                                 
tyq     s                                                                 
 pt                                                                       
 a                                                                        
                                                                          
                                                                          
                                                                          
                                                                          
                                                                          
© 1998-2020Legal notice