Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                   p    pr kfgvg
                                                                        l  apa  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------ps--------------e----------------lqpa-er-
saracpcqvprarpmepsqcvtegtasgmcmfqipmakq--dvssewvpcqicdr-             grq--se --l
 g g     sspsepmaprgsaclskrlqspcpahefegeeeqeds      dels             ddvfs-- dg 
 r         sgssnranfti visaeggggmlargrvarasqem      eaer             agrseld sp 
           l ladwvdyr  d ef  tsadpcpsmripgrkag      rgcd             hspatap gs 
             r tllp l           rdsscq sgrkggr       ria              aerggr qe 
               a  s q              k t tdv   d        t               paqans lv 
                    p                a q     t        s                d h g kq 
                                       m              g                  p v af 
                                       d                                 k t  a 
                                                                         r k  t 
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------slgtepq-------------------------------------------------
egppqlrpgapt            g-q----gn                                            sll
  aa staarlk            ep-pqrttg                                            rst
   v  hh t              -ehaslasd                                            em 
                        ageswqhpp                                               
                        vvncagdcf                                               
                        patggssar                                               
                        lsslrtgea                                               
                        tdadfdkls                                               
                          vkl e e                                               
                          rq    l                                               
                          pr                                                    
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
sadlfaqsqsldcplsrlql                                                       galgs
 tgi pgpl rpal garpp                                                            
     t nr ys   p fh                                                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vlrplrarp  rprrpfplthccglrsgkhh psavscglcepglpaahrrpggrqapgllpq pglrptsqe       
                rqsgrelpsslsrlv       s    rptrr      ptlaagpg  raihqqdra       
                ggapq p   ppgcs              a        la  e rw  deskcegts       
                qapdg a    q qr                        p  w s   englsaegr       
                stfa       h  t                        l        akpqarpsq       
                csge          w                                 tsygvslnp       
                a er                                            stvthph g       
                  vs                                            qrr  ia         
                  q                                               a  lr         
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
  ssaltla                                                     ggaapgvaraqrpggpg 
      a                                                                         
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                             dk            ptqtlggegdscphglp                    
                             gr            aegnhspasprqgvmgg                    
                                           gassshqllspnngfrl                    
                                           esavpaaspagrwqv q                    
                                           spplgpvfqglsept r                    
                                           rdlgtlsvrrtgsle t                    
                                            hdarmrtcvehtes                      
                                            qtrqe ghq ddik                      
                                            frieq ydk  lal                      
                                            r  a  p f   kd                      
                                            n           t                       
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
            gdrgpaaadggrpqravraa              etcgvteepqr                       
                                                r aaa  rp                       
                                                  l    pl                       
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
        lfygnagyrlplspqgplappaspgpfatrsplfifmrrssllsrsssgyfsfdtdmpeeseeeglplrsqp
        arrspsspvshtpsasspslasrdelleallytqtpvpepqvmehalqrvteeeegvesarqaqvngmgelm
        plsrsraaferfrarhesytlg  iemt dkae lls sgltgaql   mgdlrsprqgt lglqrdeegt 
        tseatveflpldgeeffqveve  lfvq f    s   tepd n     gagdtarggp     reriaqr 
        e  lawvskqgvnghpgvgqil  r  s          g r  t      qhvapsdtd     hgesqre 
        r  t  qghhfpcdmlharsq   h                         pcahdvqhq     dps     
        v     tlmais vsrtdl                               rvtsgetr       dh     
        g       yi i  pd t                                l q vae               
                c  c   e h                                s p   s               
                   r   v f                                  h   l               
                                                            m                   
                                                                                
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
papms-dkstq---tpsp-------cqafgr-------m-----------------------------------lrrigd
----pc--r-rsap----pelelpa--qiahyigalsak     asmrqsqaepadmrpeiwiaqe        -q-m--
tega-frg-sevsspalwaqt   vaaeynqeqdlwpwq     varaevavvasllfgfqrtgld        f-c-al
qplqwrqhpa-qqlgrrsrd    eekrl--qgtfenv-     craigevgliewt ev fpl           allst
ldtslaerarsapaanmgt     tpek-sta h  lre     gvie dsld pgw                  yafpv
arkdasgdqqkprtrvaq      dsd-wplg    ctr     died  ie    h                  tsaks
ggrpdvasngldg ecve      pgvcc ds      l      nwl   s    i                  egs  
sqenfmpamvan  vdil      grgtv s       n       f                              v  
 sskrqstllpe  qehr      l rsd a       t                                         
 l gqy p  fy  lg        n tle e       p                                         
   c   w  gi   s          sdr i       a                                         
   l      ch   i           m  m                                                 
   v                                                                            
   r                                                                            
   h                                                                            

       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e-f--n--------------------------------------------------------------------------
- -  hfrqkllnlisklfcsgt rlhlqqymrkvkshrnqrnqg     r        hqqprpksagtatqmrrssla
q l  -         a   r    asldkle kr   aq     i              gglnqvrrnreeqgrhqppvg
d m  d                  seferg       p                     ytarkaphrqqlkevamhr p
k w  v                  gqymer                              emktmhglaatr wghk   
f i  e                  vmrva                               rp vlt skrhs iq y   
t    r                  trvkl                               p   sl dvg p y      
c    a                  dgpis                                          l h      
a    q                  pwqqh                                          g        
     c                  nh                                                      
     y                  q                                                       
                        l                                                       
                                                                                
                                                                                
                                                                                

       890       900       910       920       930       940       950       960
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
laf      iydqttdirgvlrsfmdgfttlrenimrfwrslnpr                     sw          vs
qty          qdgl d    l   lan         s pt g                                 lp
f l                                                                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       970       980       990      1000      1010      1020      1030      1040
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
reqqep  q                 lclqllawwryprrllgfslnqyqagrghpqmllllllryivrlvwrnheenrn
pi      m                 vl a  slyvlanlvqsqfwlprnlaedaaslvsfrfdtegfhnlalmggrrte
h       l                  w    vplavllnialrghwnlpreglshaipiqhgelteiiaggggadq   
                                lftgaygamikmerkdfgsshrgteaepssqgsfqenfhherqth   
                                psrsfrste fnlvrsdegrthlnlvhfnqv    lpsrrvlr     
                                m flgidsh  eakqepspvsatshyav va    a   l s      
                                g v sftfa  wippltawtqsqdvhfk m     s   c        
                                f h rc     k  yhqdq pp  nsqa                    
                                w s iq         rct  n   rpie                    
                                h q  v         gs   k      q                    
                                t a                 a      t                    
                                e                                               
                                                                                
                                                                                

      1050      1060      1070      1080      1090 
....:....|....:....|....:....|....:....|....:....|.
                                                   
---------------------------------------------------
gagpr                                              
vv                                                 
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
                                                   
© 1998-2020Legal notice