Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                      pa  ag  r  g mdrpsylp     gla      a  g   
                                                   a    g                       
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------makq-------ps----------d---e-d
psp lcaprg rg gpgapggrgaaaacpgqvprarslswmaamfmippe--e-       -e          -vss-c-
              r r kfr  sr rpwcars pstatssqsnmqedsqcv-e       s-          qdvfqpe
                        g  r    a  a  rtvpqketgvrdfmdd       ld          eetehsm
                                       lrghsrspkmrslsp       ea          rselvyk
                                        adcqiekaypgdmg       rl          tlgglrs
                                          tgsrd dslsra       ag          pgndsmp
                                          p  c  fliepr       tt          mq pg g
                                          k  d   nvrh        ir          na ap  
                                             a   knk         dk          l      
                                                 ae          k           s      
                                                  r                      k      
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----g---qpaerp--pq--------------------------------------------------------------
dgre-rqledgsslsadr       faqsqsldcplsr   lqlfplth                               
pfepagrttes-laceel        t nl ys l g    fh                                     
gaplcwpa-frpikgrgp                        s                                     
fsghsegkpa-q--at-a                                                              
s knls mc-cdvtfpr-                                                              
  qkva sagqtpsyvss                                                              
  saq  gsqekmhtqai                                                              
  atk  pgmtgqg sqg                                                              
  lr   rnsnrgd mld                                                              
  tv    dtpaar  tt                                                              
   s     lv he  kv                                                              
   g      h f   hf                                                              
            n   nn                                                              
            t                                                                   
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------lgpgaptslqte---pq------------------------------------------g------
             g-r---r---p--kat--gn  pegprgl           g           sqgvmgeg-scphgl
             cc-tsp-gts-edgmlqtls  aasnhpr                         dfplpcdvgeepp
             stqlplapprennaparcpv  lseselv                          tyenasftllrr
             peseagtadaalsds ernl  gllggrs                          lsfrsaarrvfa
             vaederdrlvlfp   ahhp  tvpelsq                          sa grprskqsv
             astgrqlhvggcq   ssqg  stdisvm                          rl tp pvscls
             qqnavdgdgcsqf   lprt   qvfdmt                          pr d  lktah 
             trdsqtsqaqrda   yeta   r dqt                            t s  gegiw 
             rv q sqseekht   kdsq   p   q                                 mpdt  
             l  w kkeiitpr              a                                 t a   
                  iv rmimv                                                q     
                   c  p r                                                 k     
                      t g                                                       
                        s                                                       
                        v                                                       
                        i                                                       

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aapglpgaqrlfyspqgplappaspgpfatrsplfifvrrssllsrsssgyfsfdtdrspapmscdkstqtpsppptqtp
qsesqlssssrdagnaqyrlhlspasfplplas gvhmsqrivpplrrlshgrgagavetrsrhssypgprtalsa    
lrfehvatrtespaheelqgrtpashlcs trq    al   gaviaatrspywpfgprslgggprsdr q  dgr    
nhlavarflvsrreeppgcsavrvlyta  sd     q    prht p  rh rs   dl ws  lp a v   r     
cesqciw vpgpwpdsaep sat vdrs              f  p    g   t   p      q        t     
spcpsgl  n envagdqv  sg ta                d  h                   y        k     
tgg rre  a ahiscvfk  qk cq                s                                     
yq  yf     tedgrtr   r  i                                                       
k    t     gmn tsi   n                                                          
            d    s                                                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------rp-qgrp-sarpe-------------------------
sptgqaeqhlcqafnhylsamegepeameqlplpaetsessm--fra-sadmpaa                         
     vmalaldrgaeedg s tptsglartsg    wp peqqse-e-r-----                         
     ssn  epeeerree r erqdewqgdy        gralp-pqwqqhegc                         
          dsqmtvlqd   pmenr rp h        egseagsvalalarn                         
           asddddhv   svapv    e        dllsgalptkgvstv                         
           gprvasac   atggd             rievesvgqhettvs                         
           elapsqv    dqrrs             qpdadprhlplsqfi                         
           rgsqqpn     asqi             lagtqlmarstgfst                         
           lt slag     nda              vwihlvtlfehwgkd                         
           vh   gr     g                isfgyiqsgmpi ef                         
                vs     l                kft r edivnp lr                         
                                        n w    in     g                         
                                               ch                               
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------iwiaqe---------lrrigdefn-----------aly-rr--------------------------------
       lgagrkwarvygrlq--cms-qlhqct rt     ---pq-vraeerrrprpspwrllpnyfaaetdhrnhql
       vqqkl-irdeicavefq--aa--da    p     ryhl-grfqqklqnhaapfplviykllqsgegwwpqlq
       qre--q   aerqikskll-fdw-           selmkqlarrsqlaapvae  aflgdqmgad rgswgn
       ---eer   flastgdyafplktv           gsfdwleqsggtpg  l l  sknaaiptyg qqdfrm
       ratlkd    venft hgdeetdg           tqrapvml ari l    k   nsrsycpva   erec
       plptal    f pcr esp  aye           dhpvdt d          s   rapnvs        tp
       msrpgp    a     pm   rnl           qwniaa                vhdfsr        hr
       ddgrpt          aq     q           wrsess                 esh t         a
       yes tv           p     a           hgaqe                    p           h
       ttk dh           i     y           cdvkm                    t           v
       cfd  g                 r           nnwcl                                d
        vy                                p   h                                 
        ml                                k   g                                 
                                          v                                     
                                                                                
                                                                                

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
prprsaglaawllgrrnl    tatqmhpsmwwlrqlryivrlvwrmhillllshqerehnlalnlellnrrgagprggg
ngnkvra      r        apkmerqqpsisllqvllilrllllqlrrfqawwdtdgennalgsetfdnrfiagr y
qlvqghr               gteglpnpsvl pvm   agfa qalwsfiftpkva lrvshhvhhelkshrte a r
akagitq               slrppqhglav ae            tayrapvlps scegggedachhptevq i  
raraaqp               rnqswgrrrgp  w            ffvtrgfdgp a    ianv  ltspag    
kqghlp                e lkivtekif  a            vnavwllpsl      est   eqlv      
gtlsml                k sva dlaqs               ggcat  rq        nl    lel      
tpsvr                   gr  vhvtr                etmk            f     v t      
lmqtn                    e    h                                  r              
mf p                                                                            
ev l                                                                            
hn                                                                              
                                                                                
                                                                                
                                                                                
                                                                                

       810       820       830       840       850         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
-----------------------------------------------------------
aqggrrsnlgrgss      apsqsggsagdflctm                       
l  sqlldshsrgl      papstlaltqipf                          
g      td glva      m ad                                   
       h  qqp       l                                      
       s  khr                                              
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
                                                           
© 1998-2022Legal notice