Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

1027 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A4W3JXA1_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-02       --------------------------------------------------
A0A670JUU6_BMF-04       --------------------------------------------------
A0A674GIP8_BMF-03       --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A669PL85_BMF-02       --------------------------------------------------
A0A663MPI8_BMF-01       --------------------------------------------------
A0A674GIP8_BMF-02       --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A674GIP8_BMF-01       --------------------------------------------------
A0A803YBD7_BMF-01       --------------------------------------------------
A0A663DZQ4_BMF-01       --------------------------------------------------
A0A672V891_BMF-01       --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
A0A669PL85_BMF-01       --------------------------------------------------
A0A670XMZ5_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-02       --------------------------------------------------
A0A803SZ00_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-03       --------------------------------------------------
A0A670JUU6_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-05       --------------------------------------------------
A0A670JUU6_BMF-03       --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
F7HZL0_BMF-01           --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
F7HZL0_BMF-03           --------------------------------------------------
Q91ZE9_BMF-06           --------------------------------------------------
Q91ZE9_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A7N4PJP2_BMF-01       --------------------------------------------------
A0A4X2KLG2_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A5F4CJ04_BMF-03       --------------------------------------------------
A0A5F4CJ04_BMF-02       --------------------------------------------------
A0A5F4CJ04_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F7HZL0_BMF-02           --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A667H967_BMF-01       --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A671DWL6_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A674IPL3_BMF-01       --------------------------------------------------
A0A673TA87_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
Q91ZE9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A671DWL6_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
A0A673J9C6_BAD-01       --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
A0A480SCP6_BBC3-04      --------------------------------------------------
A0A4W5JLL9_BAD-02       ----------------------------MLS-------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A674DKC6_BAD-01       ----------------------------SLSSLSLPLLLSLSSLSLSSLS
A0A287AEC6_BCL2L11      --------------------------------------------ETPDIE
A0A287AEC6_BCL2L11      --------------------------------------------ETPDIE
A0A287AEC6_BCL2L11      --------------------------------------------ETPDIE
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A4W4DXF5_BAD-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A0A803YBD7_BMF-02       --------------------------------------------------
A0A3P8YI30_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
Q925D2_BIK-02           --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A4W4DZH9_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A668TQU8_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B5KWG6_BMF-03       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3P9ICE1_BMF-02       --------------------------------------------------
A0A3P9ICE1_BMF-05       --------------------------------------------------
A0A3P9ICE1_BMF-03       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A672HG10_BMF-01       --------------------------------------------------
A0A673C8N3_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A665VG08_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A0F8AD62_BMF-01       --------------------------------------------------
A0A671X848_BMF-01       --------------------------------------------------
A0A667YNR9_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-01       --------------------------------------------------
A0A1S3SNN2_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-02       --------------------------------------------------
A0A6F9B4C5_BMF-01       --------------------------------------------------
A0A6F9BGV6_BMF-01       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A671MNR9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A671M0H4_BMF-01       --------------------------------------------------
A0A671M0H4_BMF-02       --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
O70337_BIK-03           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
A0A674I2R9_BAD-01       --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      PATWGGGSRQGSRGVRAGTEAGRAGGAGAARVRETPAAVAAGAAFGGEFV
A0A7N5JE15_BCL2L11      TRSAGAGP------AASAGEPGRATLAFTCWSLKAPAAAAAAAARRG---
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A4W4HE29_BAD-01       --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A674AVP9_BAD-01       --------------------------------------------------
A0A1S3L0Z2_BAD-01       --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A060W8W7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
A0A671PX91_BAD-01       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A671SBB4_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-02       --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A667ZNC6_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A668V3Q4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A672JQ68_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A672YF93_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A6F9CQZ0_BAD-02       --------------------------------------------------
A0A6F9CA11_BAD-02       --------------------------------------------------
A0A1S3N9Q3_BAD-01       --------------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
A0A060W8P9_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A671NP27_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A671RUV0_BAD-01       --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A665TUH3_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-04       --------------------------------------------------
A0A674MXC1_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-02       --------------------------------------------------
A0A674MXC1_BAD-03       --------------------------------------------------
A0A671TL42_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A1A8AQV0_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A672RK14_BMF-01       --------------------------------------------------
A0A673JJ10_BMF-01       --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
A0A6I8NF73_BMF-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       --------------------------------------------------
A0A672V9F8_BAD-01       --------------------------------------------------
A0A674GQ16_BAD-01       --------------------------------------------------
A0A6I8NVP2_BAD-01       --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
G5B6Q3_BAD-01           --------------------------------------------------
G5B6Q3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
Q61337_BAD-07           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2J8TYJ3_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z674_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-03       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
A0A2K6E7I4_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
A0A671ELU4_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A667H8Z9_BAD-01       --------------------------------------------------
A0A673V6P8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
A0A4U1FMC3_BAD-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z674_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5PDB1_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A0A2I2YFH2_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z674_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------------------
A0A671F3X5_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------------------
A0A2I3N2Z9_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
A0A670YRG7_BAD-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
Q92934_BAD-06           --------------------------------------------------
Q92934_BAD-05           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A671EZ71_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A4X2K3J4_HRK-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A4W3JXA1_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-02       --------------------------------------------------
A0A670JUU6_BMF-04       --------------------------------------------------
A0A674GIP8_BMF-03       --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A669PL85_BMF-02       --------------------------------------------------
A0A663MPI8_BMF-01       --------------------------------------------------
A0A674GIP8_BMF-02       --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A674GIP8_BMF-01       --------------------------------------------------
A0A803YBD7_BMF-01       --------------------------------------------------
A0A663DZQ4_BMF-01       --------------------------------------------------
A0A672V891_BMF-01       --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
A0A669PL85_BMF-01       --------------------------------------------------
A0A670XMZ5_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-02       --------------------------------------------------
A0A803SZ00_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-03       --------------------------------------------------
A0A670JUU6_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-05       --------------------------------------------------
A0A670JUU6_BMF-03       --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
F7HZL0_BMF-01           --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
F7HZL0_BMF-03           --------------------------------------------------
Q91ZE9_BMF-06           --------------------------------------------------
Q91ZE9_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A7N4PJP2_BMF-01       --------------------------------------------------
A0A4X2KLG2_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A5F4CJ04_BMF-03       --------------------------------------------------
A0A5F4CJ04_BMF-02       --------------------------------------------------
A0A5F4CJ04_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F7HZL0_BMF-02           --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A667H967_BMF-01       --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A671DWL6_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A674IPL3_BMF-01       --------------------------------------------------
A0A673TA87_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
Q91ZE9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A671DWL6_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
A0A673J9C6_BAD-01       --------------------------------------------------
F7GL32_BBC3-01          ------------MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVV
A0A480SCP6_BBC3-04      -----------------------MTVFVGGCAGQPVPW------------
A0A4W5JLL9_BAD-02       --------------------------------------------------
A0A3Q7S5V2_BCL2L11      ----------------------------GRKTGA-------RARCAPPP-
A0A674DKC6_BAD-01       PSPLSPLLSLSSLLSRPLRLPLPLSLSASPSSSPLLCLSPSSLSCLSLSS
A0A287AEC6_BCL2L11      PG-----------------LSGLLRLSAGGSGGVWFTLYSERPLCSTRT-
A0A287AEC6_BCL2L11      PG-----------------LSGLLRLSAGGSGGVWFTLYSERPLCSTRT-
A0A287AEC6_BCL2L11      PG-----------------LSGLLRLSAGGSGGVWFTLYSERPLCSTRT-
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A4W4DXF5_BAD-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A0A803YBD7_BMF-02       --------------------------------------------------
A0A3P8YI30_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
Q925D2_BIK-02           --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A4W4DZH9_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A668TQU8_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B5KWG6_BMF-03       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3P9ICE1_BMF-02       --------------------------------------------------
A0A3P9ICE1_BMF-05       --------------------------------------------------
A0A3P9ICE1_BMF-03       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A672HG10_BMF-01       --------------------------------------------------
A0A673C8N3_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A665VG08_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A0F8AD62_BMF-01       --------------------------------------------------
A0A671X848_BMF-01       --------------------------------------------------
A0A667YNR9_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-01       --------------------------------------------------
A0A1S3SNN2_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-02       --------------------------------------------------
A0A6F9B4C5_BMF-01       --------------------------------------------------
A0A6F9BGV6_BMF-01       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A671MNR9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A671M0H4_BMF-01       --------------------------------------------------
A0A671M0H4_BMF-02       --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
O70337_BIK-03           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
A0A674I2R9_BAD-01       --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      NNRLAFGGLTRRRRLRRRRLLAVARSDRARANWERGHPAPAARGGRRCRR
A0A7N5JE15_BCL2L11      ---------------------------------GAGRACPRAGAGLRGGG
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A4W4HE29_BAD-01       --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A674AVP9_BAD-01       --------------------------------------------------
A0A1S3L0Z2_BAD-01       --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A060W8W7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
A0A671PX91_BAD-01       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A671SBB4_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-02       --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A667ZNC6_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A668V3Q4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A672JQ68_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A672YF93_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A6F9CQZ0_BAD-02       --------------------------------------------------
A0A6F9CA11_BAD-02       --------------------------------------------------
A0A1S3N9Q3_BAD-01       --------------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
A0A060W8P9_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A671NP27_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A671RUV0_BAD-01       --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A665TUH3_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-04       --------------------------------------------------
A0A674MXC1_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-02       --------------------------------------------------
A0A674MXC1_BAD-03       --------------------------------------------------
A0A671TL42_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A1A8AQV0_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A672RK14_BMF-01       --------------------------------------------------
A0A673JJ10_BMF-01       --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
A0A6I8NF73_BMF-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       --------------------------------------------------
A0A672V9F8_BAD-01       --------------------------------------------------
A0A674GQ16_BAD-01       --------------------------------------------------
A0A6I8NVP2_BAD-01       --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
G5B6Q3_BAD-01           --------------------------------------------------
G5B6Q3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
Q61337_BAD-07           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2J8TYJ3_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z674_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-03       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
A0A2K6E7I4_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
A0A671ELU4_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A667H8Z9_BAD-01       --------------------------------------------------
A0A673V6P8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
A0A4U1FMC3_BAD-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z674_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5PDB1_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A0A2I2YFH2_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z674_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------------------
A0A671F3X5_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------------------
A0A2I3N2Z9_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
A0A670YRG7_BAD-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
Q92934_BAD-06           --------------------------------------------------
Q92934_BAD-05           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A671EZ71_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A4X2K3J4_HRK-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A4W3JXA1_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
A0A7N5KDU2_BIK-01       ----------------------------MGMEKSTVASGLLGGRMGQSCQ
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       -------------------------------MDRPSYL------------
A0A670JUU6_BMF-02       -------------------------------MDSPDYL------------
A0A670JUU6_BMF-04       -----------MNSYIEVTLTSVGMDLFPGEMDSPDYL------------
A0A674GIP8_BMF-03       -------------------------------MDRPSYL------------
A0A7M4FPU2_BMF-01       -------------------------------MDPSSYL------------
K7FRX2_BMF-01           -------------------------------MDPPSYL------------
A0A3Q2UCA0_BMF-01       -------------------------------MDRPSYL------------
A0A3Q2UCA0_BMF-02       -------------------------------MDRPSYL------------
A0A669PL85_BMF-02       -------------------------------MDRPSYL------------
A0A663MPI8_BMF-01       -------------MLLSCLSCFLKCPFIAGAMDRPSYL------------
A0A674GIP8_BMF-02       -------------------------------MDRPSYL------------
U3JS06_BMF-01           -------------------------------MDRPSYL------------
A0A674GIP8_BMF-01       -------------------------------MDRPSYL------------
A0A803YBD7_BMF-01       -------------------------------MDRPSYL------------
A0A663DZQ4_BMF-01       -------------------------------MDRPSYL------------
A0A672V891_BMF-01       -------------------------------MDRPSYL------------
A0A493T7X1_BMF-02       -------------------------------MDRPSYL------------
A0A3Q2UCA0_BMF-03       -------------------------------MDRPSYL------------
A0A3Q2UCA0_BMF-04       -------------------------------MDRPSYL------------
A0A669PL85_BMF-01       -------------------------------MDRPSYL------------
A0A670XMZ5_BMF-01       -------------------------------MDPPVYL------------
A0A803SZ00_BMF-02       -------------------------------MDPPGYL------------
A0A803SZ00_BMF-01       -------------------------------MDPPGYL------------
A0A803SZ00_BMF-03       -------------------------------MDPPGYL------------
A0A670JUU6_BMF-01       -----------MNSYIEVTLTSVGMDLFPGEMDSPDYL------------
A0A670JUU6_BMF-05       -------------------------------MDSPDYL------------
A0A670JUU6_BMF-03       -------------------------------MDSPDYL------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
F7HZL0_BMF-01           -------------------MPRAGVFWKQYRTVRSGLLPPRPASAVAAAL
A0A337ST43_BMF-04       -----------MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGG
A0A337ST43_BMF-05       -----------MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGG
F7HZL0_BMF-03           --------------------------------------------------
Q91ZE9_BMF-06           --------------------------------------------------
Q91ZE9_BMF-01           -------------------MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAA
A0A287CXH0_BMF-01       -------------------MPRAGVFWKQYRAVRSGLLRRPPESAAAAGP
G3T7Z4_BMF-01           -------------------MPRAGVFWKQYRTVLSLVHQRPPALAAAA--
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A7N4PJP2_BMF-01       --------------------------------------------------
A0A4X2KLG2_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A5F4CJ04_BMF-03       --------------------------------------------------
A0A5F4CJ04_BMF-02       --------------------------------------------------
A0A5F4CJ04_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F7HZL0_BMF-02           --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A667H967_BMF-01       --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A671DWL6_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A674IPL3_BMF-01       --------------------------------------------------
A0A673TA87_BMF-01       --------CFQGKVRTFVTVPGSRPARDLGLHSPLAGRGRDAREAGPHQL
A0A287AIU8_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-02       ----------------------------MPRAGVFWKQYRAVHSGLLPRQ
A0A7N5JI49_BMF-01       ---------------------------MFPR-----------EAGLFPSF
G1PAU1_BMF-01           --------------------------------------------------
Q91ZE9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A671DWL6_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      ------------------------------------------MFPAAAAG
A0A3Q2GRS5_BCL2L11      ------------------------------------------MFPAAAAG
A0A7M4F197_BCL2L11      ------------------------------------RSGRSPRRPGPAQT
A0A673J9C6_BAD-01       --------------------------------------------------
F7GL32_BBC3-01          FQGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCC---------------
A0A480SCP6_BBC3-04      -------VSPPTMGGACLLGPSHLPPLHLGLVCVVGASPGLPCLPRVLMP
A0A4W5JLL9_BAD-02       -------PSPPL---------------------------PFPTYPLS---
A0A3Q7S5V2_BCL2L11      -------PPPEHVRAAACPRRTLAAGREAAVRRAGSLPHAGPGWGGGVRA
A0A674DKC6_BAD-01       LSSPLSPPSPLSLSLPLLLPSPLSPL--------SSLSLPLLSLSSL---
A0A287AEC6_BCL2L11      -------PRPPLVGEEERLHFELGDG--------CALSHPQPSHSSK---
A0A287AEC6_BCL2L11      -------PRPPLVGEEERLHFELGDG--------CALSHPQPSHSSK---
A0A287AEC6_BCL2L11      -------PRPPLVGEEERLHFELGDG--------CALSHPQPSHSSK---
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A4W4DXF5_BAD-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A0A803YBD7_BMF-02       --------------------------------------------------
A0A3P8YI30_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
Q925D2_BIK-02           --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A4W4DZH9_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A668TQU8_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B5KWG6_BMF-03       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3P9ICE1_BMF-02       --------------------------------------------------
A0A3P9ICE1_BMF-05       --------------------------------------------------
A0A3P9ICE1_BMF-03       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A672HG10_BMF-01       --------------------------------------------------
A0A673C8N3_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A665VG08_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A0F8AD62_BMF-01       --------------------------------------------------
A0A671X848_BMF-01       --------------------------------------------------
A0A667YNR9_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-01       --------------------------------------------------
A0A1S3SNN2_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-02       --------------------------------------------------
A0A6F9B4C5_BMF-01       --------------------------------------------------
A0A6F9BGV6_BMF-01       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A671MNR9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A671M0H4_BMF-01       --------------------------------------------------
A0A671M0H4_BMF-02       --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
O70337_BIK-03           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
A0A674I2R9_BAD-01       --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      RRAQCARRSGRXAEALGCPAERGGGRAASGRLCAAPGALNASPGYCLLRS
A0A7N5JE15_BCL2L11      ARGDWVRALGRQSE-LSCGAVQVSLRSAQP---PSLGLVKALRPASPLPP
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      ----------------MFPAAATRAARARGAARGAVGCPAERSGGLAGRR
A0A2Y9Q753_BCL2L11      ----------------MFPAAAVGVARTGDAACGALSCPAERGSGRAASC
M3YDI3_BCL2L11-01       ----------------MFPAAAAGAARARGAARGALGCRTARGGGRAASG
F7HHA1_BCL2L11-02       ----------------MFPAAAAGAARARGAACGALGCPAECGGGLAGRR
A0A096NYC3_BCL2L11      ----------------MFPAAAAGAARGRGAACGALGCPAECGGGLAGRR
A0A2K5X1Y3_BCL2L11      ----------------MFPAAAAGAARARGAACGTLGCPAECGGGLAGRR
F7HHA1_BCL2L11-03       ----------------MFPAAAAGAARARGAACGALGCPAECGGGLAGRR
A0A096NYC3_BCL2L11      ----------------MFPAAAAGAARGRGAACGALGCPAECGGGLAGRR
A0A2K5X1Y3_BCL2L11      ----------------MFPAAAAGAARARGAACGTLGCPAECGGGLAGRR
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A4W4HE29_BAD-01       --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A674AVP9_BAD-01       --------------------------------------------------
A0A1S3L0Z2_BAD-01       --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A060W8W7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
A0A671PX91_BAD-01       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A671SBB4_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-02       --------------------------------------------------
A0A3Q2QC80_BAD-01       -------------------------------------MSPSSSSHIGCFP
A0A4W6EMZ7_BAD-02       --------------------------------------MYRNKCCLVIIC
A0A3Q3FKT9_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------MKCNNKCYHFIR
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A667ZNC6_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A668V3Q4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A672JQ68_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A672YF93_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A6F9CQZ0_BAD-02       --------------------------------------------------
A0A6F9CA11_BAD-02       --------------------------------------------------
A0A1S3N9Q3_BAD-01       --------------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
A0A060W8P9_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A671NP27_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A671RUV0_BAD-01       --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A665TUH3_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-04       --------------------------------------------------
A0A674MXC1_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-02       --------------------------------------------------
A0A674MXC1_BAD-03       --------------------------------------------------
A0A671TL42_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A1A8AQV0_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A672RK14_BMF-01       --------------------------------------------------
A0A673JJ10_BMF-01       --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
A0A6I8NF73_BMF-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A5F8GA49_BAD-01       ------------------------------------------------MT
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       --------------------------------------------------
A0A672V9F8_BAD-01       --------------------------------------------------
A0A674GQ16_BAD-01       --------------------------------------------------
A0A6I8NVP2_BAD-01       --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
G5B6Q3_BAD-01           --------------------------------------------------
G5B6Q3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
Q61337_BAD-07           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2J8TYJ3_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z674_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-03       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
A0A2K6E7I4_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
A0A671ELU4_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A667H8Z9_BAD-01       --------------------------------------------------
A0A673V6P8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
A0A4U1FMC3_BAD-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z674_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5PDB1_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A0A2I2YFH2_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z674_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------------------
A0A671F3X5_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------------------
A0A2I3N2Z9_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
A0A670YRG7_BAD-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
Q92934_BAD-06           --------------------------------------------------
Q92934_BAD-05           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A671EZ71_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A4X2K3J4_HRK-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A5F5XUY6_BIK-01       ---------MNLGVDTNTQSTANWGKANCKISRQENSCVVLPLGWSVLSR
A0A4W3JXA1_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      -------------------------------------------------M
A0A3Q2LHE3_BIK-02       --------------------------------------------------
A0A7N5KDU2_BIK-01       DPGSYTQIQPLDSSTSTPWRLLNAPPCWETALADGGAQTAHTFTQPPRTR
A0A3Q7V097_BIK-03       --------MTLACSSMRTIGPNVTLSGVSPAGGTAWAHWEEAGRRVACLL
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-02       --------------------------------------------------
A0A670JUU6_BMF-04       --------------------------------------------------
A0A674GIP8_BMF-03       --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A669PL85_BMF-02       --------------------------------------------------
A0A663MPI8_BMF-01       --------------------------------------------------
A0A674GIP8_BMF-02       --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A674GIP8_BMF-01       --------------------------------------------------
A0A803YBD7_BMF-01       --------------------------------------------------
A0A663DZQ4_BMF-01       --------------------------------------------------
A0A672V891_BMF-01       --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
A0A669PL85_BMF-01       --------------------------------------------------
A0A670XMZ5_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-02       --------------------------------------------------
A0A803SZ00_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-03       --------------------------------------------------
A0A670JUU6_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-05       --------------------------------------------------
A0A670JUU6_BMF-03       --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
F7HZL0_BMF-01           CLRLPPPAAARWAFSLLPNRVWASSPRVLVTLDPGAEPWHHDSEAETLSW
A0A337ST43_BMF-04       CHPQWYFITRSFVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHC
A0A337ST43_BMF-05       CHPQWYFITRSFVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHC
F7HZL0_BMF-03           --------------------------------------------------
Q91ZE9_BMF-06           --------------------------------------------------
Q91ZE9_BMF-01           ARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLSW
A0A287CXH0_BMF-01       ASGSRLP------------GSGVSLPQVFITLDPGAEPWHHDSEAETLSW
G3T7Z4_BMF-01           VRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSW
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A7N4PJP2_BMF-01       --------------------------------------------------
A0A4X2KLG2_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A5F4CJ04_BMF-03       --------------------------------------------------
A0A5F4CJ04_BMF-02       --------------------------------------------------
A0A5F4CJ04_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       ---MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSW
Q96LC9_BMF-06           --------------------------------------------------
F7HZL0_BMF-02           --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A667H967_BMF-01       --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A671DWL6_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A674IPL3_BMF-01       --------------------------------------------------
A0A673TA87_BMF-01       FAGCPERAYFGNNTARATVASTRASPPAAAAAPASASRHPPQPAGLFPSF
A0A287AIU8_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-02       PASCRRRPCPCLPPPATRRGPWAPSPRVLVTLDPGAEPWHHDSEAETLSW
A0A7N5JI49_BMF-01       PIE------------------WAPSPRVLVTLDPGAEPWHHDSEAETLSW
G1PAU1_BMF-01           --------------------------------------------------
Q91ZE9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-03       ------------------------------------------MRAWWLLL
A0A671DWL6_BMF-02       ----------------------------------------------MPYY
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      AARARGAARGALGCPAERGGGGRAASGRLCAVLAP--------------L
A0A3Q2GRS5_BCL2L11      AARARGAARGALGCPAERGGGGRAASGRLCAVLAP--------------L
A0A7M4F197_BCL2L11      CCAQHIRENNGLGRGRGRAAPPRRRPLLLAGCGAGTARTRRSLALPVPTQ
A0A673J9C6_BAD-01       --------------MKTYRSVGPMQLVSVLSISRR--------------I
F7GL32_BBC3-01          ------RCECGAGLGKLRRGRARGVAPPLTCSAH---------------L
A0A480SCP6_BBC3-04      ------GFKSGVPCVPQGGGCPGGRPDAPCTSQLT--------------V
A0A4W5JLL9_BAD-02       -------------------------------------------------L
A0A3Q7S5V2_BCL2L11      CGAPGGGPKCGSGRDCARRGAGKGSARSALSRELRPRCWILGCAAGRQVS
A0A674DKC6_BAD-01       ------SP-----------------SPLSLLSPLL--------------L
A0A287AEC6_BCL2L11      ------HARRGQGGRRAQRGTRRGRPRLYLSEPAR--------------V
A0A287AEC6_BCL2L11      ------HARRGQGGRRAQRGTRRGRPRLYLSEPAR--------------V
A0A287AEC6_BCL2L11      ------HARRGQGGRRAQRGTRRGRPRLYLSEPAR--------------V
A0A3B1JLM2_BAD-01       ------------------------------------------------MS
A0A4W4DXF5_BAD-01       ------------------------------------------------MH
A9XRH0_BMF-01           -----------------------------------------------MDR
A0A803YBD7_BMF-02       -----------------------------------------------MDR
A0A3P8YI30_BAD-01       -----------MFYSFCHSPCDECFLTICNAFGQCLLRMDVFSLQAFKM-
A0A3B4DUY7_BAD-01       MSNQYLQKLRRARFNCEEERYKKVIKTLTGEKGTPFNPLCWNSLRTTACA
A0A4W3IWD3_BCL2L11      -----------------------------------RCSQFQFHTLTDKRE
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      -----------------------------------MCSGV-VKEYPGMSR
A0A3B4UNJ0_BMF-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
Q925D2_BIK-02           ----------------------MASAPVSARTWEFASVPPLGILGSVPFL
A0A3P9ICE1_BMF-01       --------------------------------------------MCLSGI
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A4W4DZH9_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A668TQU8_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B5KWG6_BMF-03       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3P9ICE1_BMF-02       --------------------------------------------------
A0A3P9ICE1_BMF-05       --------------------------------------------------
A0A3P9ICE1_BMF-03       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A672HG10_BMF-01       --------------------------------------------------
A0A673C8N3_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A665VG08_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A0F8AD62_BMF-01       --------------------------------------------------
A0A671X848_BMF-01       --------------------------------------------------
A0A667YNR9_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-01       --------------------------------------------------
A0A1S3SNN2_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-02       --------------------------------------------------
A0A6F9B4C5_BMF-01       ---------------------------------------------MFRIH
A0A6F9BGV6_BMF-01       ------------------------------------------MQGHPLPQ
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A671MNR9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       ----------------------MAHMFTLSDDSDTSEDLGDADQPEASKR
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A671M0H4_BMF-01       --------------------------------------------------
A0A671M0H4_BMF-02       --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
O70337_BIK-03           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5VW94_BIK-01       ---------------------------------------------MLSFC
G1MV54_BCL2L11-01       --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
A0A674I2R9_BAD-01       --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      LRADGQGAPGRRRTRAGRRGARARARTRRSEG------------------
A0A7N5JE15_BCL2L11      LPPDSHSHPARASPTAASIAAGCSLRPAPAATPSAPFPWPSSPQCLTLTL
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      GLCAAPGTLNPSPGLCLLHCLRGDGQGPPGRRKARVGRRGAPSRARTLRS
A0A2Y9Q753_BCL2L11      RLSAAPGAPTASPGLCLPGRLRVDGQGAPGRRRARAGRRRAPARTR--RS
M3YDI3_BCL2L11-01       RLCAAPGALKASPRLCLPRFFRAEGQGAPGRRRTRAGRRGARARTR--RS
F7HHA1_BCL2L11-02       GLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRS
A0A096NYC3_BCL2L11      GLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAQTLRS
A0A2K5X1Y3_BCL2L11      GLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRS
F7HHA1_BCL2L11-03       GLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRS
A0A096NYC3_BCL2L11      GLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAQTLRS
A0A2K5X1Y3_BCL2L11      GLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRS
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      ----------------------------MPLSVRSYLWIWLGSPGAGLGD
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      ------MGPEWGTRPAACNRCICARSCAPAQYLIPGSQSPLGVSDFCKSA
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      ------------------------------------------MGWDGAAA
K7GA86_BCL2L11-01       ------------------------------------------MGRAGRGP
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A4W4HE29_BAD-01       -------------------------------------------------M
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       -------------------------------------------------M
B8JK68_BCL2L11-01       -------------------------------------------------M
A0A671M057_BCL2L11      -------------------------------------------------M
A0A672L1R2_BCL2L11      -------------------------------------------------M
A0A671SJ75_BCL2L11      -------------------------------------------------V
A0A673IWZ7_BCL2L11      -------------------------------------------------M
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      ------------------------------------------------MS
A0A3B4BSH7_BCL2L11      -----------------------LLSARKARFSVCPCSSPEDRIHHLPHY
A0A3B1JXK6_BCL2L11      ------------------------------------------------MS
A0A4W4H3Y1_BCL2L11      -------------------------------------------------R
A0A4W5NF23_BCL2L11      -------------------------------------------------M
A0A4W5R3N6_BCL2L11      ---------------------------------------------MTDSS
A0A1S3SAH9_BCL2L11      ---------------------------------------------MSDSS
A0A673WET2_BCL2L11      ---------------------------------------------MSDSS
A0A3P8XIA2_BCL2L11      --------------------------------------------MFD-SS
A0A673XGV4_BCL2L11      --------------------------------------------QNKIYK
A0A4W5R3N6_BCL2L11      ------------------------------MTLHRQNNKNSLTLILDLSY
A0A4W5R3N6_BCL2L11      ------------------------------MTLHRQNNKNSLTLILDLSY
A0A3Q3FKT9_BAD-01       -----------------------------------------MTLTASDVT
A0A3B1IH05_BAD-01       ------------------------MSTAARAAAGTCDSTAVSQPSKLDFT
A0A3B3QC78_BCL2L11      -------------------------------------------------M
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A674AVP9_BAD-01       --------------------------------------------------
A0A1S3L0Z2_BAD-01       --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A060W8W7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
A0A671PX91_BAD-01       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A671SBB4_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-02       -----------------------------------------MGCSTPYRN
A0A3Q2QC80_BAD-01       YPLRNQINSSPSCTFISGLNFPNSCLP--------------------DDT
A0A4W6EMZ7_BAD-02       MNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQFLLNLPSPDVT
A0A3Q3FKT9_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-03       L-----VFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGVL---DVT
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A667ZNC6_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A668V3Q4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       ---------------------------------------MAQSVETSDPI
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------MNVEVSIFPDVT
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A672JQ68_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A672YF93_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A6F9CQZ0_BAD-02       --------------------------------------------------
A0A6F9CA11_BAD-02       --------------------------------------------------
A0A1S3N9Q3_BAD-01       --------------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       ------------------------------------------------MA
A0A4W5R1T6_BAD-01       --------------------------------MAIINTIIHCGCPFSLQI
A0A060W8P9_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A671NP27_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A671RUV0_BAD-01       --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3B3QX41_BAD-01       ---------------------------------------------MSGVT
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A665TUH3_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-04       --------------------------------------------------
A0A674MXC1_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-02       --------------------------------------------------
A0A674MXC1_BAD-03       --------------------------------------------------
A0A671TL42_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A1A8AQV0_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      -----------------------------------MVLEGAAAEPALTCS
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      ---------------------------------------------MLTVT
A0A3B5QAM1_BCL2L11      ---------------------------------------------MLTVT
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A672RK14_BMF-01       ------------------------------------------------MD
A0A673JJ10_BMF-01       ------------------------------------------------MD
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      ------------------MYIYICICTYKYITDSLTSCYSRSQRLCRATD
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      -----------------------------------------------MVT
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
A0A6I8NF73_BMF-01       ----------------------------------MKWPWPGRRYGCARSL
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A5F8GA49_BAD-01       VSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESETPSWPDDASR
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       --------------------------------------------------
A0A672V9F8_BAD-01       --------------------------------------------------
A0A674GQ16_BAD-01       --------------------------------------------------
A0A6I8NVP2_BAD-01       --------------------------------------------------
G3TP47_BAD-01           --------GPPENPSPASTHAQGVRMSGAEHPEKK------KGRRRSSGG
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-02           -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPA----
Q61337_BAD-01           -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPA----
A0A287CT05_BAD-01       -------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAW
A0A287CT05_BAD-02       -------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAW
G5B6Q3_BAD-01           -------MRTPENPSPAPTNAEGLRKLELGIRRLES--------------
G5B6Q3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           ------------------------------------------------PT
A0A452ER54_BAD-02       ----------------------------------------------YRAW
W5P8G9_BAD-01           ------------------------------------------QGPRYRAW
Q61337_BAD-07           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2J8TYJ3_BAD-02       -----------------------------MGTPENPSPAPTHAQDVRQRG
A0A2I2YFH2_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z674_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-03       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
A0A2K6E7I4_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       ---------------MGSSGGKKLWLARPSPSTEEPLPLPSTGNRGPSLR
A0A287AEF3_BAD-01       ---------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPA
A0A4X1VE31_BAD-03       ---------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRQGYL
A0A671ELU4_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       -----------------MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGP
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A667H8Z9_BAD-01       --------------------------------------------------
A0A673V6P8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
A0A4U1FMC3_BAD-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z674_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5PDB1_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2J8TYJ3_BAD-01       -----------------------------MGTPENPSPAPTHAQDVRQRG
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A0A2I2YFH2_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z674_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      ---------------------------MKFGMGSAQACPCQVPRAASATW
A0A2K5F6X4_BBC3-03      ---------------------------------SAWACPCQVPRASSSTW
A0A2K6FQZ1_BBC3-02      ---------------------------MKFGAGSARACPCQVPGTSFSWW
A0A671F3X5_BBC3-01      ----------------------------RVSAGAARACPCQVPRLPSG-W
A0A5F5PGZ4_BBC3-01      ---------------------------VRVSAGAARACLCQAPGASFSPW
A0A2I3HWI8_BBC3-02      ---------------------------MKFGMGSARACPCQVPRASSVTW
A0A2K5QNS7_BBC3-01      ---------------------------MKCGVGSAWACPCQVPRASSSVW
A0A2K5P2T8_BBC3-01      ---------------------------IKFGVGSARACPCQVPRAASATW
A0A2K6QZT2_BBC3-02      ---------------------------IKFGVGSARACPCQVPRASSATW
A0A2K6ASP2_BBC3-01      ---------------------------IKFGVGSARACPCQVPRASSATW
A0A2I3N2Z9_BBC3-01      ---------------------------IKFGVGSARACPCQVPRASSATW
Q9BXH1_BBC3-03          ---------------------------MKFGMGSAQACPCQVPRAASTTW
A0A2I3RGH5_BBC3-02      ---------------------------MKFGMGSAQACPCQVPRAASATW
H2NZD3_BBC3-01          ---------------------------MKFGMGSAQACPCQVPRASSATW
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------MASGACPISGPV
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
A0A670YRG7_BAD-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
Q92934_BAD-06           --------------------------------------------------
Q92934_BAD-05           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A671EZ71_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A4X2K3J4_HRK-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      ---------------------KQ-------------------AGTSPVTP
O61667_EGL1-01          -----MLMLTFAST-------SSDLLPMSNVFDVQSSVFYNEKNMFYSSS
A0A5F5XUY6_BIK-01       KGHKRKSPHGLFSK-------RGIRGPEGLRNLSGAKRPSWTRTQVAQQP
A0A4W3JXA1_BMF-01       ------MDLSDTEELDSDDEVFA----------QDLTAPDSGYSD--NTS
A0A3Q3SYA1_BCL2L11      ATEESGDPPAGDPR-------VS----------AQTSRSNGGTDQSSVSP
A0A3Q2LHE3_BIK-02       -----MRKRRRHAA-------AK----------RQTWDSNSGPLV--SEP
A0A7N5KDU2_BIK-01       GRGSGAAGRERRPRGRAGAGPAVYKLARRPEAADNTAPGSSAPAA--TIA
A0A3Q7V097_BIK-03       RTPSFTRQLAGIKAGFAELQRNQESSISPFFSSPDGLGCGRGCSE--DGS
A0A3Q7V097_BIK-01       ------------------------MGRWRRGMLLTMFLPKHHSWF--SDC
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A670JUU6_BMF-02       -----EEDFSNLDG-------LE----------DDVFHSEDCGLA--SQP
A0A670JUU6_BMF-04       -----EEDFSNLDG-------LE----------DDVFHSEDCGLA--SQP
A0A674GIP8_BMF-03       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A7M4FPU2_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
K7FRX2_BMF-01           -----EEDYSSLDG-------LD----------DDVFHSDDFGLT--GQP
A0A3Q2UCA0_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A3Q2UCA0_BMF-02       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A669PL85_BMF-02       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A663MPI8_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A674GIP8_BMF-02       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
U3JS06_BMF-01           -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A674GIP8_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A803YBD7_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A663DZQ4_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A672V891_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A493T7X1_BMF-02       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A3Q2UCA0_BMF-03       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A3Q2UCA0_BMF-04       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A669PL85_BMF-01       -----EEDYSSLDG-------LD----------DDVFHSDDFGLA--GQP
A0A670XMZ5_BMF-01       -----EDDFSHLDG-------LD----------DDVFHSDDCELV--SQS
A0A803SZ00_BMF-02       -----DDDFSTLDG-------LE----------DDVFHAEDCGLA--SQP
A0A803SZ00_BMF-01       -----DDDFSTLDG-------LE----------DDVFHAEDCGLA--SQP
A0A803SZ00_BMF-03       -----DDDFSTLDG-------LE----------DDVFHAEDCGLA--SQP
A0A670JUU6_BMF-01       -----EEDFSNLDG-------LE----------DDVFHSEDCGLA--SQP
A0A670JUU6_BMF-05       -----EEDFSNLDG-------LE----------DDVFHSEDCGLA--SQP
A0A670JUU6_BMF-03       -----EEDFSNLDG-------LE----------DDVFHSEDCGLA--SQP
A0A337ST43_BMF-02       -----MEPPQCVEE-------LE----------DDVFQPEDVEPG--TQP
A0A2K5KGP2_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6FFN3_BMF-02       -----MEPSHCVEE-------LE----------DDVFQPEDGESG--TQP
A0A2K5E1Q4_BMF-02       -----MEPSQCVEE-------LE----------DDVFQSEDGEPG--TQP
A0A2K5RN49_BMF-02       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A2K6TW78_BMF-03       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A2K6RAW1_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2I2Z168_BMF-02       -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
Q96LC9_BMF-05           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
Q96LC9_BMF-07           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
A0A2R9BS98_BMF-02       -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
A0A2J8QDD5_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
A0A2K5MJW4_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6B5F6_BMF-03       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K5Z4A9_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2I3HD83_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
F7HZL0_BMF-01           SHPGEMEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A337ST43_BMF-04       TPAGEMEPPQCVEE-------LE----------DDVFQPEDVEPG--TQP
A0A337ST43_BMF-05       TPAGEMEPPQCVEE-------LE----------DDVFQPEDVEPG--TQP
F7HZL0_BMF-03           -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
Q91ZE9_BMF-06           -----MEPPQCVEE-------LE----------DDVFQSEDGEPG--TQP
Q91ZE9_BMF-01           SHPGEMEPPQCVEE-------LE----------DDVFQSEDGEPG--TQP
A0A287CXH0_BMF-01       SHPGEMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
G3T7Z4_BMF-01           SHPGEMEPSQCVEE-------LE----------DDVFQPEEGEPG--TQP
A0A5F8GKJ8_BMF-01       -----MEPPHYVEE-------LE----------DDVFHPEDSEPG--AQP
A0A7N4PJP2_BMF-01       -----MESPHYVEE-------LE----------DDVFHPEDSEPG--AQP
A0A4X2KLG2_BMF-01       -----MEPPHYVEE-------LE----------DDVFHPEDSEPG--AQP
A0A3Q2HR24_BMF-02       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A3Q2HR24_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A5F4CJ04_BMF-03       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A5F4CJ04_BMF-02       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A5F4CJ04_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A286XXB0_BMF-02       SHPGEMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
Q96LC9_BMF-06           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
F7HZL0_BMF-02           -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A096NTE9_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A286XXB0_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A337ST43_BMF-03       -----MEPPQCVEE-------LE----------DDVFQPEDVEPG--TQP
A0A7N9CRT3_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--SQP
A0A2K6FFN3_BMF-01       -----MEPSHCVEE-------LE----------DDVFQPEDGESG--TQP
H0WYH6_BMF-01           -----MEPSQCVEE-------LE----------DDVFQPEDGELG--T--
A0A2K5MJW4_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K5KGP2_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A7N9CRT3_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--SQP
A0A5F7ZML1_BMF-03       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A5F7ZML1_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6B5F6_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6B5F6_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6B5F6_BMF-04       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K5Z4A9_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6L919_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6L919_BMF-03       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6RAW1_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A0D9R4R5_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K5E1Q4_BMF-01       -----MEPSQCVEE-------LE----------DDVFQSEDGEPG--TQP
A0A2K6TW78_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A2K6TW78_BMF-02       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A2K5RN49_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A2I2Z168_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
Q96LC9_BMF-01           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
Q96LC9_BMF-02           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
Q96LC9_BMF-03           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
Q96LC9_BMF-04           -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
A0A2R9BS98_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
A0A2J8QDD5_BMF-02       -----MEPSQCVEE-------LE----------DDVFQPEDGEPV--TQP
A0A2J8T301_BMF-01       -----MEPSQCVEE-------LE----------DDVFQPEDGEPG--TQS
A0A7N9CRT3_BMF-03       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--SQP
A0A5F7ZML1_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A096NTE9_BMF-01       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A2K6L919_BMF-02       -----MEPSRCVEE-------LE----------DDVFQPEDGEPG--AQP
G1SR62_BMF-01           -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A337ST43_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDVEPG--TQP
W5QFV1_BMF-01           -LTGEMEPPQCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A4W2EII1_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A4W2EII1_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
Q05KI3_BMF-01           -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
Q05KI3_BMF-02           -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A4W2INA4_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
L8IXF5_BMF-01           -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A4W2INA4_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A452F2E0_BMF-02       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A452F2E0_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--AQP
A0A667H967_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A2U4BC98_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A671DWL6_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGDLG--TQP
M3YAD5_BMF-01           -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
U6CSY8_BMF-01           -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A452SED0_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A384D070_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A337SAW2_BAD-01       --MGTPENPLSAPT-------------------HVPGPGMSGTEQREARK
A0A452H3N6_BMF-01       -----MDPPNYLEDDYSSLDGLD----------DDVFHSDFGLTG---QP
A0A674IPL3_BMF-01       -----MDPPSYLEEDYSSLDGLD----------DDVFHSDFGLTG---QP
A0A673TA87_BMF-01       PIESGRQAPECSSR-------WTLARSPGITTRRRRLSPGVTQQGRWSQP
A0A287AIU8_BMF-02       -----MEPPQCVEE-------LE----------DDVFQPEEGEPG--TQP
A0A7N5JI49_BMF-02       SHPGEMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A7N5JI49_BMF-01       SHPGEMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
G1PAU1_BMF-01           -----MEPPQCVEE-------LE----------DDVFQPED-ELG--TQP
Q91ZE9_BMF-02           MSPGEMEPPQCVEE-------LE----------DDVFQSEDGEPG--TQP
A0A287AIU8_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEEGEPG--TQP
A0A4X1UQ42_BMF-01       -----MEPPQCVEE-------LE----------DDVFQPEEGEPG--TQP
A0A4X1UQ42_BMF-02       -----MEPPQCVEE-------LE----------DDVFQPEEGEPG--TQP
A0A7N5JI49_BMF-03       RAVREMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A671DWL6_BMF-02       ALTGEMEPPQCVEE-------LE----------DDVFQPEDGDLG--TQP
A0A286XXB0_BMF-03       VFPREMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A287CXH0_BMF-02       VFPEEMEPPQCVEE-------LE----------DDVFQPEDGEPG--TQP
A0A3Q2GRS5_BCL2L11      SASPGLCLPRCLSG-------DN----------QGAPGRRKARAGRRGAR
A0A3Q2GRS5_BCL2L11      SASPGLCLPRCLSG-------DN----------QGAPGRRKARAGRRGAR
A0A7M4F197_BCL2L11      QVSGRAGRARSGAA-------WL----------ASFTSKCNGFCRRPADS
A0A673J9C6_BAD-01       RSCSAAVSALAIFH-------NL----------ATTVYAHDALLRTQRPP
F7GL32_BBC3-01          SVSLRRLPPHWGMA-------RA----------QQDGSSPEPVEGLPRE-
A0A480SCP6_BBC3-04      PLCPVLQAPGSAMA-------RA----------RQEGSSPEPVEGLARD-
A0A4W5JLL9_BAD-02       SASPPVSFPLSTS------------------------------LFPSLST
A0A3Q7S5V2_BCL2L11      PPCPETPPPPPSPG-------SG----------RAVGAGLAPWLSSGARA
A0A674DKC6_BAD-01       SSLSLCLSSFPSP----------------------------------LSP
A0A287AEC6_BCL2L11      SGCSGAEAGLSSPR-------AG----------RDLAGAGHAVIGRGLGA
A0A287AEC6_BCL2L11      SGCSGAEAGLSSPR-------AG----------RDLAGAGHAVIGRGLGA
A0A287AEC6_BCL2L11      SGCSGAEAGLSSPR-------AG----------RDLAGAGHAVIGRGLGA
A0A3B1JLM2_BAD-01       NQYLLKLRRARFNC-------DE----------EGYSQALNSRTSTEGGG
A0A4W4DXF5_BAD-01       NQYLLRLRKANFTR-------ED------------YKKVIKAKTLREEG-
A9XRH0_BMF-01           PSYLEEDYSSLDGL-------DD----------DVFHSDDFGLAGNAGYR
A0A803YBD7_BMF-02       PSYLEEDYSSLDGL-------DD----------DVFHSDDFGLAGNAGYR
A0A3P8YI30_BAD-01       --DHTQDCVGDIPE-------NI----------NEKYDLDHLGTTHYPEF
A0A3B4DUY7_BAD-01       MEKHSEDGISTMDD-------QD----------ESNWS-ETVKNGDSPQL
A0A4W3IWD3_BCL2L11      GRQGVPSDFPINTT-------CE----------NIQLSPAFITTCPLFNT
A0A4W3IWD3_BCL2L11      --------MQSSRS-------TQ----------NIQLSPAFITTCPLFNT
A0A4W3IWD3_BCL2L11      GELSGQSDFPINTT-------CE----------NIQLSPAFITTCPLFNT
A0A3B4UNJ0_BMF-01       -----------MDD-------EE----------EDMSQPI--SHLWGTSF
A0A3G3M2M0_BCL2L11      -------------------------------------MSD--TS-REQTP
A0A672PQD1_BCL2L11      -------------------------------------MSD--TSSREQTP
Q925D2_BIK-02           PRSEDMSEARLMAR-------DI----------IKTLLHD--QVPQPAVV
A0A3P9ICE1_BMF-01       SGHSSYSAPPRMDD-------EE----------DDVFEPD--PNKWRTTA
A0A3B4B6Y3_BMF-01       -----------MED-------EE----------DDVFEPD--LHCWHTTF
A0A4W4DZH9_BMF-01       -----------MDD-------EE----------DDVFRIA--AQYWPHSL
A0A3B1K1X5_BMF-01       -----------MDD-------EE----------DDVFVTD--PEPWRSPI
A0A3B4CNJ8_BMF-01       -----------MDE-------DE----------DDVFVMD--TQYWRSSI
A0A3B3RH63_BMF-01       -----------MDD-------DD----------DDVFHTD--PLTYQPPF
W5N4P7_BMF-01           -----------MEE-------DE----------DDVFHPSHFSHCWGTQF
A0A2U9CJH3_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A3Q2YCX7_BMF-01       -----------MED-------EE----------DDVFEPD--PHCWRTTF
A0A3Q2YCX7_BMF-02       -----------MED-------EE----------DDVFEPD--PHCWRTTF
A0A668TQU8_BMF-01       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3Q3VLX6_BMF-01       -----------MDD-------DE----------DDVFEPE--AHCWRTTF
A0A3P8UA78_BMF-01       -----------MDD-------EE----------DDVFEPD--PHSWHTTF
A0A3P8UA78_BMF-03       -----------MDD-------EE----------DDVFEPD--PHSWHTTF
A0A3P8UA78_BMF-02       -----------MDD-------EE----------DDVFEPD--PHSWHTTF
A0A3B5KWG6_BMF-03       -----------MDD-------EE----------DDVFQPD--PYSWRTTF
A0A3B5KWG6_BMF-01       -----------MDD-------EE----------DDVFQPD--PYSWRTTF
A0A3B5KWG6_BMF-02       -----------MDD-------EE----------DDVFQPD--PYSWRTTF
A0A3B3CGR9_BMF-01       -----------MDD-------EE----------DDVFEPD--PNNWRTAV
A0A3B3HAU1_BMF-04       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3P9ICE1_BMF-04       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3P9K487_BMF-02       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3B3HAU1_BMF-01       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3B3HAU1_BMF-02       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3B3HAU1_BMF-03       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3P9ICE1_BMF-02       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3P9ICE1_BMF-05       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3P9ICE1_BMF-03       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A3P9K487_BMF-01       -----------MDD-------EE----------DDVFEPD--PNKWRTTA
A0A672HG10_BMF-01       -----------MDD-------EE----------DDVFEPD--PRCWRTAF
A0A673C8N3_BMF-01       -----------MED-------EE----------DDVFEPD--PHCWRTTF
A0A3P8NFE2_BMF-02       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
I3K2D6_BMF-01           -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3P8NFE2_BMF-01       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3Q3C5V2_BMF-01       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3P9DPJ5_BMF-01       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3P9DPJ5_BMF-02       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3B4ETH0_BMF-01       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3Q4G1I4_BMF-01       -----------MDD-------EE----------DDVFEPK--ANCWRTTF
A0A3Q1FVH7_BMF-02       -----------MDD-------EE----------DDVFEPD--THCWRTTF
A0A3Q1FVH7_BMF-01       -----------MDD-------EE----------DDVFEPD--THCWRTTF
A0A3Q2ZA20_BMF-01       -----------MDD-------EE----------DDVFEPD--PSCWRTTF
A0A665VG08_BMF-01       -----------MDD-------EE----------DDVFEPD--PHFWRTTF
A0A3Q3RVI2_BMF-01       -----------MDD-------EE----------DDVFEPD--PHFWRTTF
A0A3Q1D1K3_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A3P8RKY9_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A3Q3RVI2_BMF-02       -----------MDD-------EE----------DDVFEPD--PHFWRTTF
A0A4W6DUL1_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A3Q1IPR4_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A0F8AD62_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A671X848_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A667YNR9_BMF-01       -----------MDD-------EE----------DDVFEPD--LHCWRTTF
A0A3B4U5H8_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A3B4WM88_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A3Q3QZ16_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTAF
A0A3Q3QZ16_BMF-02       -----------MDD-------EE----------DDVFEPD--PHCWRTAF
A0A3Q2PJX9_BMF-01       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3Q2PJX9_BMF-02       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3Q2PJX9_BMF-03       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3B5QK08_BMF-02       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3B5QK08_BMF-01       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A096LRV0_BMF-01       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3B3WU80_BMF-01       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3P9Q8E2_BMF-01       -----------MED-------EE----------DDVFEPD--PNCWRTPF
A0A3Q2CXC4_BMF-02       -----------MEE-------EE----------DDVFEPD--PNSWHTPF
A0A3Q2CXC4_BMF-01       -----------MEE-------EE----------DDVFEPD--PNSWHTPF
A0A3Q3GUU5_BMF-01       -----------MDD-------EE----------DDVFEPD--PHSWRTYF
A0A3B5B8F6_BMF-01       -----------MDD-------EE----------DDVFEPD--PHCWRTTF
A0A1S3P5K4_BMF-01       -----------MDD-------EE----------DDVFEPD--SHCWRTAF
A0A1S3SNN2_BMF-01       -----------MDD-------EE----------DDVFVPDS-SHCWRTAF
A0A674EF64_BMF-01       -----------MDD-------EE----------DDVFVPDS-SHCWRTAF
A0A4W5N3A7_BMF-01       -----------MDD-------EE----------DDVFVPDS-SHCWRTAF
A0A4W5N721_BMF-01       -----------MDD-------EE----------DDVFEPD--SHCWRTAF
A0A1S3P5K4_BMF-02       -----------MDD-------EE----------DDVFEPD--SHCWRTAF
A0A6F9B4C5_BMF-01       IDLKVLADRRRMDD-------EE----------DDVFEPD--FHCWRTAF
A0A6F9BGV6_BMF-01       LSKQDLADFCRMDD-------EE----------DDVFVPDS-SHCWRTAF
A0A3P8ZIE7_BMF-01       -----------MED-------EE----------DDVFEPD--SYCWHTAS
A0A673YQV3_BMF-01       -----------MDD-------EE----------DDVFEPD--SHCWRTAF
A0A673CKA1_BCL2L11      -------VAPCVKS-------LK----------RAYCSAS--GELSPGFT
A0A4W4H3Y1_BCL2L11      ----IRQNRANGPA-------FL----------KEQGESG--ENTGVGTA
A0A3B4BSH7_BCL2L11      ------MQNSNYCC-------F------------EQGESG--QSSGAASS
Q0GKC7_BMF-01           ----MDEDEDDVFR-------KG----------LQHWPPP--HLQIKQTE
A0A673HDR4_BMF-01       ----MDEDEDDVRR-------KG----------LQRWPSS--RVQIKQTE
A0A672JWL9_BMF-02       ----MDEDEDDVRR-------KG----------LQHWPSS--RVQIKQTE
A0A671MNR9_BMF-01       ----MDEDEDDVRR-------KG----------LQHWPSS--RVQIKQTE
A0A672JWL9_BMF-01       ----MDEDEDDVRR-------KG----------LQHWPSS--RVQIKQTE
A0A3B4CPH6_BAD-01       AELSQSGQHPLVPE-------RF----------RESRQRN--HSMNEDAL
M3XHJ5_BCL2L11-01       -------------M-------PT----------EESLQFD--KDQGTSDV
A0A671M0H4_BMF-01       ----MDEDEDDVRR-------KG----------LQRWPSS--RVQIKQTE
A0A671M0H4_BMF-02       ----MDEDEDDVRR-------KG----------LQRWPSS--RVQIKQTE
A0A2K5QXZ1_BIK-01       ----MSEERPLSID-------IL----------METLLCE--QFMDPLTM
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           ----MSEARLMARD-------II-----------KTLLHD--QVPQPAVV
O70337_BIK-03           ----MSEARLMARD-------VI-----------KTVPHD--QVPQPPVA
O70337_BIK-01           ----MSEARLMARD-------VI-----------KTVPHD--QVPQPPVA
O70337_BIK-02           ----MSEARLMARD-------VI-----------KTVPHD--QVPQPPVA
G1TZR9_BIK-01           ----MSEVRPGSRD-------LF----------QEALLDE--QVPEPLLT
H0XAE7_BIK-01           ----MSAGRPVSMD-------HF----------METFPFE--QLLEPLTM
A0A2K6FM79_BIK-01       ----MSEVRPVSTD-------LL----------METFPFE--HLLDPLIL
A0A2K5CLG5_BIK-01       ----MSEVRPLSSD-------IL----------METLLCE--QFVHPLTM
A0A2K6TBD7_BIK-01       ----MSEDRPLSSD-------IL----------METLLCE--QFVDPLTM
G1S1X2_BIK-01           ----MSEVRPISRD-------IL----------MESLLYE--QLLEPPTM
H2P4N6_BIK-01           ----MSEVRPISRD-------IL----------METLLYE--QLLEPPTM
G3QCT2_BIK-01           ----MSEVRPLSRD-------IL----------METLLYE--QLLEPPTM
A0A2R8ZXD2_BIK-01       ----MSEVRPLSRD-------IL----------METLLYE--QLLEPPTM
H2QLU7_BIK-01           ----MSEVRPLSRD-------IL----------METLLYE--QLLEPPTM
Q13323_BIK-01           ----MSEVRPLSRD-------IL----------METLLYE--QLLEPPTM
A0A2K6MCW0_BIK-01       ----MSGVRPVSRD-------IL----------METLLYE--QLLEPLTM
A0A2K6QK74_BIK-01       ----MSGVRPVSRD-------IL----------METLLYE--QLLEPLTM
A0A0D9QZY8_BIK-01       ----MSGVRPISRH-------IL----------MESLLYE--QLLEPLTM
F6SUD3_BIK-01           ----MSGVRPISRD-------TL----------METLLYE--QLLEPLTM
A0A2K6DBJ4_BIK-01       ----MSGVRPISRD-------TL----------METLLYE--QLLEPLTM
A0A2K5J4Q7_BIK-01       ----MSGVRPISRD-------IL----------METLLYE--QLLEPLTM
A0A096NKG5_BIK-01       ----MSGVRPISRD-------IL----------METLLYE--QLLEPLTM
A0A2K5LDM6_BIK-01       ----MSGVRPISRD-------TW----------METLLYE--QLLEPLTM
A0A2K5XSA1_BIK-01       ----MSGVRPISRD-------TL----------METLLYE--QLLEPLTM
H0W025_BIK-01           ----MSEAKPVARD-------PL----------METPLFE--PPPGPLLA
A0A2K5VW94_BIK-01       PKGEMSGVRPISRD-------TL----------METLLYE--QLLEPLTM
G1MV54_BCL2L11-01       -----------GMK-------SP----------EVCSECTLANTGTRLQH
C1C3S9_BAD-01           ----------MGDS-------PH----------KSMFSIE------EFPP
A0A452IFQ4_BAD-01       -------MFRIQEF-------PD----------EVFPGRG--KEAPAPPE
A0A674I2R9_BAD-01       -------MFRIQEF-------PD----------EVFPGRG--KESPLPPE
A0A672TST9_BCL2L11      ----------MAKQ-------PP----------EVKAQRD--GDGG----
A0A674H354_BCL2L11      ----------MAKQ-------PP----------EVKARRD--GEGGRLPA
O43521_BCL2L11-13       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-16       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A7N4NUH6_BCL2L11      ----------MAKQ-------PS----------DLNSECD--REGGQLQP
A0A7N5JE15_BCL2L11      --KGRTKKDQMAKQ-------PS----------DVSSECD--REGGQLQP
A0A7N5JE15_BCL2L11      GLRNARKKDQMAKQ-------PS----------DVSSECD--REGGQLQP
A0A5F8H037_BCL2L11      ----------MAKQ-------PS----------DLNSECD--REGGQLQP
A0A5F9C9V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2R8M6L7_BCL2L11      EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
A0A2Y9Q753_BCL2L11      EGKGRTKKDQMAKQ-------PS----------DVSSECD--REGGQLQP
M3YDI3_BCL2L11-01       EGKGRTKKDQMAKQ-------PS----------DVSSECD--REGGQLQP
F7HHA1_BCL2L11-02       EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
A0A096NYC3_BCL2L11      EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
F7HHA1_BCL2L11-03       EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
A0A096NYC3_BCL2L11      EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      EGKARTKKDQMAKQ-------PS----------DVSSECD--REGRQLQP
A0A674IAI8_BCL2L11      ----------MAKQ-------SS----------DLNSECN--REGGQFQS
A0A7N4NUH6_BCL2L11      ----------MAKQ-------PS----------DLNSECD--REGGQLQP
A0A2K6GE22_BCL2L11      ----------MAKQ-------PS----------DVGSECD--REGGQLQS
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-20       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-07       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-22       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
C1KGB8_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A673SRF7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2I2UX96_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A667H9R7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A7N5JE15_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
U6CTE3_BCL2L11-04       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A3Q2GRS5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A287AEC6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4X1VMQ3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A671FCV3_BCL2L11      ----------MAKQ-------PS----------DASSECD--REGGQLQP
O54918_BCL2L11-06       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
O54918_BCL2L11-08       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
O54918_BCL2L11-05       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
C1KGB7_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
U6CTE3_BCL2L11-03       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A0D9RWE0_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-09       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-14       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A3Q1MV27_BCL2L11      LAPIRRKKDQMAKQ-------PS----------DVSSECD--REGGQLQP
A0A2K6GE22_BCL2L11      ----------MAKQ-------PS----------DVGSECD--REGGQLQS
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A286XJN2_BCL2L11      ----------MAKQ-------PS----------DVSCECD--REGGQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-04       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2Y9T3Y6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQT
A0A452SBG5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4X1VMQ3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2I2UX96_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A667H9R7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A3Q7S5V2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
G3H020_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A287DFJ0_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2D2G6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2G3J8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
L8IVA4_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A3Q1MV27_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2D2G6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2G3J8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A452FCR6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-23       ------------KQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-03       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A096NYC3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O54918_BCL2L11-03       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A452U4S4_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A3Q2GRS5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
O43521_BCL2L11-17       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A096NYC3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-02       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-15       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A7N5JE15_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A673SRF7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A7N5JE15_BCL2L11      LSKEHIKKDQMAKQ-------PS----------DVSSECD--REGGQLQP
O43521_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-08       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-21       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-12       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-06       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-18       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A667H9R7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A671FCV3_BCL2L11      ----------MAKQ-------PS----------DASSECD--REGGQLQP
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A2K6GE22_BCL2L11      ----------MAKQ-------PS----------DVGSECD--REGGQLQS
A0A2K6GE22_BCL2L11      ----------MAKQ-------PS----------DVGSECD--REGGQLQS
O54918_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
G3H020_BCL2L11-02       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
F7HHA1_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-05       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A2K6GE22_BCL2L11      ----------MAKQ-------PS----------DVGSECD--REGGQLQS
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5CA52_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Q1U2_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R8M6L7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6TRJ7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A096NYC3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-11       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-19       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5NTQ5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5HZ87_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5X1Y3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K5Z7V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A096NYC3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6KJM8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2K6QIJ1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I2Y4B3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
O43521_BCL2L11-10       ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3GAA1_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2R9BZX9_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A2I3S5F6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A1U7SU38_BCL2L11      ----------MAKQ-------PS----------VVSSECD--REGGQLQP
A0A4X1VMQ3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
C1KGB6_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A3Q2GRS5_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A673SRF7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A671FCV3_BCL2L11      ----------MAKQ-------PS----------DASSECD--REGGQLQP
A0A2Y9T3Y6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQT
A0A7N5JE15_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
U6CTE3_BCL2L11-02       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4X1VMQ3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2I2UX96_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A667H9R7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A287DFJ0_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2K6GE22_BCL2L11      ----------MAKQ-------PS----------DVGSECD--REGGQLQS
A0A5F9C9V3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2D2G6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2G3J8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
L8IVA4_BCL2L11-02       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A3Q1MV27_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2D2G6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4W2G3J8_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A452FCR6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
W5PY58_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A286XJN2_BCL2L11      ----------MAKQ-------PS----------DVSCECD--REGGQLQP
A0A286XJN2_BCL2L11      ----------MAKQ-------PS----------DVSCECD--REGGQLQP
H0XW23_BCL2L11-01       ----------MAKQ-------PS----------DVGSECD--REGGQLQP
A0A671FCV3_BCL2L11      ----------MAKQ-------PS----------DASSECD--REGGQLQP
A0A2Y9Q753_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2Y9T3Y6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQT
U6CTE3_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A4X1VMQ3_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A673SRF7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A7N5JE15_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A2I2UX96_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A667H9R7_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGGQLQP
U3IW89_BCL2L11-01       ----------GGAG-------KH----------GAGTGRD--GRGGQRQP
A0A3Q2U844_BCL2L11      ----------MAKQ-------PP----------EAKAPRD--RRAGRLPP
A0A669QMB4_BCL2L11      ----------MAKQ-------PP----------EAKAPRD--RRAGRLPP
A0A2K6E1Z6_BCL2L11      ----------MAKQ-------PS----------DVSSECD--REGRQLQP
A0A5F8H037_BCL2L11      ----------MAKQ-------PS----------DLNSECD--REGGQLQP
A0A4X2L9J9_BCL2L11      ----------MAKQ-------PS----------DLNSECH--REGGQLHP
A0A7N4NUH6_BCL2L11      ----------MAKQ-------PS----------DLNSECD--REGGQLQP
A0A7N4NUH6_BCL2L11      ----------MAKQ-------PS----------DLNSECD--REGGQLQP
G3SU55_BCL2L11-01       ----------MAKQ-------PS----------DVSSECD--REGGQLQP
A0A670KEZ9_BCL2L11      ----------MAKQ-------SS----------DLTSECG--REGGQLQP
A0A670Y3D3_BCL2L11      ----------MAKQ-------SS----------DLNSECE--REGGQLQP
A0A6I8NCK5_BCL2L11      ----------MAKQ-------PS----------DLNSECD--SEGGRLEP
A0A6I8NCK5_BCL2L11      ----------MAKQ-------PS----------DLNSECD--SEGGRLEP
A0A6I8NCK5_BCL2L11      ----------MAKQ-------PS----------DLNSECD--SEGGRLEP
A0A6I8NCK5_BCL2L11      ----------MAKQ-------PS----------DLNSECD--SEGGRLEP
A0A6I8NCK5_BCL2L11      ----------MAKQ-------PS----------DLNSECD--SEGGRLEP
A0A667ZMY7_BCL2L11      --------LSDVTA-------AQ----------T--------------PR
A0A2I2YVQ5_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2I3SX38_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
H2NWG2_PMAIP1-01        --------MPGKKA-------RK----------N--------------AQ
A0A2I3HX97_PMAIP1-      --------SLG-EA-------RR----------N--------------AQ
A0A2K5JY17_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2K5NJZ2_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2K5ZWH1_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2K5VPX2_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2K6BV43_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2K6KJF1_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A2K6NC45_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
Q13794_PMAIP1-02        --------MPGKKA-------RK----------N--------------AQ
A0A2R9AKC9_PMAIP1-      --------MPGKKA-------RK----------N--------------AQ
A0A3P8RLE2_BCL2L11      ------------------------------------------------AN
A0A7M4F197_BCL2L11      GRLLLAAA----PS-------CS----------PAAGRAQRGPAALSPSQ
K7GA86_BCL2L11-01       GAAQSVQAPRRVPA-------FC----------PVAGGSERAAARFPAPA
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       ------------------------------------------------MA
A0A4W4HE29_BAD-01       FNSSFDFDRLRKVC-------AA----------RHREQQPPADQTSRSVS
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       SDTS-REQTLANGP-------AS----------QGSGESTGGGVVLPAGH
B8JK68_BCL2L11-01       SDTS-REQTLANGP-------AS----------QGSGESTGGGVVLPAGH
A0A671M057_BCL2L11      SDTS------REQT-------PG----------RGSGESAGGGAVVRSGY
A0A672L1R2_BCL2L11      SDTS------REQT-------PG----------RGSGESAGGAAVLGSGH
A0A671SJ75_BCL2L11      SDTT--TQTLANGP-------AS----------RGSGESAGGGAVLRSGH
A0A673IWZ7_BCL2L11      ADSTILKQTLANGP-------AS----------RGSGESAGGGAVLRSEH
A0A3Q1ELG4_BCL2L11      ------------------------------------------------SS
A0A3Q1CI15_BCL2L11      ------------------------------------------------PT
A0A3B4BSH7_BCL2L11      RRSNRAGRPAFLKE-------QG----------ESGQS-SGAASSRAAEQ
A0A3B4BSH7_BCL2L11      LRSNRAGRPAFLKE-------QG----------ESGQS-SGAASSRAAEQ
A0A3B1JXK6_BCL2L11      RPSNRATRPPFLKE-------QG----------ERGQSGGGGGTLSRAEQ
A0A4W4H3Y1_BCL2L11      IRQNRANGPAFLKE-------QG----------ESGEN-TGVGTASRPEQ
A0A4W5NF23_BCL2L11      NHNIGPNVSTTLIE-------RR----------KSGESHPGGGAASRAEP
A0A4W5R3N6_BCL2L11      RQQNQSNGSTILIE-------RG----------KYGELNPGGGAASGAEP
A0A1S3SAH9_BCL2L11      RQQNQSNGSTILIE-------RG----------KYGELNPGGGAASGAEP
A0A673WET2_BCL2L11      RQQNQSNGSTILIE-------RG----------KYGELNPGGGAASGAEP
A0A3P8XIA2_BCL2L11      RPQNRSNGTTTLIG-------RG----------KIGESHPCGGATSSSKL
A0A673XGV4_BCL2L11      KRGYYCNLWVAIMD-------QG----------ESGESHPGGGAASRAEP
A0A4W5R3N6_BCL2L11      RQQNQSNGSTILIE-------RG----------KYGELNPGGGAASGAEP
A0A4W5R3N6_BCL2L11      RQQNQSNGSTILIE-------RG----------KYGELNPGGGAASGAEP
A0A3Q3FKT9_BAD-01       MAAKFTI-SDSESG-------S--------------------------EE
A0A3B1IH05_BAD-01       MDHMFTI-SDESDA-------SE----------ELGD-----------SD
A0A3B3QC78_BCL2L11      GQILLTIPCSVCSA-------ED----------KITRM----------AE
A0A2K5F6X4_BBC3-02      ---------KC---------------------------------------
A0A673UKJ9_BBC3-01      --------MYS---------------------------------------
A0A480SCP6_BBC3-01      --------ARV---------------------------------------
A0A4X1VVX9_BBC3-01      --------ARV---------------------------------------
A0A2K5V8L0_BBC3-01      --------IKF---------------------------------------
A0A2I3HWI8_BBC3-03      --------MKF---------------------------------------
A0A671F3X5_BBC3-02      ---------RV---------------------------------------
A0A4W2EKD9_BBC3-01      --------VRA---------------------------------------
A0A4W2EKD9_BBC3-01      --------VRA---------------------------------------
A0A5F5PGZ4_BBC3-02      --------VRV---------------------------------------
A0A2K5QNS7_BBC3-02      --------MKC---------------------------------------
A0A2K6STD6_BBC3-02      --------MKC---------------------------------------
A0A2K6FQZ1_BBC3-04      --------MKF---------------------------------------
H2NZD3_BBC3-02          --------MKF---------------------------------------
Q9BXH1_BBC3-05          --------MKF---------------------------------------
A0A2R9BZA9_BBC3-01      --------MKF---------------------------------------
A0A2I3RGH5_BBC3-03      --------MKF---------------------------------------
A0A2K5P2T8_BBC3-03      --------IKF---------------------------------------
A0A2K6ASP2_BBC3-03      --------IKF---------------------------------------
A0A2I3N2Z9_BBC3-02      --------IKF---------------------------------------
A0A2K6QZT2_BBC3-04      --------IKF---------------------------------------
A0A669C520_BCL2L11      --------YLFENA-------DM----------QADCGLRIYFWLFLCDA
A0A674AVP9_BAD-01       ------------------------------------------------MD
A0A1S3L0Z2_BAD-01       ------------------------------------------------MD
B5XEF1_BAD-01           ------------------------------------------------MD
A0A4W5MZR2_BAD-01       ------------------------------------------------MD
A0A060W8W7_BAD-01       ------------------------------------------------MD
E7FBJ6_BAD-01           ------------ME-------NT----------S--------------HD
A0A673J5Q9_BAD-01       ------------MD-------NT----------L--------------HD
A0A671PX91_BAD-01       ------------MD-------NT----------L--------------HD
A0A672LB88_BAD-01       ------------MD-------NT----------L--------------HD
A0A673I6H5_BAD-01       ------------MD-------KR----------L--------------HG
A0A671SBB4_BAD-01       ------------MD-------KR----------L--------------HD
A0A672R7P6_BAD-01       ------------MD-------KR----------L--------------HD
A0A3P8Y761_BAD-02       GISTSTILPHTTGT-------GD----------RLLPY----------GL
A0A3Q2QC80_BAD-01       MAAKFTI-SDSDSE-------PP----------EEVEE----------EG
A0A4W6EMZ7_BAD-02       MAANFTI-SDSESE-------AS----------EEVEE----------GE
A0A3Q3FKT9_BAD-02       MAAKFTI-SDSESG-------SE----------EEVKE----------EE
A0A3Q3FKT9_BAD-03       MAAKFTI-SDSESG-------SE----------EEVKE----------EE
A0A3B5L9R9_BAD-01       MDTKFTI-SDGESD-------PS----------EDVEE----------RG
A0A667ZNC6_BAD-01       -MASFTI-SDGESD-------PS----------EEVGE----------SE
A0A3P9B2E4_BAD-01       MAANFKI-SDSDSE-------AS----------EEVGE----------GE
A0A668V3Q4_BAD-01       MAANFTI-SDSESE-------TS----------EEVGE----------EE
I3K7B6_BAD-01           MAANFTI-SDSESE-------TS----------EEVGE----------EE
A0A3Q3C680_BAD-01       MAANFKI-SDSDSE-------AS----------EEVGE----------EE
A0A3P8QRJ7_BAD-01       MAANFKI-SDSDSE-------AS----------EEVGE----------GE
A0A3Q4GGN3_BAD-01       MAANFKI-SDSDSE-------TS----------EEVGE----------GE
A0A3B4GXJ6_BAD-01       MAANFKI-SDSDSE-------AS----------EEVGE----------GE
A0A3Q2D5S0_BAD-01       MAATFTI-SDSDTE-------PS----------EEVEE----------TR
A0A3Q0QNQ2_BAD-01       FIHFLPF-IQGRGQ-------QP----------SHLLQ----------LI
A0A3P8WI83_BAD-02       MAAQFTI-SDSESE-------PE----------EEVEG----------GK
A0A3P8WI83_BAD-01       MAAQFTI-SDSESE-------PE----------EEVEG----------GK
A0A3P9HNZ2_BAD-01       MAAKFTI-SD-DSE-------SS----------EEVEG----------GK
A0A3B3BQF7_BAD-01       MAAKFSI-SDNDSE-------SS----------EEVEG----------GR
A0A672JQ68_BAD-01       MAAKFSI-SDSESE-------PS----------EEVEE----------EE
A0A2U9BAC9_BAD-01       MAANFTI-SDSESE-------PS----------EEVEE----------GE
A0A4W6EMZ7_BAD-01       MAANFTI-SDSESE-------AS----------EEVEE----------GE
A0A3B4VFC5_BAD-01       MAANFTI-SDSESE-------PS----------EEVDE----------GE
A0A3B4W9T1_BAD-01       MAANFTI-SDSESE-------PS----------EEVDE----------GE
A0A3Q1K1C7_BAD-01       MAARFTI-SDSDSD-------PS----------EGMEE----------EG
A0A672YF93_BAD-01       MAAKFTI-SDSESE-------PS----------EDLEE----------EQ
A0A3Q1GWH9_BAD-01       MAAKFSI-SDGDSE-------PE----------E--VE----------GE
A0A3Q1CPU7_BAD-01       MAAKFTI-SDSESE-------PS----------EEVEE----------GE
A0A3P8TWH6_BAD-01       MAAKFTI-SDSESE-------PS----------EEVEE----------GE
H3D8J8_BAD-01           MAAKFSLCSDSDSE-------PS----------EEVEE----------GE
A0A6F9CQZ0_BAD-02       ---MFTI-SDCKSE-------PS----------E-VGE----------TE
A0A6F9CA11_BAD-02       MAQMFTI-SDSESE-------PS----------EDVGE----------TE
A0A1S3N9Q3_BAD-01       MAQIFTI-SDSE----------S----------EEVGE----------TE
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       FKMDHTQ-DCVGDI-------PE----------NINEK----------YD
A0A4W5R1T6_BAD-01       FTMNHTH-DCVDDN-------PE----------TMNEK----------DE
A0A060W8P9_BAD-01       --MNHTH-DCVDDN-------PE----------TMNEQ----------DE
B5X1T1_BAD-01           --MDHTH-DCVDDN-------PE----------TMNEH----------DE
A0A673ZHY7_BAD-01       --MDHTH-DCVDDN-------PE----------TMNEQ----------DE
A0A671NP27_BAD-01       MAQMFSI-SDNESD-------TE----------TSEDC----------ED
A0A672SAE4_BAD-01       MAQMFSI-SDNESD-------TE----------TSEDC----------ED
A0A672SAE4_BAD-02       MAQMFSI-SDNESD-------TE----------TSEDC----------ED
A0A671RUV0_BAD-01       MAQMFSI-SDNESE-------TE----------TSEDC----------EE
A0A673HRQ3_BAD-01       MAQMFSI-SDNESE-------TE----------TSEDC----------EE
A0A672RGH0_BAD-01       MAQMFSI-SDNESE-------TE----------TSEDC----------EE
Q4V925_BAD-02           MAHMFNI-SD-DSE-------TE----------TMEDS----------ED
Q4V925_BAD-03           MAHMFNI-SD-DSE-------TE----------TMEDS----------ED
A7MCM4_BAD-01           MAHMFNI-SD-DSE-------TE----------TMEDS----------EA
Q4V925_BAD-01           MAHMFNI-SD-DSE-------TE----------TMEDS----------ED
Q4V925_BAD-04           MAHMFNI-SD-DSE-------TE----------TMEDS----------ED
A0A3B3QX41_BAD-01       MAHMFTI-SG-NES-------DT----------SESDT----------PD
A0A3Q3RXS8_BAD-01       MAAKFS--IS-ESE-------SD----------SSEEV----------EG
A0A3Q0QNQ2_BAD-02       --------MP-EPP-------RL----------VLFDV----------EE
A0A3Q3WTY4_BAD-01       MATNFTI-SS-DSE-------SE----------LSEEI----------EE
A0A3P8Y761_BAD-01       MENIFTI-S--DTE-------SE----------SSDV------------E
A0A4W5JLL9_BAD-01       MAQMFTI-S--DSE-------SE----------PSEEV----------GE
A0A3B5Q2N7_BAD-01       MDTKFTI-S--DGE-------SD----------PSEDV----------EE
A0A087X8P8_BAD-01       MDAKFTI-S--DSD-------SE----------PSEDV----------EE
A0A3B3UA11_BAD-01       MDAKFTI-S--DSD-------SE----------PSEDV----------EE
A0A3B3YFR1_BAD-01       MDAKFTI-S--DSD-------SE----------PSEDV----------EE
A0A3P9Q7C3_BAD-01       MDAKFTI-S--DSD-------SE----------PSEDV----------EE
A0A3B3HDU2_BAD-01       MAAKFTI-S---DD-------SE----------SSEEV----------EG
A0A3P9KSL7_BAD-02       MAAKFTI-S---DD-------SE----------SSEEV----------EG
A0A3P9KSL7_BAD-01       MAAKFTI-S---DD-------SE----------SSEEV----------EG
A0A3B5BAL2_BAD-01       MAAQFSI-S--GSE-------SD----------P-EEV----------EE
A0A665TUH3_BAD-01       MSAQFTI-S--DSE-------SD----------PSEEV----------EE
A0A674MXC1_BAD-04       MATRFSI-SS-DSD-------SD----------PSEEV----------DE
A0A674MXC1_BAD-01       MATRFSI-SS-DSD-------SD----------PSEEV----------DE
A0A674MXC1_BAD-02       MATRFSI-SS-DSD-------SD----------PSEEV----------DE
A0A674MXC1_BAD-03       MATRFSI-SS-DSD-------SD----------PSEEV----------DE
A0A671TL42_BAD-01       MAANFTI-SS-ESD-------SE----------PSEEV----------EE
A0A3Q3AEL8_BAD-01       MAAKFTI-S--DSE-------SE----------PSDEV----------EE
A0A3Q3AEL8_BAD-02       MAAKFTI-S--DSE-------SE----------PSDEV----------EE
A0A1A8AQV0_BAD-01       MAAHFTI-S--DSD-------SE----------PSEEV----------EE
G3Q8B3_BAD-01           MAAHFTI-S--DSE-------SE----------PSDGV----------EE
A0A3Q2Y0E4_BAD-01       MAANFSI-S--DSE-------SE----------PSEEV----------EE
A0A3Q3R5S3_BAD-01       MAANFTI-S--DSE-------SE----------SSEEV----------EE
F7GL32_BBC3-02          ------------MA-------RA----------Q--------------QD
A0A4X2LVY2_BBC3-01      AHLSPQA-PRCGMA-------RA----------Q--------------QD
A0A4X2LVY2_BBC3-02      ------------MA-------RA----------Q--------------QD
A0A3Q3ESW6_BCL2L11      MHRPSRP-PNRLDG-------SP----------TVTE-----------SH
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      MRSPSRP-PNLRDG-------ST----------EVKA-----------TE
A0A3B5M375_BCL2L11      LCSSNRP-PNLLDG-------ST----------EVTP-----------AE
A0A3B5QAM1_BCL2L11      LCSSNRP-PNLLDG-------ST----------EVTP-----------AE
A0A3B5QAM1_BCL2L11      -MHSLRP-PNLLDG-------ST----------EVTP-----------AE
A0A672RK14_BMF-01       DEEDEQL-PHCCET-------PL----------RNKS-----------SE
A0A673JJ10_BMF-01       DEEDEQL-PHCCET-------PL----------RNKS-----------SE
A0A4W6ETK4_BCL2L11      ------M-KAQADG-------AA-----------LFI-----------QQ
A0A4W6ETK4_BCL2L11      MQPPSRP-PNQSDG-------ST----------EVTA-----------RE
A0A4W6ETK4_BCL2L11      ----QRP-PNQSDG-------ST----------EVTA-----------RE
A0A3B4V919_BCL2L11      ------M-KAQADG-------AA-----------LFI-----------QQ
A0A3B4XZH1_BCL2L11      ------M-KAQADG-------AA-----------LFI-----------QQ
A0A3Q2SZH6_BCL2L11      LCSSNRP-PNLRDG-------ST----------EVTP-----------PE
A0A3B3VNE0_BCL2L11      -MHSSRP-PNLLDG-------ST----------EVTP-----------AE
A0A3B3YII5_BCL2L11      -MHSLRP-PNLLDG-------ST----------EVTP-----------AE
A0A3B3YII5_BCL2L11      -MHSLRP-PNLLDG-------ST----------EVTP-----------AE
A0A3Q3K6I5_BCL2L11      -MHLSRP-PNRSDG-------ST----------AVTA-----------TE
A0A3Q1ICY2_BCL2L11      --MDPRQ-PNRSDG-------ST----------AVTA-----------TG
A0A671W556_BCL2L11      MQHPSRP-PNSSDG-------ST----------AVTA-----------GQ
A0A6I8NF73_BMF-01       SAGRMEL-SQYEEE-------LE----------ELTGLEELEDDVFHPET
Q9GL49_PMAIP1-01        ----------------------M----------R--------------SS
A0A5F8GA49_BAD-01       PVSMFQI-PEF-EP-------GE----------Q--------------ED
H3ANP3_BAD-03           ---MFQI-SDSDSD-------AY----------E--------------DD
H3ANP3_BAD-01           ---MFQI-SDSDSD-------AY----------E--------------DD
H3ANP3_BAD-02           ---MFQI-SDSDSD-------AY----------E--------------DD
H3ANP3_BAD-04           ---MFQI-SDSDSD-------AY----------E--------------DD
G3VRY3_BAD-03           ---MFQI-SEF-EP-------SE---------------------------
G3VRY3_BAD-02           ---MFQI-SEF-EP-------SE---------------------------
G3VRY3_BAD-01           ---MFQI-SEF-EP-------SE---------------------------
A0A4X2KAA5_BAD-01       -MSMFQI-SEF-EP-------SE----------Q--------------ET
A0A672V9F8_BAD-01       ------M-GGPCEV-------VG----------C--------------SP
A0A674GQ16_BAD-01       ---MLRL-DETPED-------RG----------S--------------PP
A0A6I8NVP2_BAD-01       ---MFQI-PEF-EP-------SE----------R--------------GD
G3TP47_BAD-01           LQSMFQI-PEF-EQ-------SD----------R--------------ED
Q61337_BAD-05           ---MFQI-PEF-EP-------SE----------Q--------------ED
Q61337_BAD-06           ---MFQI-PEF-EP-------SE----------Q--------------ED
Q61337_BAD-03           ---MFQI-PEF-EP-------SE----------Q--------------ED
Q61337_BAD-04           ---MFQI-PEF-EP-------SE----------Q--------------ED
Q61337_BAD-02           AQSMFQI-PEF-EP-------SE----------Q--------------ED
Q61337_BAD-01           AQSMFQI-PEF-EP-------SE----------Q--------------ED
A0A287CT05_BAD-01       TQSMFQI-PEF-EP-------SE----------Q--------------ED
A0A287CT05_BAD-02       TQSMFQI-PEF-EP-------SE----------Q--------------ED
G5B6Q3_BAD-01           AQSMFQI-PEF-EP-------SE----------Q--------------ED
G5B6Q3_BAD-02           ---MFQI-PEF-EP-------SE----------Q--------------ED
G1P8C5_BAD-01           AQSMFQI-PEF-EH-------SE----------Q--------------ED
A0A452ER54_BAD-02       AQSMFQI-PEF-EQ-------SE----------Q--------------ED
W5P8G9_BAD-01           AQSMFQI-PEF-EQ-------SE----------Q--------------ED
Q61337_BAD-07           ----XQI-PEF-EP-------SE----------Q--------------ED
H0WVR2_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6GWV0_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
F7DN67_BAD-01           ---MFQI-PEF-EQ-------SE----------P--------------ED
Q45KI9_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A3Q7SWS0_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
B4DZQ9_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2J8TYJ3_BAD-02       SQSMFQI-PEF-EP-------SE----------Q--------------ED
A0A2I2YFH2_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2I2YFH2_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
Q92934_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
Q92934_BAD-02           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2I3TBK7_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2R8Z674_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2J8TYJ3_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
H0V608_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5PDB1_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------EG
U3F2S3_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5E6A6_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6TG62_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5M0A7_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A1D5QBW1_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6E7I4_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5XJR2_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6N196_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6PUL3_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5HKU7_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A0D9R491_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5VCA1_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A4X1VE31_BAD-02       ---MFQI-PEF-EQ-------SE----------Q--------------ED
A0A4X1VE31_BAD-01       AQSMFQI-PEF-EQ-------SE----------Q--------------ED
A0A287AEF3_BAD-01       SQSMFQI-PEF-EQ-------SE----------Q--------------ED
A0A4X1VE31_BAD-03       SQSMFQI-PEF-EQ-------SE----------Q--------------ED
A0A671ELU4_BAD-01       ---MFQI-PEF-EQ-------SE----------Q--------------ED
A0A452ER54_BAD-01       RGSMFQI-PEF-EQ-------SE----------Q--------------ED
A0A452RJM6_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A384DJL2_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
M3YNE7_BAD-01           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A667H8Z9_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A673V6P8_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A4W2C9A8_BAD-01       ---MFQI-PEF-EQ-------SE----------Q--------------ED
A0A4W2C9A8_BAD-01       ---MFQI-PEF-EQ-------SE----------Q--------------ED
F1MUT9_BAD-01           ---MFQI-PEF-EQ-------SE----------Q--------------ED
Q3SYZ0_BAD-01           ---MFQI-PEF-EQ-------SE----------Q--------------ED
A0A4U1FMC3_BAD-01       ---MFQI-PEF-EQ-------SE----------Q--------------ED
A0A2Y9EHU3_BAD-01       ---MFQI-PEF-EQ-------SE----------Q--------------ED
A0A2I3TBK7_BAD-01       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2R8Z674_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2I2YFH2_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
Q92934_BAD-03           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5M0A7_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5XJR2_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6E7I4_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5PDB1_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------EG
A0A2K5E6A6_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6TG62_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5HKU7_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6N196_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6PUL3_BAD-02       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2J8TYJ3_BAD-01       SQSMFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5M0A7_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5XJR2_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6E7I4_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2I2YFH2_BAD-04       ---MFQI-PEF-EP-------SE----------Q--------------ED
Q92934_BAD-04           ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2I3TBK7_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2R8Z674_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5E6A6_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K5PDB1_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------EG
A0A2K6TG62_BAD-03       ---MFQI-PEF-EP-------SE----------Q--------------ED
A0A2K6KS56_BBC3-01      ------M-PRTR--------------------------------------
A0A2I3RGH5_BBC3-04      VPCQICG-PRERHG-------PR----------T--------------PG
A0A2K5F6X4_BBC3-03      VPCQMCG-PRERHG-------PR----------T--------------PG
A0A2K6FQZ1_BBC3-02      VLGHIPG-PRERHG-------PR----------T--------------PG
A0A671F3X5_BBC3-01      VPHQICG-PRERHG-------PS----------T--------------PG
A0A5F5PGZ4_BBC3-01      VPQQTRG-PRERHG-------PS----------T--------------PG
A0A2I3HWI8_BBC3-02      VPCQICG-PRERHG-------PR----------T--------------PG
A0A2K5QNS7_BBC3-01      VPCQMCG-PRERHG-------PR----------T--------------PG
A0A2K5P2T8_BBC3-01      VLCQICG-PRERHG-------PR----------T--------------PG
A0A2K6QZT2_BBC3-02      VPCQICG-PRERHG-------PR----------T--------------PG
A0A2K6ASP2_BBC3-01      VPCQICG-PRERHG-------PR----------T--------------PG
A0A2I3N2Z9_BBC3-01      VPCQICG-PRERHG-------PR----------T--------------PG
Q9BXH1_BBC3-03          VPCQICG-PRERHG-------PR----------T--------------PG
A0A2I3RGH5_BBC3-02      VPCQICG-PRERHG-------PR----------T--------------PG
H2NZD3_BBC3-01          VPCQICG-PRERHG-------PR----------T--------------AG
M3Y0R3_BBC3-01          -----QA-PGSAMA-------RA----------R--------------QE
B2RVL4_BBC3-01          ------------MA-------RA----------R--------------QE
Q99ML1_BBC3-02          ------------MA-------RA----------R--------------QE
Q80ZG6_BBC3-01          ------------MA-------RA----------R--------------QE
H0XQ00_BBC3-01          ------------MA-------RA----------R--------------QE
A0A4X1VVX9_BBC3-02      ------------MA-------RA----------R--------------QE
A0A4W2EKD9_BBC3-02      ------------MA-------RA----------R--------------QE
A0A3Q1LXZ6_BBC3-01      ------------MA-------RA----------R--------------QE
A0A4W2EKD9_BBC3-02      ------------MA-------RA----------R--------------QE
A0A452E3G1_BBC3-01      ------------MA-------RA----------R--------------QE
A0A2Y9PEE3_BBC3-01      ------------MA-------RA----------R--------------QE
A0A337SJI7_BBC3-01      ------------MA-------RA----------R--------------QE
A0A667IM83_BBC3-01      ------------MA-------RA----------R--------------QE
A0A480SCP6_BBC3-03      ------------MA-------RA----------R--------------QE
A0A2K6FQZ1_BBC3-01      ------------MA-------RA----------R--------------QE
Q9BXH1_BBC3-06          ------------MA-------RA----------R--------------QE
A0A2I3RGH5_BBC3-01      ------------MA-------RA----------R--------------QE
A0A2K6QZT2_BBC3-01      ------------MA-------RA----------R--------------QE
A0A0D9S2H2_BBC3-01      -----QA-PGSAMA-------RA----------R--------------QE
B4DQK3_BBC3-01          -----MA-PGSAMA-------RA----------R--------------QE
Q99ML1_BBC3-01          ------------MA-------RA----------R--------------QE
Q99ML1_BBC3-03          ------------MA-------RA----------R--------------QE
G3T2N1_BBC3-01          ------------MA-------RA----------R--------------QE
A0A5F9DGT6_BBC3-01      ------------MA-------RA----------R--------------QE
A0A480SCP6_BBC3-02      SRNLSQA-PGSAMA-------RA----------R--------------QE
A0A7N5KJL4_BBC3-02      ------------MA-------RA----------R--------------QE
A0A7N5KJL4_BBC3-01      ------------MA-------RA----------R--------------QE
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           ---------------------MV----------QGSHQVALRLACIGDEM
Q9JM54_PMAIP1-01        -----------------------------------MPGRKARRNAPVNPT
A3KND0_BMF-01           ----------MDELDDDVFYPDA----------FGYPDQTITSSSLFNQS
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      -----------------------------------------TSEAFGRSG
F1SMU1_PMAIP1-01        ---------------------------------ARAAAGAPTSEAFGRSG
A0A667HYB7_PMAIP1-      ---------------------EE----------SAGAGRRSDLRGARASL
A0A671EYM5_PMAIP1-      ----------------------------------VGSCFSPEPEVLGYPL
Q6P7C5_BAD-01           ---------------------------------------------MGTPK
A0A663E970_BCL2L11      ---------------------MA----------KQPPEVKAQRDGEGGRL
A0A803WCD8_BCL2L11      ---------------------RS----------RGPGRVGSGRVRHGRR-
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------LEF----------------NNIRKDWTLAL
A0A670YRG7_BAD-01       --------------------LEL----------RRRIGSDQLDSETSDEV
A0A2K5F6X4_BBC3-01      ---------------------------------------KCGVGSAWACP
A0A673UKJ9_BBC3-02      --------------------------------------MYSSAGAARACP
A0A2K6FQZ1_BBC3-03      --------------------------------------MKFGAGSARACP
A0A671F3X5_BBC3-03      ---------------------------------------RVSAGAARACP
A0A2K6STD6_BBC3-01      --------------------------------------MKCGMGSAWACP
A0A2K5P2T8_BBC3-02      --------------------------------------IKFGVGSARACP
A0A2K6ASP2_BBC3-02      --------------------------------------IKFGVGSARACP
A0A2K6QZT2_BBC3-03      --------------------------------------IKFGVGSARACP
A0A2K5QNS7_BBC3-03      --------------------------------------MKCGVGSAWACP
A0A2I3HWI8_BBC3-01      --------------------------------------MKFGMGSARACP
Q9BXH1_BBC3-04          --------------------------------------MKFGMGSAQACP
A0A2R9BZA9_BBC3-02      --------------------------------------MKFGMGSAQACP
A0A2I3RGH5_BBC3-05      --------------------------------------MKFGMGSAQACP
A0A2K6KS56_BBC3-02      -----------------------------------------------LAE
Q2PG01_BAD-01           ---------------------------------------------MEEEP
A0A2I3H4B2_BAD-01       ---------------------------------------------MGEEP
Q92934_BAD-06           ---------------------------------------------MGEEP
Q92934_BAD-05           ---------------------------------------------MGEEP
P62816_HRK-03           -----------------------------------------------MCP
P62817_HRK-01           -----------------------------------------------MCP
A0A4X1TMB1_HRK-01       -----------------------------------------------MCP
A0A2K5KZ69_HRK-01       -----------------------------------------------MCP
H2NIS8_HRK-01           -----------------------------------------------MCP
H2Q6Y8_HRK-01           -----------------------------------------------MCP
G3UH24_HRK-01           -----------------------------------------------MCP
A0A2K5BYA0_HRK-01       -----------------------------------------------MCP
A0A4W2CRW4_HRK-01       -----------------------------------------------MCP
A0A4W2GVZ3_HRK-01       -----------------------------------------------MCP
A0A4W2CRW4_HRK-01       -----------------------------------------------MCP
A0A4W2GVZ3_HRK-01       -----------------------------------------------MCP
U3E722_HRK-01           -----------------------------------------------MCP
A0A452DXE5_HRK-01       -----------------------------------------------MCP
A0A0D9SC73_HRK-01       -----------------------------------------------MCP
A0A3Q2IBL3_HRK-01       -----------------------------------------------MCP
A0A337SQ56_HRK-01       -----------------------------------------------MCP
G3QTJ6_HRK-01           -----------------------------------------------MCP
O00198_HRK-01           -----------------------------------------------MCP
A0A2K6AYL7_HRK-01       -----------------------------------------------MCP
G1QHD8_HRK-01           -----------------------------------------------MCP
G1T7W1_HRK-01           -----------------------------------------------MCP
H0Y001_HRK-01           -----------------------------------------------MCP
A0A096N944_HRK-01       -----------------------------------------------MCP
A0A2K6GL98_HRK-01       -----------------------------------------------MCP
A0A671EZ71_HRK-01       -----------------------------------------------MCP
A0A2K5PIE7_HRK-01       -----------------------------------------------MCP
A0A2Y9Q8G3_HRK-01       -----------------------------------------------MCP
A0A2Y9SD47_HRK-01       -----------------------------------------------MCP
F7G1G0_HRK-01           -----------------------------------------------MCP
A0A4X2K3J4_HRK-01       -----------------------------------------------MCP
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------MEPSQCVEELED
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      ---------------------------------------MPGLESH----
A0A674HDV6_PMAIP1-      ---------------------------------------MPGRTLR-KTA
A0A803VLS8_BCL2L11      ---------------------------------------MFHKAAV-PEV
A0A5F8ATY0_PMAIP1-      ---------------------------------------MPSKNEK-TNL
A0A5F9C629_PMAIP1-      ---------------------------------------MPGKRAR-KRS
A0A2K6EM90_PMAIP1-      ---------------------------------------MPVKKAR-KNA
A0A670IXL8_PMAIP1-      ---------------------------------------MPSQRLE-LQL
G1P8F9_PMAIP1-01        ---------------------------------------MPGKKAR-KNA
Q9JM54_PMAIP1-03        ---------------------------------------MPGKSQKSRMR
A0A3Q2I0H2_PMAIP1-      ---------------------------------------MPTRKAR-KSG
G3T0P7_PMAIP1-01        ---------------------------------------MPGKKAR-KSA
A0A7N5JEA5_PMAIP1-      ---------------------------------------MPGKKAR-KSA
A0A452STA4_PMAIP1-      ---------------------------------------MPGKKAR-KSA
A0A2K5NJZ2_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A0D9S003_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K6BV43_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K5ZWH1_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K5JY17_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K6KJF1_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K6NC45_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K6S6C4_PMAIP1-      ---------------------------------------MPGKKAR-KSA
A0A2I2YVQ5_PMAIP1-      ---------------------------------------MPGKKAR-KNA
Q13794_PMAIP1-01        ---------------------------------------MPGKKAR-KNA
A0A2R9AKC9_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2I3SX38_PMAIP1-      ---------------------------------------MPGKKAR-KNA
A0A2K5CFK7_PMAIP1-      ---------------------------------------MPGKKAR-KSA
A0A2K5QQC6_PMAIP1-      ---------------------------------------MPGKKAR-KSA
A0A337SUX1_PMAIP1-      ---------------------------------------MPGKRTR-KSA
A0A673UI19_PMAIP1-      ---------------------------------------MPGKKAR-KSA
A0A2Y9P485_PMAIP1-      ---------------------------------------MPGRRVR-KSA
A0A2Y9TJ73_PMAIP1-      ---------------------------------------MPGRRAR-KSA
A0A4W2CDL0_PMAIP1-      ---------------------------------------MPGRRAR-KSA
A0A3Q1NFP6_PMAIP1-      ---------------------------------------MPGRRAR-KSA
A0A4W2CDL0_PMAIP1-      ---------------------------------------MPGRRAR-KSA
A0A452EST2_PMAIP1-      ---------------------------------------MPGRRAR-RSA
W5P738_PMAIP1-01        ---------------------------------------MPGRRAR-RSA
A0A803YIP1_PMAIP1-      ---------------------------------------LSGKDLV-RIK
A0A663N909_PMAIP1-      ---------------------------------------LPGHHHK-RRC
A0A1D5PAR2_PMAIP1-      --------------------------------------MMPGRTIR-K--
Q9JM54_PMAIP1-02        ---------------------------------------MPGRKAR-RNA
A0A2I3HX97_PMAIP1-      ----------------------------------------KPGRAR-RNA
G1LIZ7_PMAIP1-01        ---------------------------------------IGSLLSG-EPA
A0A452TE71_PMAIP1-      ---------------------------------------WGSLLSG-EPA
A0A452J430_PMAIP1-      ---------------------------------------MPGKTLR-KGA
A0A493SWX7_PMAIP1-      ---------------------------------------MPCRTLR-KPA
A0A674JUE0_PMAIP1-      ---------------------------------------VRGTKFG-SRF
A0A7M4FB17_PMAIP1-      ---------------------------------------QSGRDSD-TSA
A0A663FH84_PMAIP1-      ---------------------------------------MPGRTLR-KAA
A0A670ZS96_PMAIP1-      ---------------------------------------RGGKERQ-RTA
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      CQLISWLS------------------------------------------
O61667_EGL1-01          QDFSSCED------------------------------------------
A0A5F5XUY6_BIK-01       SAPWHSVP------VHREEMSHAGPLSRNVFLSTFLQEH-----------
A0A4W3JXA1_BMF-01       GTHESLTW-------RATRSRLRSPINS---------VH-----------
A0A3Q3SYA1_BCL2L11      SRGRTRSI--------AHLDSLSVFHTR----SIFQLPR-----------
A0A3Q2LHE3_BIK-02       RSSSSYSVPKAVWSSVGEEMSQVGPVSRDLFLDAFLHER-----------
A0A7N5KDU2_BIK-01       ATAAATSD-------AREEMSHTGPLSRNLFLSTFLQEH-----------
A0A3Q7V097_BIK-03       IRWLGLHA-------DLGEMSHSGPLSRNLFLSTFLQEH-----------
A0A3Q7V097_BIK-01       EIGRNIPN-------SREEMSHSGPLSRNLFLSTFLQEH-----------
A0A3Q7V097_BIK-02       -------------------MSHSGPLSRNLFLSTFLQEH-----------
A0A667G4D3_BIK-01       -------------------MSHAGPLSRNVFLSTFLQEH-----------
A0A673V4V4_BIK-01       ----MTEP-------NREEMSHAGPLSRDVFLSTFLQEH-----------
A0A493T7X1_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A670JUU6_BMF-02       NEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A670JUU6_BMF-04       NEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A674GIP8_BMF-03       GEMTATGF-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A7M4FPU2_BMF-01       GEMTSTGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
K7FRX2_BMF-01           GEMTPTGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A3Q2UCA0_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A3Q2UCA0_BMF-02       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A669PL85_BMF-02       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A663MPI8_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A674GIP8_BMF-02       GEMTATGF-------FTQNQSYSCLLGR---FQLFPLTH-----------
U3JS06_BMF-01           GEMTATGF-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A674GIP8_BMF-01       GEMTATGF-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A803YBD7_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A663DZQ4_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A672V891_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A493T7X1_BMF-02       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A3Q2UCA0_BMF-03       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A3Q2UCA0_BMF-04       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A669PL85_BMF-01       GEMTATGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A670XMZ5_BMF-01       SKMAFRGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A803SZ00_BMF-02       SEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A803SZ00_BMF-01       SEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A803SZ00_BMF-03       SEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A670JUU6_BMF-01       NEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A670JUU6_BMF-05       NEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A670JUU6_BMF-03       NEMTFPGI-------FTQSKSYNCLLGR---FQLFPLTH-----------
A0A337ST43_BMF-02       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
A0A2K5KGP2_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6FFN3_BMF-02       GSVLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A2K5E1Q4_BMF-02       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5RN49_BMF-02       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6TW78_BMF-03       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6RAW1_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2I2Z168_BMF-02       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q96LC9_BMF-05           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q96LC9_BMF-07           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2R9BS98_BMF-02       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2J8QDD5_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5MJW4_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6B5F6_BMF-03       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5Z4A9_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2I3HD83_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
F7HZL0_BMF-01           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A337ST43_BMF-04       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
A0A337ST43_BMF-05       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
F7HZL0_BMF-03           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q91ZE9_BMF-06           GGLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
Q91ZE9_BMF-01           GGLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A287CXH0_BMF-01       GSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
G3T7Z4_BMF-01           GGLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A5F8GKJ8_BMF-01       GGLTSAAL-------FAQSQ-PDYMLDG---LQLFPLTH-----------
A0A7N4PJP2_BMF-01       GGLTSPAL-------FAQSQ-PDYMLDG---LQLFPLTH-----------
A0A4X2KLG2_BMF-01       GGLTSAAL-------FAQSQ-PDYMLDG---LQLFPLTH-----------
A0A3Q2HR24_BMF-02       RSLLSADL-------FAPSQ-LDCPLSH---LRLFPLTH-----------
A0A3Q2HR24_BMF-01       RSLLSADL-------FAPSQ-LDCPLSH---LRLFPLTH-----------
A0A5F4CJ04_BMF-03       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A5F4CJ04_BMF-02       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A5F4CJ04_BMF-01       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A286XXB0_BMF-02       GSLLSADL-------FAQSQ-LDCPLGR---LHLFPLTH-----------
Q96LC9_BMF-06           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
F7HZL0_BMF-02           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A096NTE9_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A286XXB0_BMF-01       GSLLSADL-------FAQSQ-LDCPLGR---LHLFPLTH-----------
A0A337ST43_BMF-03       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
A0A7N9CRT3_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6FFN3_BMF-01       GSVLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
H0WYH6_BMF-01           GNVLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A2K5MJW4_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5KGP2_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A7N9CRT3_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A5F7ZML1_BMF-03       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A5F7ZML1_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6B5F6_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6B5F6_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6B5F6_BMF-04       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5Z4A9_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6L919_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6L919_BMF-03       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6RAW1_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A0D9R4R5_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5E1Q4_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6TW78_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6TW78_BMF-02       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K5RN49_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2I2Z168_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q96LC9_BMF-01           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q96LC9_BMF-02           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q96LC9_BMF-03           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
Q96LC9_BMF-04           GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2R9BS98_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2J8QDD5_BMF-02       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2J8T301_BMF-01       GSLLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A7N9CRT3_BMF-03       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A5F7ZML1_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A096NTE9_BMF-01       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
A0A2K6L919_BMF-02       GSSLSADL-------FAQSL-LDCPLSR---LQLFPLTH-----------
G1SR62_BMF-01           QSLLSADP-------FAQSQ-LDCPLGR---LHLFPLTH-----------
A0A337ST43_BMF-01       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
W5QFV1_BMF-01           RRLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A4W2EII1_BMF-01       RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A4W2EII1_BMF-01       RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
Q05KI3_BMF-01           RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
Q05KI3_BMF-02           RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A4W2INA4_BMF-01       RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
L8IXF5_BMF-01           RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A4W2INA4_BMF-01       RSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A452F2E0_BMF-02       RRLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A452F2E0_BMF-01       RRLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A667H967_BMF-01       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
A0A2U4BC98_BMF-01       GSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A671DWL6_BMF-01       GSLPSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
M3YAD5_BMF-01           GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
U6CSY8_BMF-01           GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A452SED0_BMF-01       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A384D070_BMF-01       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A337SAW2_BAD-01       GPRTKAVG-------REQVPRRGRRLGR---KRPRPLAS-----------
A0A452H3N6_BMF-01       GEMTPPGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A674IPL3_BMF-01       GEMTPPGI-------FTQNQSYSCLLGR---FQLFPLTH-----------
A0A673TA87_BMF-01       GSLLSANL-------FAQSQ-LDCPLSH---LQLFPLTH-----------
A0A287AIU8_BMF-02       RRV-SADP-------FVQSQ-LDCPLSR---LQLFPLTH-----------
A0A7N5JI49_BMF-02       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A7N5JI49_BMF-01       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
G1PAU1_BMF-01           GSLPSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
Q91ZE9_BMF-02           GGLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A287AIU8_BMF-01       RRV-SADP-------FVQSQ-LDCPLSR---LQLFPLTH-----------
A0A4X1UQ42_BMF-01       RRV-SADP-------FVQSQ-LDCPLSR---LQLFPLTH-----------
A0A4X1UQ42_BMF-02       RRV-SADP-------FVQSQ-LDCPLSR---LQLFPLTH-----------
A0A7N5JI49_BMF-03       GSLLSADL-------FAQSQ-LDCPLSR---LHLFPLTH-----------
A0A671DWL6_BMF-02       GSLPSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A286XXB0_BMF-03       GSLLSADL-------FAQSQ-LDCPLGR---LHLFPLTH-----------
A0A287CXH0_BMF-02       GSLLSADL-------FAQSQ-LDCPLSR---LQLFPLTH-----------
A0A3Q2GRS5_BCL2L11      ARTRRSEG-------KGRI-------------------------------
A0A3Q2GRS5_BCL2L11      ARTRRSEG-------KGRI-------------------------------
A0A7M4F197_BCL2L11      RSAPVGTA-------GGFWSVEKGSALL---SYFFVCLF-----------
A0A673J9C6_BAD-01       E--------------------RERKRER---GKILELLL-----------
F7GL32_BBC3-01          ---------------------SPRTFPL---GRLMPSAV-----------
A0A480SCP6_BBC3-04      ---------------------GPRPFPL---SRLVPSAV-----------
A0A4W5JLL9_BAD-02       SPLSLC---------------PLSFISL---YPLSPHLF-----------
A0A3Q7S5V2_BCL2L11      RCGGFAEL-------RRFFHWRDSAFSL---HRLRPRFQGGCSVRALLDV
A0A674DKC6_BAD-01       PLLSLSLS-------SPSPLSPPSPLSL---PLLSLSLS-----------
A0A287AEC6_BCL2L11      ASLSWAAG-------LRRFHFAPRSLQV---SSLQERLV-----------
A0A287AEC6_BCL2L11      ASLSWAAG-------LRRFHFAPRSLQV---SSLQERLV-----------
A0A287AEC6_BCL2L11      ASLSWAAG-------LRRFHFAPRSLQV---SSLQERLV-----------
A0A3B1JLM2_BAD-01       RDTLFRPL------------------------------------------
A0A4W4DXF5_BAD-01       -ETPSNTS------------------------------------------
A9XRH0_BMF-01           LHVPPVGF------------------------------------------
A0A803YBD7_BMF-02       LHVPPVGF------------------------------------------
A0A3P8YI30_BAD-01       QFCNTSTN------------------------------------------
A0A3B4DUY7_BAD-01       DSQHSMAS------------------------------------------
A0A4W3IWD3_BCL2L11      NFFRTPYS------------------------------------------
A0A4W3IWD3_BCL2L11      NFFRTPYS------------------------------------------
A0A4W3IWD3_BCL2L11      NFFRTPYS------------------------------------------
A0A3B4UNJ0_BMF-01       RDVKYEDR------------------------------------------
A0A3G3M2M0_BCL2L11      GNVPASRG------------------------------------------
A0A672PQD1_BCL2L11      G-----RG------------------------------------------
Q925D2_BIK-02           SGAPSMKE------------------------------------------
A0A3P9ICE1_BMF-01       RKIKCEDR------------------------------------------
A0A3B4B6Y3_BMF-01       RQIKCEDR------------------------------------------
A0A4W4DZH9_BMF-01       REIKQEER------------------------------------------
A0A3B1K1X5_BMF-01       SVIKQEER------------------------------------------
A0A3B4CNJ8_BMF-01       REIKQEER------------------------------------------
A0A3B3RH63_BMF-01       RDIKCENR------------------------------------------
W5N4P7_BMF-01           REIKYEDK------------------------------------------
A0A2U9CJH3_BMF-01       REIKCEDR------------------------------------------
A0A3Q2YCX7_BMF-01       KEIKCEER------------------------------------------
A0A3Q2YCX7_BMF-02       KEIKCEER------------------------------------------
A0A668TQU8_BMF-01       REIKCEHR------------------------------------------
A0A3Q3VLX6_BMF-01       REIKCEDR------------------------------------------
A0A3P8UA78_BMF-01       REIRCEDR------------------------------------------
A0A3P8UA78_BMF-03       REIRCEDR------------------------------------------
A0A3P8UA78_BMF-02       REIRCEDR------------------------------------------
A0A3B5KWG6_BMF-03       QEIKCEDR------------------------------------------
A0A3B5KWG6_BMF-01       QEIKCEDR------------------------------------------
A0A3B5KWG6_BMF-02       QEIKCEDR------------------------------------------
A0A3B3CGR9_BMF-01       RKIKCEDR------------------------------------------
A0A3B3HAU1_BMF-04       RKIKCEDR------------------------------------------
A0A3P9ICE1_BMF-04       RKIKCEDR------------------------------------------
A0A3P9K487_BMF-02       RKIKCEDR------------------------------------------
A0A3B3HAU1_BMF-01       RKIKCEDR------------------------------------------
A0A3B3HAU1_BMF-02       RKIKCEDR------------------------------------------
A0A3B3HAU1_BMF-03       RKIKCEDR------------------------------------------
A0A3P9ICE1_BMF-02       RKIKCEDR------------------------------------------
A0A3P9ICE1_BMF-05       RKIKCEDR------------------------------------------
A0A3P9ICE1_BMF-03       RKIKCEDR------------------------------------------
A0A3P9K487_BMF-01       RKIKCEDR------------------------------------------
A0A672HG10_BMF-01       REIKCEDR------------------------------------------
A0A673C8N3_BMF-01       REIKCEDR------------------------------------------
A0A3P8NFE2_BMF-02       REIKCEHR------------------------------------------
I3K2D6_BMF-01           REIKCEHR------------------------------------------
A0A3P8NFE2_BMF-01       REIKCEHR------------------------------------------
A0A3Q3C5V2_BMF-01       REIKCEHR------------------------------------------
A0A3P9DPJ5_BMF-01       REIKCEHR------------------------------------------
A0A3P9DPJ5_BMF-02       REIKCEHR------------------------------------------
A0A3B4ETH0_BMF-01       REIKCEHR------------------------------------------
A0A3Q4G1I4_BMF-01       REIKCEHR------------------------------------------
A0A3Q1FVH7_BMF-02       REIKCEDR------------------------------------------
A0A3Q1FVH7_BMF-01       REIKCEDR------------------------------------------
A0A3Q2ZA20_BMF-01       REIKCEDR------------------------------------------
A0A665VG08_BMF-01       REIKCEHR------------------------------------------
A0A3Q3RVI2_BMF-01       REIKCEDR------------------------------------------
A0A3Q1D1K3_BMF-01       REIKCEDR------------------------------------------
A0A3P8RKY9_BMF-01       REIKCEDR------------------------------------------
A0A3Q3RVI2_BMF-02       REIKCEDR------------------------------------------
A0A4W6DUL1_BMF-01       REIKCEDR------------------------------------------
A0A3Q1IPR4_BMF-01       REIKCQDR------------------------------------------
A0A0F8AD62_BMF-01       REIKCEDQ------------------------------------------
A0A671X848_BMF-01       REIKCEDR------------------------------------------
A0A667YNR9_BMF-01       REIKCEDR------------------------------------------
A0A3B4U5H8_BMF-01       REIKCEDR------------------------------------------
A0A3B4WM88_BMF-01       REIKCEDR------------------------------------------
A0A3Q3QZ16_BMF-01       REIKCEDR------------------------------------------
A0A3Q3QZ16_BMF-02       REIKCEDR------------------------------------------
A0A3Q2PJX9_BMF-01       REIKCEDR------------------------------------------
A0A3Q2PJX9_BMF-02       REIKCEDR------------------------------------------
A0A3Q2PJX9_BMF-03       REIKCEDR------------------------------------------
A0A3B5QK08_BMF-02       REIKCEDR------------------------------------------
A0A3B5QK08_BMF-01       REIKCEDR------------------------------------------
A0A096LRV0_BMF-01       REIKCEDR------------------------------------------
A0A3B3WU80_BMF-01       REIKCEDR------------------------------------------
A0A3P9Q8E2_BMF-01       REIKCEDR------------------------------------------
A0A3Q2CXC4_BMF-02       REIKFEDR------------------------------------------
A0A3Q2CXC4_BMF-01       REIKFEDR------------------------------------------
A0A3Q3GUU5_BMF-01       QEIKCEDR------------------------------------------
A0A3B5B8F6_BMF-01       REIKCEDR------------------------------------------
A0A1S3P5K4_BMF-01       REIKYEDR------------------------------------------
A0A1S3SNN2_BMF-01       REIKYEDR------------------------------------------
A0A674EF64_BMF-01       REIKYEDR------------------------------------------
A0A4W5N3A7_BMF-01       REIKYEDR------------------------------------------
A0A4W5N721_BMF-01       REIKYEDR------------------------------------------
A0A1S3P5K4_BMF-02       REIKYEDR------------------------------------------
A0A6F9B4C5_BMF-01       REIKYEDR------------------------------------------
A0A6F9BGV6_BMF-01       REIKYEDR------------------------------------------
A0A3P8ZIE7_BMF-01       REIKYEDR------------------------------------------
A0A673YQV3_BMF-01       REIKYEDR------------------------------------------
A0A673CKA1_BCL2L11      GPTGEGRE------------------------------------------
A0A4W4H3Y1_BCL2L11      SRPEQFDC------------------------------------------
A0A3B4BSH7_BCL2L11      RAAEQCEQ------------------------------------------
Q0GKC7_BMF-01           L-------------------------------------------------
A0A673HDR4_BMF-01       T-------------------------------------------------
A0A672JWL9_BMF-02       T-------------------------------------------------
A0A671MNR9_BMF-01       T-------------------------------------------------
A0A672JWL9_BMF-01       T-------------------------------------------------
A0A3B4CPH6_BAD-01       QESGAVRH------------------------------------------
M3XHJ5_BCL2L11-01       ISECGHLH------------------------------------------
A0A671M0H4_BMF-01       T-------------------------------------------------
A0A671M0H4_BMF-02       T-------------------------------------------------
A0A2K5QXZ1_BIK-01       EVVGGGSD------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           SGAPSMKE------------------------------------------
O70337_BIK-03           SETPSMKE------------------------------------------
O70337_BIK-01           SETPSMKE------------------------------------------
O70337_BIK-02           SETPSMKE------------------------------------------
G1TZR9_BIK-01           AEVPGLTR------------------------------------------
H0XAE7_BIK-01           E-VLGMTE------------------------------------------
A0A2K6FM79_BIK-01       E-VLSIMD------------------------------------------
A0A2K5CLG5_BIK-01       E-VVGGSD------------------------------------------
A0A2K6TBD7_BIK-01       E-VVGGSD------------------------------------------
G1S1X2_BIK-01           E-VLGVTD------------------------------------------
H2P4N6_BIK-01           E-VLGVTD------------------------------------------
G3QCT2_BIK-01           E-VLGVTD------------------------------------------
A0A2R8ZXD2_BIK-01       E-VLGVTE------------------------------------------
H2QLU7_BIK-01           E-VLGVTD------------------------------------------
Q13323_BIK-01           E-VLGMTD------------------------------------------
A0A2K6MCW0_BIK-01       E-VLGVTD------------------------------------------
A0A2K6QK74_BIK-01       E-VLGVTD------------------------------------------
A0A0D9QZY8_BIK-01       E-VLGVTD------------------------------------------
F6SUD3_BIK-01           E-VLGVTD------------------------------------------
A0A2K6DBJ4_BIK-01       E-VLGVTD------------------------------------------
A0A2K5J4Q7_BIK-01       E-VLGVTD------------------------------------------
A0A096NKG5_BIK-01       E-VLGVTD------------------------------------------
A0A2K5LDM6_BIK-01       E-VLGVTD------------------------------------------
A0A2K5XSA1_BIK-01       E-VLGVTD------------------------------------------
H0W025_BIK-01           EGALGVTQ------------------------------------------
A0A2K5VW94_BIK-01       E-VLGVTD------------------------------------------
G1MV54_BCL2L11-01       AHRTASLD------------------------------------------
C1C3S9_BAD-01           TERG--SA------------------------------------------
A0A452IFQ4_BAD-01       SQRGHTPG------------------------------------------
A0A674I2R9_BAD-01       SQRGHTPG------------------------------------------
A0A672TST9_BCL2L11      -EGPGPAA------------------------------------------
A0A674H354_BCL2L11      AEGPGPGA------------------------------------------
O43521_BCL2L11-13       AERP--PQ------------------------------------------
O43521_BCL2L11-16       AERP--PQ------------------------------------------
A0A7N4NUH6_BCL2L11      TERPTQPQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
A0A5F8H037_BCL2L11      TERPTQPQ------------------------------------------
A0A5F9C9V3_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A2Y9Q753_BCL2L11      AERP--PQ------------------------------------------
M3YDI3_BCL2L11-01       VERP--PQ------------------------------------------
F7HHA1_BCL2L11-02       AERP--PQ------------------------------------------
A0A096NYC3_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
F7HHA1_BCL2L11-03       AERP--PQ------------------------------------------
A0A096NYC3_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
A0A674IAI8_BCL2L11      IERPSQPQ------------------------------------------
A0A7N4NUH6_BCL2L11      TERPTQPQ------------------------------------------
A0A2K6GE22_BCL2L11      VERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-20       AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-07       AERP--PQ------------------------------------------
O43521_BCL2L11-22       AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
C1KGB8_BCL2L11-01       AERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A673SRF7_BCL2L11      AERP--PQ------------------------------------------
A0A2I2UX96_BCL2L11      AERP--PQ------------------------------------------
A0A667H9R7_BCL2L11      AERP--PQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
U6CTE3_BCL2L11-04       VERP--PQ------------------------------------------
A0A3Q2GRS5_BCL2L11      AERP--PQ------------------------------------------
A0A287AEC6_BCL2L11      AERP--PQ------------------------------------------
A0A4X1VMQ3_BCL2L11      AERP--PQ------------------------------------------
A0A671FCV3_BCL2L11      AERP--PQ------------------------------------------
O54918_BCL2L11-06       AERP--PQ------------------------------------------
O54918_BCL2L11-08       AERP--PQ------------------------------------------
O54918_BCL2L11-05       AERP--PQ------------------------------------------
C1KGB7_BCL2L11-01       AERP--PQ------------------------------------------
U6CTE3_BCL2L11-03       VERP--PQ------------------------------------------
A0A0D9RWE0_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-09       AERP--PQ------------------------------------------
O43521_BCL2L11-14       AERP--PQ------------------------------------------
A0A3Q1MV27_BCL2L11      AERP--PQ------------------------------------------
A0A2K6GE22_BCL2L11      VERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A286XJN2_BCL2L11      AERP--SQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-04       AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2Y9T3Y6_BCL2L11      AERP--PQ------------------------------------------
A0A452SBG5_BCL2L11      AERP--PQ------------------------------------------
A0A4X1VMQ3_BCL2L11      AERP--PQ------------------------------------------
A0A2I2UX96_BCL2L11      AERP--PQ------------------------------------------
A0A667H9R7_BCL2L11      AERP--PQ------------------------------------------
A0A3Q7S5V2_BCL2L11      AERP--PQ------------------------------------------
G3H020_BCL2L11-01       AERP--PQ------------------------------------------
A0A287DFJ0_BCL2L11      AERP--PQ------------------------------------------
A0A4W2D2G6_BCL2L11      AERP--PQ------------------------------------------
A0A4W2G3J8_BCL2L11      AERP--PQ------------------------------------------
L8IVA4_BCL2L11-01       AERP--PQ------------------------------------------
A0A3Q1MV27_BCL2L11      AERP--PQ------------------------------------------
A0A4W2D2G6_BCL2L11      AERP--PQ------------------------------------------
A0A4W2G3J8_BCL2L11      AERP--PQ------------------------------------------
A0A452FCR6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-23       AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-03       AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
A0A096NYC3_BCL2L11      AERP--PQ------------------------------------------
O54918_BCL2L11-03       AERP--PQ------------------------------------------
A0A452U4S4_BCL2L11      AERP--PQ------------------------------------------
A0A3Q2GRS5_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-17       AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A096NYC3_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-02       AERP--PQ------------------------------------------
O43521_BCL2L11-15       AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A673SRF7_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-01       AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-08       AERP--PQ------------------------------------------
O43521_BCL2L11-21       AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-12       AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-06       AERP--PQ------------------------------------------
O43521_BCL2L11-18       AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A667H9R7_BCL2L11      AERP--PQ------------------------------------------
A0A671FCV3_BCL2L11      AERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A2K6GE22_BCL2L11      VERP--PQ------------------------------------------
A0A2K6GE22_BCL2L11      VERP--PQ------------------------------------------
O54918_BCL2L11-01       AERP--PQ------------------------------------------
G3H020_BCL2L11-02       AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
F7HHA1_BCL2L11-01       AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-05       AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A2K6GE22_BCL2L11      VERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5CA52_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Q1U2_BCL2L11      AERP--PQ------------------------------------------
A0A2R8M6L7_BCL2L11      AERP--PQ------------------------------------------
A0A2K6TRJ7_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A096NYC3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-11       AERP--PQ------------------------------------------
O43521_BCL2L11-19       AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5NTQ5_BCL2L11      AERP--PQ------------------------------------------
A0A2K5HZ87_BCL2L11      AERP--PQ------------------------------------------
A0A2K5X1Y3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6E1Z6_BCL2L11      AERP--PQ------------------------------------------
A0A2K5Z7V3_BCL2L11      AERP--PQ------------------------------------------
A0A096NYC3_BCL2L11      AERP--PQ------------------------------------------
A0A2K6KJM8_BCL2L11      AERP--PQ------------------------------------------
A0A2K6QIJ1_BCL2L11      AERP--PQ------------------------------------------
A0A2I2Y4B3_BCL2L11      AERP--PQ------------------------------------------
O43521_BCL2L11-10       AERP--PQ------------------------------------------
A0A2I3GAA1_BCL2L11      AERP--PQ------------------------------------------
A0A2R9BZX9_BCL2L11      AERP--PQ------------------------------------------
A0A2I3S5F6_BCL2L11      AERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A1U7SU38_BCL2L11      AERP--PQ------------------------------------------
A0A4X1VMQ3_BCL2L11      AERP--PQ------------------------------------------
C1KGB6_BCL2L11-01       AERP--PQ------------------------------------------
A0A3Q2GRS5_BCL2L11      AERP--PQ------------------------------------------
A0A673SRF7_BCL2L11      AERP--PQ------------------------------------------
A0A671FCV3_BCL2L11      AERP--PQ------------------------------------------
A0A2Y9T3Y6_BCL2L11      AERP--PQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
U6CTE3_BCL2L11-02       VERP--PQ------------------------------------------
A0A4X1VMQ3_BCL2L11      AERP--PQ------------------------------------------
A0A2I2UX96_BCL2L11      AERP--PQ------------------------------------------
A0A667H9R7_BCL2L11      AERP--PQ------------------------------------------
A0A287DFJ0_BCL2L11      AERP--PQ------------------------------------------
A0A2K6GE22_BCL2L11      VERP--PQ------------------------------------------
A0A5F9C9V3_BCL2L11      AERP--PQ------------------------------------------
A0A4W2D2G6_BCL2L11      AERP--PQ------------------------------------------
A0A4W2G3J8_BCL2L11      AERP--PQ------------------------------------------
L8IVA4_BCL2L11-02       AERP--PQ------------------------------------------
A0A3Q1MV27_BCL2L11      AERP--PQ------------------------------------------
A0A4W2D2G6_BCL2L11      AERP--PQ------------------------------------------
A0A4W2G3J8_BCL2L11      AERP--PQ------------------------------------------
A0A452FCR6_BCL2L11      AERP--PQ------------------------------------------
W5PY58_BCL2L11-01       AERP--PQ------------------------------------------
A0A286XJN2_BCL2L11      AERP--SQ------------------------------------------
A0A286XJN2_BCL2L11      AERP--SQ------------------------------------------
H0XW23_BCL2L11-01       AERP--PQ------------------------------------------
A0A671FCV3_BCL2L11      AERP--PQ------------------------------------------
A0A2Y9Q753_BCL2L11      AERP--PQ------------------------------------------
A0A2Y9T3Y6_BCL2L11      AERP--PQ------------------------------------------
U6CTE3_BCL2L11-01       VERP--PQ------------------------------------------
A0A4X1VMQ3_BCL2L11      AERP--PQ------------------------------------------
A0A673SRF7_BCL2L11      AERP--PQ------------------------------------------
A0A7N5JE15_BCL2L11      AERP--PQ------------------------------------------
A0A2I2UX96_BCL2L11      AERP--PQ------------------------------------------
A0A667H9R7_BCL2L11      AERP--PQ------------------------------------------
U3IW89_BCL2L11-01       RA------------------------------------------------
A0A3Q2U844_BCL2L11      GEGPGPAV------------------------------------------
A0A669QMB4_BCL2L11      GEGPGPAV------------------------------------------
A0A2K6E1Z6_BCL2L11      AER---PP------------------------------------------
A0A5F8H037_BCL2L11      TERPTQPQ------------------------------------------
A0A4X2L9J9_BCL2L11      TERPTQPQ------------------------------------------
A0A7N4NUH6_BCL2L11      TERPTQP-------------------------------------------
A0A7N4NUH6_BCL2L11      TERPTQP-------------------------------------------
G3SU55_BCL2L11-01       AERPPQPP------------------------------------------
A0A670KEZ9_BCL2L11      AERPAQ--------------------------------------------
A0A670Y3D3_BCL2L11      AERPAQPH------------------------------------------
A0A6I8NCK5_BCL2L11      AEGPAQPP------------------------------------------
A0A6I8NCK5_BCL2L11      AEGPAQPP------------------------------------------
A0A6I8NCK5_BCL2L11      AEGPAQPP------------------------------------------
A0A6I8NCK5_BCL2L11      AEGPAQPP------------------------------------------
A0A6I8NCK5_BCL2L11      AEGPAQPP------------------------------------------
A0A667ZMY7_BCL2L11      AAPA--NE------------------------------------------
A0A2I2YVQ5_PMAIP1-      PSPA--RA------------------------------------------
A0A2I3SX38_PMAIP1-      PSPA--RA------------------------------------------
H2NWG2_PMAIP1-01        PSPA--RA------------------------------------------
A0A2I3HX97_PMAIP1-      PSPA--PA------------------------------------------
A0A2K5JY17_PMAIP1-      PSPA--RA------------------------------------------
A0A2K5NJZ2_PMAIP1-      PSPM--RA------------------------------------------
A0A2K5ZWH1_PMAIP1-      PSPT--RA------------------------------------------
A0A2K5VPX2_PMAIP1-      PSPT--RA------------------------------------------
A0A2K6BV43_PMAIP1-      PSPT--RA------------------------------------------
A0A2K6KJF1_PMAIP1-      PSPA--RA------------------------------------------
A0A2K6NC45_PMAIP1-      PSPA--RA------------------------------------------
Q13794_PMAIP1-02        PSPA--RA------------------------------------------
A0A2R9AKC9_PMAIP1-      PSPA--RA------------------------------------------
A0A3P8RLE2_BCL2L11      RTPS--LV------------------------------------------
A0A7M4F197_BCL2L11      SQHS--KF------------------------------------------
K7GA86_BCL2L11-01       GADS--ER------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       WSSE--EA------------------------------------------
A0A4W4HE29_BAD-01       VSYR--EF------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       FDFP--QP------------------------------------------
B8JK68_BCL2L11-01       FDFP--QP------------------------------------------
A0A671M057_BCL2L11      FDFP--QP------------------------------------------
A0A672L1R2_BCL2L11      FDFP--QP------------------------------------------
A0A671SJ75_BCL2L11      FDFP--QP------------------------------------------
A0A673IWZ7_BCL2L11      FDFP--QP------------------------------------------
A0A3Q1ELG4_BCL2L11      SAAS--PA------------------------------------------
A0A3Q1CI15_BCL2L11      KSGP--DA------------------------------------------
A0A3B4BSH7_BCL2L11      CEQP--EP------------------------------------------
A0A3B4BSH7_BCL2L11      CEQP--EP------------------------------------------
A0A3B1JXK6_BCL2L11      CEQP--EP------------------------------------------
A0A4W4H3Y1_BCL2L11      FDCS--HP------------------------------------------
A0A4W5NF23_BCL2L11      SDNP--QS------------------------------------------
A0A4W5R3N6_BCL2L11      TDIP--QF------------------------------------------
A0A1S3SAH9_BCL2L11      TDNP--QF------------------------------------------
A0A673WET2_BCL2L11      TDNP--QF------------------------------------------
A0A3P8XIA2_BCL2L11      SDYP--QS------------------------------------------
A0A673XGV4_BCL2L11      SDNP--QS------------------------------------------
A0A4W5R3N6_BCL2L11      TDIP--QF------------------------------------------
A0A4W5R3N6_BCL2L11      TDIP--QF------------------------------------------
A0A3Q3FKT9_BAD-01       EVKE--EE------------------------------------------
A0A3B1IH05_BAD-01       QPEV--SK------------------------------------------
A0A3B3QC78_BCL2L11      SRNP--VA------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      AEVT--LG------------------------------------------
A0A674AVP9_BAD-01       HTHD--CV------------------------------------------
A0A1S3L0Z2_BAD-01       YTHD--CV------------------------------------------
B5XEF1_BAD-01           YTHD--CV------------------------------------------
A0A4W5MZR2_BAD-01       HTHD--CV------------------------------------------
A0A060W8W7_BAD-01       HIHD--CV------------------------------------------
E7FBJ6_BAD-01           HQDD--SS------------------------------------------
A0A673J5Q9_BAD-01       HQDD--SS------------------------------------------
A0A671PX91_BAD-01       HQDD--SS------------------------------------------
A0A672LB88_BAD-01       HQDD--SS------------------------------------------
A0A673I6H5_BAD-01       HQYD--SS------------------------------------------
A0A671SBB4_BAD-01       HQND--SS------------------------------------------
A0A672R7P6_BAD-01       HRND--SS------------------------------------------
A0A3P8Y761_BAD-02       FCLI--TI------------------------------------------
A0A3Q2QC80_BAD-01       NDQP--AD------------------------------------------
A0A4W6EMZ7_BAD-02       MNQS--ST------------------------------------------
A0A3Q3FKT9_BAD-02       NDQS--SA------------------------------------------
A0A3Q3FKT9_BAD-03       NDQS--SA------------------------------------------
A0A3B5L9R9_BAD-01       DLQL--MQ------------------------------------------
A0A667ZNC6_BAD-01       TDKS--LN------------------------------------------
A0A3P9B2E4_BAD-01       NQQS--AG------------------------------------------
A0A668V3Q4_BAD-01       NQQP--AG------------------------------------------
I3K7B6_BAD-01           NQQP--AG------------------------------------------
A0A3Q3C680_BAD-01       NQQS--AG------------------------------------------
A0A3P8QRJ7_BAD-01       NQQS--AG------------------------------------------
A0A3Q4GGN3_BAD-01       NQQS--AR------------------------------------------
A0A3B4GXJ6_BAD-01       NQQS--AG------------------------------------------
A0A3Q2D5S0_BAD-01       NKEP--RI------------------------------------------
A0A3Q0QNQ2_BAD-01       WGTP--RH------------------------------------------
A0A3P8WI83_BAD-02       IKHS--LN------------------------------------------
A0A3P8WI83_BAD-01       IKHS--LN------------------------------------------
A0A3P9HNZ2_BAD-01       LDLG--AA------------------------------------------
A0A3B3BQF7_BAD-01       LDLA--AS------------------------------------------
A0A672JQ68_BAD-01       TNE----T------------------------------------------
A0A2U9BAC9_BAD-01       VSQP--WT------------------------------------------
A0A4W6EMZ7_BAD-01       MNQS--ST------------------------------------------
A0A3B4VFC5_BAD-01       MSQS--LT------------------------------------------
A0A3B4W9T1_BAD-01       MSQS--LT------------------------------------------
A0A3Q1K1C7_BAD-01       HNQS--PP------------------------------------------
A0A672YF93_BAD-01       RRQP--PT------------------------------------------
A0A3Q1GWH9_BAD-01       NNHS--PA------------------------------------------
A0A3Q1CPU7_BAD-01       NNHS--PA------------------------------------------
A0A3P8TWH6_BAD-01       NNHS--PA------------------------------------------
H3D8J8_BAD-01           RGSF--ST------------------------------------------
A0A6F9CQZ0_BAD-02       KDKS--AA------------------------------------------
A0A6F9CA11_BAD-02       TDQS--AA------------------------------------------
A0A1S3N9Q3_BAD-01       NDQS--SA------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       LDHL--GT------------------------------------------
A0A4W5R1T6_BAD-01       SDHS--GT------------------------------------------
A0A060W8P9_BAD-01       SDHS--GT------------------------------------------
B5X1T1_BAD-01           SDHS--GT------------------------------------------
A0A673ZHY7_BAD-01       SDHS--GT------------------------------------------
A0A671NP27_BAD-01       SDLT--KN------------------------------------------
A0A672SAE4_BAD-01       SDLT--KN------------------------------------------
A0A672SAE4_BAD-02       SDLT--KN------------------------------------------
A0A671RUV0_BAD-01       SGQA--KN------------------------------------------
A0A673HRQ3_BAD-01       SGQV--KN------------------------------------------
A0A672RGH0_BAD-01       SGQV--KN------------------------------------------
Q4V925_BAD-02           SSLD--KH------------------------------------------
Q4V925_BAD-03           SSLD--KH------------------------------------------
A7MCM4_BAD-01           SSLD--KH------------------------------------------
Q4V925_BAD-01           SSLD--KH------------------------------------------
Q4V925_BAD-04           SSLD--KH------------------------------------------
A0A3B3QX41_BAD-01       VTAN--SQ------------------------------------------
A0A3Q3RXS8_BAD-01       GKQK--KS------------------------------------------
A0A3Q0QNQ2_BAD-02       GQSP--FR------------------------------------------
A0A3Q3WTY4_BAD-01       GENS--QL------------------------------------------
A0A3P8Y761_BAD-01       ETKK--EW------------------------------------------
A0A4W5JLL9_BAD-01       TEKD--QL------------------------------------------
A0A3B5Q2N7_BAD-01       RGDL--QL------------------------------------------
A0A087X8P8_BAD-01       RGNL--QL------------------------------------------
A0A3B3UA11_BAD-01       RGNL--QL------------------------------------------
A0A3B3YFR1_BAD-01       RGNL--QL------------------------------------------
A0A3P9Q7C3_BAD-01       RGNL--QL------------------------------------------
A0A3B3HDU2_BAD-01       GKLD--LG------------------------------------------
A0A3P9KSL7_BAD-02       GKLD--LG------------------------------------------
A0A3P9KSL7_BAD-01       GKLD--LG------------------------------------------
A0A3B5BAL2_BAD-01       GENN--HP------------------------------------------
A0A665TUH3_BAD-01       GDMS--QS------------------------------------------
A0A674MXC1_BAD-04       GERN--SS------------------------------------------
A0A674MXC1_BAD-01       GERN--SS------------------------------------------
A0A674MXC1_BAD-02       GERN--SS------------------------------------------
A0A674MXC1_BAD-03       GERN--SS------------------------------------------
A0A671TL42_BAD-01       GEHS--QS------------------------------------------
A0A3Q3AEL8_BAD-01       GKSK--QP------------------------------------------
A0A3Q3AEL8_BAD-02       GKSK--QP------------------------------------------
A0A1A8AQV0_BAD-01       GEKK--QP------------------------------------------
G3Q8B3_BAD-01           REDG--QL------------------------------------------
A0A3Q2Y0E4_BAD-01       GDDG--QG------------------------------------------
A0A3Q3R5S3_BAD-01       GKHS--QS------------------------------------------
F7GL32_BBC3-02          GSSP--EP------------------------------------------
A0A4X2LVY2_BBC3-01      GSSR--EP------------------------------------------
A0A4X2LVY2_BBC3-02      GSSR--EP------------------------------------------
A0A3Q3ESW6_BCL2L11      GTRG--DP------------------------------------------
A0A3P9N073_BCL2L11      ------DP------------------------------------------
A0A3Q3B113_BCL2L11      GSSG--GA------------------------------------------
A0A3B5M375_BCL2L11      GTGG--DP------------------------------------------
A0A3B5QAM1_BCL2L11      GTGG--DP------------------------------------------
A0A3B5QAM1_BCL2L11      GTGG--DP------------------------------------------
A0A672RK14_BMF-01       NRDG--RG------------------------------------------
A0A673JJ10_BMF-01       NRDG--PR------------------------------------------
A0A4W6ETK4_BCL2L11      TTKP--VR------------------------------------------
A0A4W6ETK4_BCL2L11      ESGG--DP------------------------------------------
A0A4W6ETK4_BCL2L11      ESGG--DP------------------------------------------
A0A3B4V919_BCL2L11      TTKP--VR------------------------------------------
A0A3B4XZH1_BCL2L11      TTKP--VR------------------------------------------
A0A3Q2SZH6_BCL2L11      GTGG--DP------------------------------------------
A0A3B3VNE0_BCL2L11      GTGG--DP------------------------------------------
A0A3B3YII5_BCL2L11      GTGG--DP------------------------------------------
A0A3B3YII5_BCL2L11      GTGG--DP------------------------------------------
A0A3Q3K6I5_BCL2L11      ES-G--DP------------------------------------------
A0A3Q1ICY2_BCL2L11      ESGG--DP------------------------------------------
A0A671W556_BCL2L11      GSGG--DP------------------------------------------
A0A6I8NF73_BMF-01       PVAE--SL------------------------------------------
Q9GL49_PMAIP1-01        GSLG--SR------------------------------------------
A0A5F8GA49_BAD-01       GSE-----------------------------------------------
H3ANP3_BAD-03           RTGP--LP------------------------------------------
H3ANP3_BAD-01           RTGP--LP------------------------------------------
H3ANP3_BAD-02           RTGP--LP------------------------------------------
H3ANP3_BAD-04           RTGP--LP------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       PKED--GF------------------------------------------
A0A672V9F8_BAD-01       PVP-----------------------------------------------
A0A674GQ16_BAD-01       PSPW--GG------------------------------------------
A0A6I8NVP2_BAD-01       VCTP----------------------------------------------
G3TP47_BAD-01           STPA--DR------------------------------------------
Q61337_BAD-05           ASAT--DR------------------------------------------
Q61337_BAD-06           ASAT--DR------------------------------------------
Q61337_BAD-03           ASAT--DR------------------------------------------
Q61337_BAD-04           ASAT--DR------------------------------------------
Q61337_BAD-02           ASAT--DR------------------------------------------
Q61337_BAD-01           ASAT--DR------------------------------------------
A0A287CT05_BAD-01       SSSA--EG------------------------------------------
A0A287CT05_BAD-02       SSSA--EG------------------------------------------
G5B6Q3_BAD-01           SSSE--ER------------------------------------------
G5B6Q3_BAD-02           SSSE--ER------------------------------------------
G1P8C5_BAD-01           SSPA--DR------------------------------------------
A0A452ER54_BAD-02       SSPA--DR------------------------------------------
W5P8G9_BAD-01           SSPA--DR------------------------------------------
Q61337_BAD-07           ASAT--DR------------------------------------------
H0WVR2_BAD-01           SSSS--DR------------------------------------------
A0A2K6GWV0_BAD-01       SSSA--GR------------------------------------------
F7DN67_BAD-01           SSPA--DR------------------------------------------
Q45KI9_BAD-01           SSPA--NR------------------------------------------
A0A3Q7SWS0_BAD-01       SSPA--NR------------------------------------------
B4DZQ9_BAD-01           SSSA--ER------------------------------------------
A0A2J8TYJ3_BAD-02       SSSA--ER------------------------------------------
A0A2I2YFH2_BAD-02       SSSA--ER------------------------------------------
A0A2I2YFH2_BAD-01       SSSA--ER------------------------------------------
Q92934_BAD-01           SSSA--ER------------------------------------------
Q92934_BAD-02           SSSA--ER------------------------------------------
A0A2I3TBK7_BAD-02       SSSA--ER------------------------------------------
A0A2R8Z674_BAD-01       SSSA--ER------------------------------------------
A0A2J8TYJ3_BAD-03       SSSA--ER------------------------------------------
H0V608_BAD-01           SSSE--ER------------------------------------------
A0A2K5PDB1_BAD-01       SSSA--ER------------------------------------------
U3F2S3_BAD-01           SSSA--ER------------------------------------------
A0A2K5E6A6_BAD-01       SSSA--ER------------------------------------------
A0A2K6TG62_BAD-01       SSSA--ER------------------------------------------
A0A2K5M0A7_BAD-01       SSSA--ER------------------------------------------
A0A1D5QBW1_BAD-01       SSSA--ER------------------------------------------
A0A2K6E7I4_BAD-01       SSSA--ER------------------------------------------
A0A2K5XJR2_BAD-01       SSSA--ER------------------------------------------
A0A2K6N196_BAD-01       SSSA--ER------------------------------------------
A0A2K6PUL3_BAD-01       SSSA--ER------------------------------------------
A0A2K5HKU7_BAD-01       SSSA--ER------------------------------------------
A0A0D9R491_BAD-01       SSSA--ER------------------------------------------
A0A2K5VCA1_BAD-01       SSSA--ER------------------------------------------
A0A4X1VE31_BAD-02       SSPA--DR------------------------------------------
A0A4X1VE31_BAD-01       SSPA--DR------------------------------------------
A0A287AEF3_BAD-01       SSPA--DR------------------------------------------
A0A4X1VE31_BAD-03       SSPA--DR------------------------------------------
A0A671ELU4_BAD-01       SSPA--DR------------------------------------------
A0A452ER54_BAD-01       SSPA--DR------------------------------------------
A0A452RJM6_BAD-01       SSPA--DR------------------------------------------
A0A384DJL2_BAD-01       SSPA--DR------------------------------------------
M3YNE7_BAD-01           SSPA--DR------------------------------------------
A0A667H8Z9_BAD-01       SSPT--DR------------------------------------------
A0A673V6P8_BAD-01       SSPT--DR------------------------------------------
A0A4W2C9A8_BAD-01       SSPA--DR------------------------------------------
A0A4W2C9A8_BAD-01       SSPA--DR------------------------------------------
F1MUT9_BAD-01           SSPA--DR------------------------------------------
Q3SYZ0_BAD-01           SSRA--DR------------------------------------------
A0A4U1FMC3_BAD-01       SSPA--DR------------------------------------------
A0A2Y9EHU3_BAD-01       SSPA--DR------------------------------------------
A0A2I3TBK7_BAD-01       SSSA--ER------------------------------------------
A0A2R8Z674_BAD-02       SSSA--ER------------------------------------------
A0A2I2YFH2_BAD-03       SSSA--ER------------------------------------------
Q92934_BAD-03           SSSA--ER------------------------------------------
A0A2K5M0A7_BAD-02       SSSA--ER------------------------------------------
A0A2K5XJR2_BAD-02       SSSA--ER------------------------------------------
A0A2K6E7I4_BAD-02       SSSA--ER------------------------------------------
A0A2K5PDB1_BAD-02       SSSA--ER------------------------------------------
A0A2K5E6A6_BAD-02       SSSA--ER------------------------------------------
A0A2K6TG62_BAD-02       SSSA--ER------------------------------------------
A0A2K5HKU7_BAD-02       SSSA--ER------------------------------------------
A0A2K6N196_BAD-02       SSSA--ER------------------------------------------
A0A2K6PUL3_BAD-02       SSSA--ER------------------------------------------
A0A2J8TYJ3_BAD-01       SSSA--ER------------------------------------------
A0A2K5M0A7_BAD-03       SSSA--ER------------------------------------------
A0A2K5XJR2_BAD-03       SSSA--ER------------------------------------------
A0A2K6E7I4_BAD-03       SSSA--ER------------------------------------------
A0A2I2YFH2_BAD-04       SSSA--ER------------------------------------------
Q92934_BAD-04           SSSA--ER------------------------------------------
A0A2I3TBK7_BAD-03       SSSA--ER------------------------------------------
A0A2R8Z674_BAD-03       SSSA--ER------------------------------------------
A0A2K5E6A6_BAD-03       SSSA--ER------------------------------------------
A0A2K5PDB1_BAD-03       SSSA--ER------------------------------------------
A0A2K6TG62_BAD-03       SSSA--ER------------------------------------------
A0A2K6KS56_BBC3-01      GSSP--GP------------------------------------------
A0A2I3RGH5_BBC3-04      GQLP--GA------------------------------------------
A0A2K5F6X4_BBC3-03      GQLP--GA------------------------------------------
A0A2K6FQZ1_BBC3-02      GQLP--GA------------------------------------------
A0A671F3X5_BBC3-01      GQLP--GA------------------------------------------
A0A5F5PGZ4_BBC3-01      GQLP--GA------------------------------------------
A0A2I3HWI8_BBC3-02      GQLP--GA------------------------------------------
A0A2K5QNS7_BBC3-01      GQLP--GA------------------------------------------
A0A2K5P2T8_BBC3-01      GQLS--GA------------------------------------------
A0A2K6QZT2_BBC3-02      GQLP--GA------------------------------------------
A0A2K6ASP2_BBC3-01      GQLP--GA------------------------------------------
A0A2I3N2Z9_BBC3-01      GQLP--GA------------------------------------------
Q9BXH1_BBC3-03          GQLP--GA------------------------------------------
A0A2I3RGH5_BBC3-02      GQLP--GA------------------------------------------
H2NZD3_BBC3-01          GQLP--GA------------------------------------------
M3Y0R3_BBC3-01          GSSP--EP------------------------------------------
B2RVL4_BBC3-01          GSSP--EP------------------------------------------
Q99ML1_BBC3-02          GSSP--EP------------------------------------------
Q80ZG6_BBC3-01          GSSP--EP------------------------------------------
H0XQ00_BBC3-01          GSSP--EP------------------------------------------
A0A4X1VVX9_BBC3-02      GSSP--EP------------------------------------------
A0A4W2EKD9_BBC3-02      GSSP--EP------------------------------------------
A0A3Q1LXZ6_BBC3-01      GSSP--EP------------------------------------------
A0A4W2EKD9_BBC3-02      GSSP--EP------------------------------------------
A0A452E3G1_BBC3-01      GSSP--EP------------------------------------------
A0A2Y9PEE3_BBC3-01      GSSP--EP------------------------------------------
A0A337SJI7_BBC3-01      GSSP--EP------------------------------------------
A0A667IM83_BBC3-01      GSSP--EP------------------------------------------
A0A480SCP6_BBC3-03      GSSP--EP------------------------------------------
A0A2K6FQZ1_BBC3-01      GSSP--EP------------------------------------------
Q9BXH1_BBC3-06          GSSP--EP------------------------------------------
A0A2I3RGH5_BBC3-01      GSSP--EP------------------------------------------
A0A2K6QZT2_BBC3-01      GSSP--EP------------------------------------------
A0A0D9S2H2_BBC3-01      GSSP--EP------------------------------------------
B4DQK3_BBC3-01          GSSP--EP------------------------------------------
Q99ML1_BBC3-01          GSSP--EP------------------------------------------
Q99ML1_BBC3-03          GSSP--EP------------------------------------------
G3T2N1_BBC3-01          GSSP--EP------------------------------------------
A0A5F9DGT6_BBC3-01      GSSP--EP------------------------------------------
A0A480SCP6_BBC3-02      GSSP--EP------------------------------------------
A0A7N5KJL4_BBC3-02      GSSP--EP------------------------------------------
A0A7N5KJL4_BBC3-01      GSSP--EP------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           DLCFQDLQ------------------------------------------
Q9JM54_PMAIP1-01        RAELPPEF------------------------------------------
A3KND0_BMF-01           QSYTCLLG------------------------------------------
A0A669QIC6_PMAIP1-      ------MP------------------------------------------
A0A4X1TQ35_PMAIP1-      CCFSSSLP------------------------------------------
F1SMU1_PMAIP1-01        CCFSSSLP------------------------------------------
A0A667HYB7_PMAIP1-      SSLVELGP------------------------------------------
A0A671EYM5_PMAIP1-      SAVSSRLP------------------------------------------
Q6P7C5_BAD-01           QPSLAPAH------------------------------------------
A0A663E970_BCL2L11      PPAEGPGP------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       GTFRARSR------------------------------------------
A0A670YRG7_BAD-01       GAFRARSR------------------------------------------
A0A2K5F6X4_BBC3-01      CQVP-RAS------------------------------------------
A0A673UKJ9_BBC3-02      WKV--GAS------------------------------------------
A0A2K6FQZ1_BBC3-03      CQVP-GTS------------------------------------------
A0A671F3X5_BBC3-03      CQVP-RLP------------------------------------------
A0A2K6STD6_BBC3-01      CQVP-RAS------------------------------------------
A0A2K5P2T8_BBC3-02      CQVP-RAA------------------------------------------
A0A2K6ASP2_BBC3-02      CQVP-RAS------------------------------------------
A0A2K6QZT2_BBC3-03      CQVP-RAS------------------------------------------
A0A2K5QNS7_BBC3-03      CQVP-RAS------------------------------------------
A0A2I3HWI8_BBC3-01      CQVP-RAS------------------------------------------
Q9BXH1_BBC3-04          CQVP-RAA------------------------------------------
A0A2R9BZA9_BBC3-02      CQVP-RAA------------------------------------------
A0A2I3RGH5_BBC3-05      CQVP-RAA------------------------------------------
A0A2K6KS56_BBC3-02      RTWS-RGA------------------------------------------
Q2PG01_BAD-01           SPFRGRSR------------------------------------------
A0A2I3H4B2_BAD-01       SPFRGRSR------------------------------------------
Q92934_BAD-06           SPFRGRSR------------------------------------------
Q92934_BAD-05           SPFRGRSR------------------------------------------
P62816_HRK-03           CPRH-RGR------------------------------------------
P62817_HRK-01           CPRH-RGR------------------------------------------
A0A4X1TMB1_HRK-01       CPLH-RGR------------------------------------------
A0A2K5KZ69_HRK-01       CPLH-RGR------------------------------------------
H2NIS8_HRK-01           CPLH-RDR------------------------------------------
H2Q6Y8_HRK-01           CPLH-RGR------------------------------------------
G3UH24_HRK-01           CPLH-RGR------------------------------------------
A0A2K5BYA0_HRK-01       CPLH-RGR------------------------------------------
A0A4W2CRW4_HRK-01       CPLH-RGR------------------------------------------
A0A4W2GVZ3_HRK-01       CPLH-RGR------------------------------------------
A0A4W2CRW4_HRK-01       CPLH-RGR------------------------------------------
A0A4W2GVZ3_HRK-01       CPLH-RGR------------------------------------------
U3E722_HRK-01           CPLH-RGR------------------------------------------
A0A452DXE5_HRK-01       CPLH-RGR------------------------------------------
A0A0D9SC73_HRK-01       CPLH-RGR------------------------------------------
A0A3Q2IBL3_HRK-01       CPLH-RGR------------------------------------------
A0A337SQ56_HRK-01       CPLH-RGR------------------------------------------
G3QTJ6_HRK-01           CPLH-RGR------------------------------------------
O00198_HRK-01           CPLH-RGR------------------------------------------
A0A2K6AYL7_HRK-01       CPLH-RGR------------------------------------------
G1QHD8_HRK-01           CPLH-RGR------------------------------------------
G1T7W1_HRK-01           CPLH-RGR------------------------------------------
H0Y001_HRK-01           CPLH-RGR------------------------------------------
A0A096N944_HRK-01       CPLH-RGR------------------------------------------
A0A2K6GL98_HRK-01       CPLH-RGR------------------------------------------
A0A671EZ71_HRK-01       CPLH-RGR------------------------------------------
A0A2K5PIE7_HRK-01       CPLH-RGR------------------------------------------
A0A2Y9Q8G3_HRK-01       CPLH-RGR------------------------------------------
A0A2Y9SD47_HRK-01       CPLH-RGR------------------------------------------
F7G1G0_HRK-01           CPLH-RGR------------------------------------------
A0A4X2K3J4_HRK-01       CPLH-RGR------------------------------------------
Q6JTU4_BCL2L11-01       -----MRQ------------------------------------------
A0A3B5RFA9_PMAIP1-      -------L------------------------------------------
Q96LC9_BMF-08           DVFQ----------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      PPAAPAA-------------------------------------------
A0A803VLS8_BCL2L11      QPE-----------------------------------------------
A0A5F8ATY0_PMAIP1-      QPQP-TNQ------------------------------------------
A0A5F9C629_PMAIP1-      QSSP-KRA------------------------------------------
A0A2K6EM90_PMAIP1-      QPSP-TRT------------------------------------------
A0A670IXL8_PMAIP1-      PPAP-AST------------------------------------------
G1P8F9_PMAIP1-01        QPSP-TRA------------------------------------------
Q9JM54_PMAIP1-03        SPSP-TRV------------------------------------------
A0A3Q2I0H2_PMAIP1-      QPSP-TRA------------------------------------------
G3T0P7_PMAIP1-01        QPGP-AGT------------------------------------------
A0A7N5JEA5_PMAIP1-      QASP-ART------------------------------------------
A0A452STA4_PMAIP1-      QASP-ART------------------------------------------
A0A2K5NJZ2_PMAIP1-      QPSP-MRA------------------------------------------
A0A0D9S003_PMAIP1-      QPSP-TRA------------------------------------------
A0A2K6BV43_PMAIP1-      QPSP-TRA------------------------------------------
A0A2K5ZWH1_PMAIP1-      QPSP-TRA------------------------------------------
A0A2K5JY17_PMAIP1-      QPSP-ARA------------------------------------------
A0A2K6KJF1_PMAIP1-      QPSP-ARA------------------------------------------
A0A2K6NC45_PMAIP1-      QPSP-ARA------------------------------------------
A0A2K6S6C4_PMAIP1-      QPSP-ARA------------------------------------------
A0A2I2YVQ5_PMAIP1-      QPSP-ARA------------------------------------------
Q13794_PMAIP1-01        QPSP-ARA------------------------------------------
A0A2R9AKC9_PMAIP1-      QPSP-ARA------------------------------------------
A0A2I3SX38_PMAIP1-      QPSP-ARA------------------------------------------
A0A2K5CFK7_PMAIP1-      QPSP-SRA------------------------------------------
A0A2K5QQC6_PMAIP1-      QPSP-APA------------------------------------------
A0A337SUX1_PMAIP1-      QPSP-ARA------------------------------------------
A0A673UI19_PMAIP1-      QPSP-ARA------------------------------------------
A0A2Y9P485_PMAIP1-      QQSP-TRA------------------------------------------
A0A2Y9TJ73_PMAIP1-      QQSP-TRA------------------------------------------
A0A4W2CDL0_PMAIP1-      QPSP-TRV------------------------------------------
A0A3Q1NFP6_PMAIP1-      QPSP-TRV------------------------------------------
A0A4W2CDL0_PMAIP1-      QPSP-TRV------------------------------------------
A0A452EST2_PMAIP1-      QPSP-TRV------------------------------------------
W5P738_PMAIP1-01        QPSP-TRV------------------------------------------
A0A803YIP1_PMAIP1-      S--P-SPC------------------------------------------
A0A663N909_PMAIP1-      GWLT-AVL------------------------------------------
A0A1D5PAR2_PMAIP1-      ---P-APP------------------------------------------
Q9JM54_PMAIP1-02        PVNP---T------------------------------------------
A0A2I3HX97_PMAIP1-      QPSP-APA------------------------------------------
G1LIZ7_PMAIP1-01        SPSP-SAA------------------------------------------
A0A452TE71_PMAIP1-      SPSP-SAA------------------------------------------
A0A452J430_PMAIP1-      QQNP-ALP------------------------------------------
A0A493SWX7_PMAIP1-      QPSA----------------------------------------------
A0A674JUE0_PMAIP1-      EPPP----------------------------------------------
A0A7M4FB17_PMAIP1-      SPAPAMLP------------------------------------------
A0A663FH84_PMAIP1-      PPAAP--A------------------------------------------
A0A670ZS96_PMAIP1-      ASTE----------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A4W3JXA1_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-02       --------------------------------------------------
A0A670JUU6_BMF-04       --------------------------------------------------
A0A674GIP8_BMF-03       --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A669PL85_BMF-02       --------------------------------------------------
A0A663MPI8_BMF-01       --------------------------------------------------
A0A674GIP8_BMF-02       --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A674GIP8_BMF-01       --------------------------------------------------
A0A803YBD7_BMF-01       --------------------------------------------------
A0A663DZQ4_BMF-01       --------------------------------------------------
A0A672V891_BMF-01       --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
A0A669PL85_BMF-01       --------------------------------------------------
A0A670XMZ5_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-02       --------------------------------------------------
A0A803SZ00_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-03       --------------------------------------------------
A0A670JUU6_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-05       --------------------------------------------------
A0A670JUU6_BMF-03       --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
F7HZL0_BMF-01           --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
F7HZL0_BMF-03           --------------------------------------------------
Q91ZE9_BMF-06           --------------------------------------------------
Q91ZE9_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A7N4PJP2_BMF-01       --------------------------------------------------
A0A4X2KLG2_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A5F4CJ04_BMF-03       --------------------------------------------------
A0A5F4CJ04_BMF-02       --------------------------------------------------
A0A5F4CJ04_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F7HZL0_BMF-02           --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A667H967_BMF-01       --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A671DWL6_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A674IPL3_BMF-01       --------------------------------------------------
A0A673TA87_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
Q91ZE9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A671DWL6_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      -----------------------------------------VCLFVRSSC
A0A673J9C6_BAD-01       -------------------------------------PCSVSCTVCELEV
F7GL32_BBC3-01          -----------------------------------------SCSLCEAGL
A0A480SCP6_BBC3-04      -----------------------------------------SCGLCEPGL
A0A4W5JLL9_BAD-02       -------------------------------------PLSLH--------
A0A3Q7S5V2_BCL2L11      SGGALPCPALPGPRLRCRHQQPHDPDGERPRAAGPAPPVGHPHSLAVPPG
A0A674DKC6_BAD-01       ------------SLSPSPLSASP--------------PFPLPLSLPLLSL
A0A287AEC6_BCL2L11      ------------PRRRRRRRRHH--------------RYRHHHRLLTVAL
A0A287AEC6_BCL2L11      ------------PRRRRRRRRHH--------------RYRHHHRLLTVAL
A0A287AEC6_BCL2L11      ------------PRRRRRRRRHH--------------RYRHHHRLLTVAL
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A4W4DXF5_BAD-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A0A803YBD7_BMF-02       --------------------------------------------------
A0A3P8YI30_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
Q925D2_BIK-02           --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A4W4DZH9_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A668TQU8_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B5KWG6_BMF-03       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3P9ICE1_BMF-02       --------------------------------------------------
A0A3P9ICE1_BMF-05       --------------------------------------------------
A0A3P9ICE1_BMF-03       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A672HG10_BMF-01       --------------------------------------------------
A0A673C8N3_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A665VG08_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A0F8AD62_BMF-01       --------------------------------------------------
A0A671X848_BMF-01       --------------------------------------------------
A0A667YNR9_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-01       --------------------------------------------------
A0A1S3SNN2_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-02       --------------------------------------------------
A0A6F9B4C5_BMF-01       --------------------------------------------------
A0A6F9BGV6_BMF-01       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A671MNR9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A671M0H4_BMF-01       --------------------------------------------------
A0A671M0H4_BMF-02       --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
O70337_BIK-03           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
A0A674I2R9_BAD-01       --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A4W4HE29_BAD-01       --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A674AVP9_BAD-01       --------------------------------------------------
A0A1S3L0Z2_BAD-01       --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A060W8W7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
A0A671PX91_BAD-01       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A671SBB4_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-02       --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A667ZNC6_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A668V3Q4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A672JQ68_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A672YF93_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A6F9CQZ0_BAD-02       --------------------------------------------------
A0A6F9CA11_BAD-02       --------------------------------------------------
A0A1S3N9Q3_BAD-01       --------------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
A0A060W8P9_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A671NP27_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A671RUV0_BAD-01       --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A665TUH3_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-04       --------------------------------------------------
A0A674MXC1_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-02       --------------------------------------------------
A0A674MXC1_BAD-03       --------------------------------------------------
A0A671TL42_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A1A8AQV0_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A672RK14_BMF-01       --------------------------------------------------
A0A673JJ10_BMF-01       --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
A0A6I8NF73_BMF-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       --------------------------------------------------
A0A672V9F8_BAD-01       --------------------------------------------------
A0A674GQ16_BAD-01       --------------------------------------------------
A0A6I8NVP2_BAD-01       --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
G5B6Q3_BAD-01           --------------------------------------------------
G5B6Q3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
Q61337_BAD-07           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2J8TYJ3_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z674_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-03       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
A0A2K6E7I4_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
A0A671ELU4_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A667H8Z9_BAD-01       --------------------------------------------------
A0A673V6P8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
A0A4U1FMC3_BAD-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z674_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5PDB1_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A0A2I2YFH2_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z674_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------------------
A0A671F3X5_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------------------
A0A2I3N2Z9_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
A0A670YRG7_BAD-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
Q92934_BAD-06           --------------------------------------------------
Q92934_BAD-05           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A671EZ71_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A4X2K3J4_HRK-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A4W3JXA1_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-02       --------------------------------------------------
A0A670JUU6_BMF-04       --------------------------------------------------
A0A674GIP8_BMF-03       --------------------------------------------------
A0A7M4FPU2_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A669PL85_BMF-02       --------------------------------------------------
A0A663MPI8_BMF-01       --------------------------------------------------
A0A674GIP8_BMF-02       --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A674GIP8_BMF-01       --------------------------------------------------
A0A803YBD7_BMF-01       --------------------------------------------------
A0A663DZQ4_BMF-01       --------------------------------------------------
A0A672V891_BMF-01       --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
A0A669PL85_BMF-01       --------------------------------------------------
A0A670XMZ5_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-02       --------------------------------------------------
A0A803SZ00_BMF-01       --------------------------------------------------
A0A803SZ00_BMF-03       --------------------------------------------------
A0A670JUU6_BMF-01       --------------------------------------------------
A0A670JUU6_BMF-05       --------------------------------------------------
A0A670JUU6_BMF-03       --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
Q96LC9_BMF-05           --------------------------------------------------
Q96LC9_BMF-07           --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
F7HZL0_BMF-01           --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
F7HZL0_BMF-03           --------------------------------------------------
Q91ZE9_BMF-06           --------------------------------------------------
Q91ZE9_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A5F8GKJ8_BMF-01       --------------------------------------------------
A0A7N4PJP2_BMF-01       --------------------------------------------------
A0A4X2KLG2_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A5F4CJ04_BMF-03       --------------------------------------------------
A0A5F4CJ04_BMF-02       --------------------------------------------------
A0A5F4CJ04_BMF-01       --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
Q96LC9_BMF-06           --------------------------------------------------
F7HZL0_BMF-02           --------------------------------------------------
A0A096NTE9_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A5F7ZML1_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
Q96LC9_BMF-01           --------------------------------------------------
Q96LC9_BMF-02           --------------------------------------------------
Q96LC9_BMF-03           --------------------------------------------------
Q96LC9_BMF-04           --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A5F7ZML1_BMF-01       --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
A0A4W2EII1_BMF-01       --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A4W2INA4_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A667H967_BMF-01       --------------------------------------------------
A0A2U4BC98_BMF-01       --------------------------------------------------
A0A671DWL6_BMF-01       --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------PGDISKADWAGSVTVPVA
A0A452H3N6_BMF-01       --------------------------------------------------
A0A674IPL3_BMF-01       --------------------------------------------------
A0A673TA87_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-01       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
Q91ZE9_BMF-02           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A7N5JI49_BMF-03       --------------------------------------------------
A0A671DWL6_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      GRCFASSHFPDLILSDGACFSELGDGAVWLQSPDVVSL------------
A0A673J9C6_BAD-01       NCSCAATPHNTGACQDSSRNPNRASESKHPDTQITRKT------------
F7GL32_BBC3-01          NPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPR------------
A0A480SCP6_BBC3-04      PAAPAAPTLLPAAYLCAPTAPPAVTAALGGPR------------------
A0A4W5JLL9_BAD-02       ------------------PSSPPSHSFLVSPLS-----------------
A0A3Q7S5V2_BCL2L11      GAVPSGACSSVSELVAEDPPAAGARG--VDVFAVCRAHGCARTRVPVASG
A0A674DKC6_BAD-01       FLCLFSLSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLT
A0A287AEC6_BCL2L11      RVLFSAASIASDCWVRPAPAAATHSA----PFP-----------------
A0A287AEC6_BCL2L11      RVLFSAASIASDCWVRPAPAAATHSA----PFP-----------------
A0A287AEC6_BCL2L11      RVLFSAASIASDCWVRPAPAAATHSA----PFP-----------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
A0A4W4DXF5_BAD-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
A0A803YBD7_BMF-02       --------------------------------------------------
A0A3P8YI30_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
Q925D2_BIK-02           --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A4W4DZH9_BMF-01       --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A668TQU8_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3B5KWG6_BMF-03       --------------------------------------------------
A0A3B5KWG6_BMF-01       --------------------------------------------------
A0A3B5KWG6_BMF-02       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3P9ICE1_BMF-02       --------------------------------------------------
A0A3P9ICE1_BMF-05       --------------------------------------------------
A0A3P9ICE1_BMF-03       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A672HG10_BMF-01       --------------------------------------------------
A0A673C8N3_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A665VG08_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A0F8AD62_BMF-01       --------------------------------------------------
A0A671X848_BMF-01       --------------------------------------------------
A0A667YNR9_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-01       --------------------------------------------------
A0A1S3SNN2_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A4W5N3A7_BMF-01       --------------------------------------------------
A0A4W5N721_BMF-01       --------------------------------------------------
A0A1S3P5K4_BMF-02       --------------------------------------------------
A0A6F9B4C5_BMF-01       --------------------------------------------------
A0A6F9BGV6_BMF-01       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A671MNR9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A671M0H4_BMF-01       --------------------------------------------------
A0A671M0H4_BMF-02       --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
O70337_BIK-03           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
Q13323_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
F6SUD3_BIK-01           --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
A0A674I2R9_BAD-01       --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A4W4HE29_BAD-01       --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A674AVP9_BAD-01       --------------------------------------------------
A0A1S3L0Z2_BAD-01       --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A4W5MZR2_BAD-01       --------------------------------------------------
A0A060W8W7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
A0A671PX91_BAD-01       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A671SBB4_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-02       --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-02       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A667ZNC6_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
A0A668V3Q4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A672JQ68_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A672YF93_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A6F9CQZ0_BAD-02       --------------------------------------------------
A0A6F9CA11_BAD-02       --------------------------------------------------
A0A1S3N9Q3_BAD-01       --------------------------------------------------
A0A6F9BAV3_BAD-01       --------------------------------------------------
A0A3P8YI30_BAD-02       --------------------------------------------------
A0A4W5R1T6_BAD-01       --------------------------------------------------
A0A060W8P9_BAD-01       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A671NP27_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A671RUV0_BAD-01       --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A4W5JLL9_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A665TUH3_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-04       --------------------------------------------------
A0A674MXC1_BAD-01       --------------------------------------------------
A0A674MXC1_BAD-02       --------------------------------------------------
A0A674MXC1_BAD-03       --------------------------------------------------
A0A671TL42_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
A0A1A8AQV0_BAD-01       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A672RK14_BMF-01       --------------------------------------------------
A0A673JJ10_BMF-01       --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
A0A6I8NF73_BMF-01       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-04           --------------------------------------------------
G3VRY3_BAD-03           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
A0A4X2KAA5_BAD-01       --------------------------------------------------
A0A672V9F8_BAD-01       --------------------------------------------------
A0A674GQ16_BAD-01       --------------------------------------------------
A0A6I8NVP2_BAD-01       --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
Q61337_BAD-06           --------------------------------------------------
Q61337_BAD-03           --------------------------------------------------
Q61337_BAD-04           --------------------------------------------------
Q61337_BAD-02           --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
G5B6Q3_BAD-01           --------------------------------------------------
G5B6Q3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
Q61337_BAD-07           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A2J8TYJ3_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-01       --------------------------------------------------
Q92934_BAD-01           --------------------------------------------------
Q92934_BAD-02           --------------------------------------------------
A0A2I3TBK7_BAD-02       --------------------------------------------------
A0A2R8Z674_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-03       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
U3F2S3_BAD-01           --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-01       --------------------------------------------------
A0A1D5QBW1_BAD-01       --------------------------------------------------
A0A2K6E7I4_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
A0A671ELU4_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A667H8Z9_BAD-01       --------------------------------------------------
A0A673V6P8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
A0A4W2C9A8_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
A0A4U1FMC3_BAD-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2R8Z674_BAD-02       --------------------------------------------------
A0A2I2YFH2_BAD-03       --------------------------------------------------
Q92934_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5PDB1_BAD-02       --------------------------------------------------
A0A2K5E6A6_BAD-02       --------------------------------------------------
A0A2K6TG62_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5XJR2_BAD-03       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A0A2I2YFH2_BAD-04       --------------------------------------------------
Q92934_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z674_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------------------
A0A671F3X5_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------------------
A0A2I3N2Z9_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
Q61337_BAD-09           --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
A0A670YRG7_BAD-01       --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
Q92934_BAD-06           --------------------------------------------------
Q92934_BAD-05           --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
A0A4W2CRW4_HRK-01       --------------------------------------------------
A0A4W2GVZ3_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
O00198_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A671EZ71_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
A0A2Y9Q8G3_HRK-01       --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A4X2K3J4_HRK-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
Q96LC9_BMF-08           --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
O00198_HRK-03           --------------------------------------------------
Q96LC9_BMF-09           --------------------------------------------------
                                                                          

A0A4W4H0G9_PMAIP1-      --------------------------------------------------
O61667_EGL1-01          -------------SSQFADDSGFFDDSEISSIG-----------------
A0A5F5XUY6_BIK-01       --------------------------------------------------
A0A4W3JXA1_BMF-01       -------------FCGPGCGRQVQCDKATQTPTSIPGSD-----------
A0A3Q3SYA1_BCL2L11      -------------RSSSGYFSSDGDSLPSSPLS--PRPVTADKA------
A0A3Q2LHE3_BIK-02       -------------------SPEALEVPGMTELT--ESSPDSDN-------
A0A7N5KDU2_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A667G4D3_BIK-01       --------------------------------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A493T7X1_BMF-01       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A670JUU6_BMF-02       -------------CCGPGTRHAKQQDKATQTLN--PSSS-----------
A0A670JUU6_BMF-04       -------------CCGPGTRHAKQQDKATQTLN--PSSS-----------
A0A674GIP8_BMF-03       -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
A0A7M4FPU2_BMF-01       -------------CCGPGSRHTEQQDKATQTLN--PSSS-----------
K7FRX2_BMF-01           -------------CCGPGIRHAEQQDKATQTLS--PSSS-----------
A0A3Q2UCA0_BMF-01       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A3Q2UCA0_BMF-02       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A669PL85_BMF-02       -------------CCGPGVRQPEQQDKATQTLS--PSSS-----------
A0A663MPI8_BMF-01       -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
A0A674GIP8_BMF-02       -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
U3JS06_BMF-01           -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
A0A674GIP8_BMF-01       -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
A0A803YBD7_BMF-01       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A663DZQ4_BMF-01       -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
A0A672V891_BMF-01       -------------CCGPGIRHPEQQDKATQTLS--PSSS-----------
A0A493T7X1_BMF-02       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A3Q2UCA0_BMF-03       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A3Q2UCA0_BMF-04       -------------CCGPGVRHPEQQDKATQTLS--PSSS-----------
A0A669PL85_BMF-01       -------------CCGPGVRQPEQQDKATQTLS--PSSS-----------
A0A670XMZ5_BMF-01       -------------CCGPGSRHAKQQDKATQTLN--ASSS-----------
A0A803SZ00_BMF-02       -------------CCGPGSRQARQQDKATQTLN--PSSS-----------
A0A803SZ00_BMF-01       -------------CCGPGSRQARQQDKATQTLN--PSSS-----------
A0A803SZ00_BMF-03       -------------CCGPGSRQARQQDKATQTLN--PSSS-----------
A0A670JUU6_BMF-01       -------------CCGPGTRHAKQQDKATQTLN--PSSS-----------
A0A670JUU6_BMF-05       -------------CCGPGTRHAKQQDKATQTLN--PSSS-----------
A0A670JUU6_BMF-03       -------------CCGPGTRHAKQQDKATQTLN--PSSS-----------
A0A337ST43_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K5KGP2_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6FFN3_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K5E1Q4_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K5RN49_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K6TW78_BMF-03       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K6RAW1_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2I2Z168_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q96LC9_BMF-05           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q96LC9_BMF-07           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2R9BS98_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2J8QDD5_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K5MJW4_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6B5F6_BMF-03       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K5Z4A9_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2I3HD83_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
F7HZL0_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A337ST43_BMF-04       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A337ST43_BMF-05       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
F7HZL0_BMF-03           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q91ZE9_BMF-06           -------------CCGPGLRPISQEDKATQTLS--PASP-----------
Q91ZE9_BMF-01           -------------CCGPGLRPISQEDKATQTLS--PASP-----------
A0A287CXH0_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
G3T7Z4_BMF-01           -------------CCGPGLRHTSQEDKATQTLS--PASP-----------
A0A5F8GKJ8_BMF-01       -------------CCGPGLRSVGQEDKATQTLS--PASP-----------
A0A7N4PJP2_BMF-01       -------------CCGPGLRSVGQEDKATQTLS--PASP-----------
A0A4X2KLG2_BMF-01       -------------CCGPGLRSVGQEDKATQTLS--PASP-----------
A0A3Q2HR24_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A3Q2HR24_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A5F4CJ04_BMF-03       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A5F4CJ04_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A5F4CJ04_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A286XXB0_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PSSP-----------
Q96LC9_BMF-06           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
F7HZL0_BMF-02           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A096NTE9_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A286XXB0_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PSSP-----------
A0A337ST43_BMF-03       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A7N9CRT3_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6FFN3_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
H0WYH6_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K5MJW4_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K5KGP2_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A7N9CRT3_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A5F7ZML1_BMF-03       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A5F7ZML1_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6B5F6_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6B5F6_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6B5F6_BMF-04       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K5Z4A9_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6L919_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6L919_BMF-03       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6RAW1_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A0D9R4R5_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K5E1Q4_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K6TW78_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K6TW78_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2K5RN49_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2I2Z168_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q96LC9_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q96LC9_BMF-02           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q96LC9_BMF-03           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q96LC9_BMF-04           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2R9BS98_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2J8QDD5_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2J8T301_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A7N9CRT3_BMF-03       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A5F7ZML1_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A096NTE9_BMF-01       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
A0A2K6L919_BMF-02       -------------CCGPGLRPTSQEDKATQTLG--PASP-----------
G1SR62_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A337ST43_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
W5QFV1_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A4W2EII1_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A4W2EII1_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q05KI3_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
Q05KI3_BMF-02           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A4W2INA4_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
L8IXF5_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A4W2INA4_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A452F2E0_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A452F2E0_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A667H967_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A2U4BC98_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A671DWL6_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
M3YAD5_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
U6CSY8_BMF-01           -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A452SED0_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A384D070_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A337SAW2_BAD-01       QATRAGLPQYWREAAGPGQGPRDRAWAQSMFQI--PEFEPSEQEDSSPTD
A0A452H3N6_BMF-01       -------------CCGPGIRHAEQQDKATQTLS--PSSS-----------
A0A674IPL3_BMF-01       -------------CCGPGIRHAEQQDKATQTLS--PSSS-----------
A0A673TA87_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A287AIU8_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A7N5JI49_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A7N5JI49_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
G1PAU1_BMF-01           -------------CCGPGLRPISQEDKATQTLS--PASP-----------
Q91ZE9_BMF-02           -------------CCGPGLRPISQEDKATQTLS--PASP-----------
A0A287AIU8_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A4X1UQ42_BMF-01       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A4X1UQ42_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A7N5JI49_BMF-03       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A671DWL6_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A286XXB0_BMF-03       -------------CCGPGLRPTSQEDKATQTLS--PSSP-----------
A0A287CXH0_BMF-02       -------------CCGPGLRPTSQEDKATQTLS--PASP-----------
A0A3Q2GRS5_BCL2L11      -----------------------KKDQMAKQPS--DVSSECDRE------
A0A3Q2GRS5_BCL2L11      -----------------------KKDQMAKQPS--DVSSECDRE------
A0A7M4F197_BCL2L11      ---WSRESLLA----MLSLSLQGKKDQMAKQPS--DLNSKCGSE------
A0A673J9C6_BAD-01       ---VRRTPTDSRNRLIMAQMFSISDNESDTETS--EDCEDSDLTKNNSGS
F7GL32_BBC3-01          ---WARAARSP---------AAGNQGQSGSLPS--LGPRSAQEE------
A0A480SCP6_BBC3-04      ---WPGGPRSR--------PRGPRPDGPQPSLS--PAEQHLESPVPSAPG
A0A4W5JLL9_BAD-02       ---LTPLPPSS--SVDVSMAQMFTISDSESEPS--EEVGETEKDQLAAGK
A0A3Q7S5V2_BCL2L11      CG-WDLDVRAALGEEKGGICGGRKKDQMAKQPS--DVSSECDRE------
A0A674DKC6_BAD-01       AFLFPLLTSSS--SVDVSMAQMFTISDSESEPS--EEVGETEKDQSSAGK
A0A287AEC6_BCL2L11      ---WPSSPQCL--TLTLGLRNARKKDQMAKQPS--DVSSECDRE------
A0A287AEC6_BCL2L11      ---WPSSPQCL--TLTLGLRNARKKDQMAKQPS--DVSSECDRE------
A0A287AEC6_BCL2L11      ---WPSSPQCL--TLTLGLRNARKKDQMAKQPS--DVSSECDRE------
A0A3B1JLM2_BAD-01       -------------CWNSSGSTVFTMEKTPPHSK--EDDISPI--------
A0A4W4DXF5_BAD-01       -------------CWNPFRVTAFTMEKA-PCGQ--RDDISAL--------
A9XRH0_BMF-01           -------------ALDPNLQEEPQEG------------------------
A0A803YBD7_BMF-02       -------------ALDPNLQEEPQEG------------------------
A0A3P8YI30_BAD-01       -------------TSNRTLP------------------------------
A0A3B4DUY7_BAD-01       -------------NISPASPDELSEV------------------------
A0A4W3IWD3_BCL2L11      -------------PVSPSSRTSRLSS------------------------
A0A4W3IWD3_BCL2L11      -------------PVSPSSRTSRLSS------------------------
A0A4W3IWD3_BCL2L11      -------------PVSPSSRTSRLSS------------------------
A0A3B4UNJ0_BMF-01       -------------ATPIAAGQALTAVTAAPLIL--F--------------
A0A3G3M2M0_BCL2L11      -------------SGESAGVGAALRPGHFDFPQ--PSDGDPLRGGIAMSN
A0A672PQD1_BCL2L11      -------------SGESAGGAAVLGSGHFDFPQ--PSDGDPLRGGIAMSS
Q925D2_BIK-02           -------------PVGVEDVSPVRDLDFMRC-------------------
A0A3P9ICE1_BMF-01       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3B4B6Y3_BMF-01       -------------ATQTPGPALAPNKGMLPCGV--AEEPRPL--------
A0A4W4DZH9_BMF-01       -------------GTQTAGRPLARPNGMLPCGV--SEEPRRL--------
A0A3B1K1X5_BMF-01       -------------GTQTPGRPPARTNGMLPCGI--SEEPRRL--------
A0A3B4CNJ8_BMF-01       -------------GTQTPGRPPARPNGMLPCGV--SEEPRRL--------
A0A3B3RH63_BMF-01       -------------GTQTPGPALVQGLNMLPCGV--GQEPRRL--------
W5N4P7_BMF-01           -------------GTQTPSPALVHGDNMLPCGV--GAEPRRL--------
A0A2U9CJH3_BMF-01       -------------GTQTPGPALALNNGMLPCGV--AEEPRPL--------
A0A3Q2YCX7_BMF-01       -------------ATQTPGPVPASNNGMLPCGV--AEEPRPL--------
A0A3Q2YCX7_BMF-02       -------------ATQTPGPVPASNNGMLPCGV--AEEPRPL--------
A0A668TQU8_BMF-01       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3Q3VLX6_BMF-01       -------------GTQTPGPALAPYSGMLPCGV--AEEPRHL--------
A0A3P8UA78_BMF-01       -------------GTQTPGPDLALNNGMLPCGV--GEEPRPL--------
A0A3P8UA78_BMF-03       -------------GTQTPGPDLALNNGMLPCGV--GEEPRPL--------
A0A3P8UA78_BMF-02       -------------GTQTPGPDLALNNGMLPCGV--GEEPRPL--------
A0A3B5KWG6_BMF-03       -------------GTQTPGPTLAPHSGMLPCGV--AEEPRLL--------
A0A3B5KWG6_BMF-01       -------------GTQTPGPTLAPHSGMLPCGV--AEEPRLL--------
A0A3B5KWG6_BMF-02       -------------GTQTPGPTLAPHSGMLPCGV--AEEPRLL--------
A0A3B3CGR9_BMF-01       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3B3HAU1_BMF-04       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3P9ICE1_BMF-04       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3P9K487_BMF-02       -------------GTQTPGPALVPNNGMLLCGL--SEEPRPL--------
A0A3B3HAU1_BMF-01       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3B3HAU1_BMF-02       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3B3HAU1_BMF-03       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3P9ICE1_BMF-02       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3P9ICE1_BMF-05       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3P9ICE1_BMF-03       -------------GTQTPGPALVPNNGMLLCGL--AEEPRPL--------
A0A3P9K487_BMF-01       -------------GTQTPGPALVPNNGMLLCGL--SEEPRPL--------
A0A672HG10_BMF-01       -------------GTQTPGPVLVPNNGMLPCGV--AEEPRPL--------
A0A673C8N3_BMF-01       -------------GTQTPGLALAPNNGMLPCGV--AEEPRPL--------
A0A3P8NFE2_BMF-02       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
I3K2D6_BMF-01           -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3P8NFE2_BMF-01       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3Q3C5V2_BMF-01       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3P9DPJ5_BMF-01       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3P9DPJ5_BMF-02       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3B4ETH0_BMF-01       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3Q4G1I4_BMF-01       -------------GTQTPGPALVPNNGMLPCGV--AEEPRPL--------
A0A3Q1FVH7_BMF-02       -------------GTQTPGPALQPNNGMLPCGV--AEEPRPL--------
A0A3Q1FVH7_BMF-01       -------------GTQTPGPALQPNNGMLPCGV--AEEPRPL--------
A0A3Q2ZA20_BMF-01       -------------GTQTPGPALVPHSGMLPCGV--AEEPRPL--------
A0A665VG08_BMF-01       -------------GTQTPGPALGPNNGMLPCGI--AKEPRPL--------
A0A3Q3RVI2_BMF-01       -------------GTQTPGPALALNNGMLPCGV--AEEPRPL--------
A0A3Q1D1K3_BMF-01       -------------GTQTPGPALQPNNGMLPCGV--AEEPRPL--------
A0A3P8RKY9_BMF-01       -------------GTQTPGPALQPNNGMLPCGV--AEEPRPL--------
A0A3Q3RVI2_BMF-02       -------------GTQTPGPALALNNGMLPCGV--AEEPRPL--------
A0A4W6DUL1_BMF-01       -------------GTQTPGPALALNNGMLPCGV--EEEPRPL--------
A0A3Q1IPR4_BMF-01       -------------GTQTPGPALPQNNGMLPCGV--AEEPRPL--------
A0A0F8AD62_BMF-01       -------------GTQTPGPALAPYNGMLPCGV--AEEPRPL--------
A0A671X848_BMF-01       -------------GTQTPGPALALYNGMLPCGV--AEEPRPL--------
A0A667YNR9_BMF-01       -------------GTQTPGPALTLANGMLPCGV--AEEPRPL--------
A0A3B4U5H8_BMF-01       -------------GTQTPGPALALNNGMLPCGV--AKEPRPL--------
A0A3B4WM88_BMF-01       -------------GTQTPGPALALNNGMLPCGV--AKEPRPL--------
A0A3Q3QZ16_BMF-01       -------------GTQTAGPTLAPNNSMLPCGV--AEDPRPL--------
A0A3Q3QZ16_BMF-02       -------------GTQTAGPTLAPNNSMLPCGV--AEDPRPL--------
A0A3Q2PJX9_BMF-01       -------------GTQTPGPALAPNNGMLPCGV--AEEPRQL--------
A0A3Q2PJX9_BMF-02       -------------GTQTPGPALAPNNGMLPCGV--AEEPRQL--------
A0A3Q2PJX9_BMF-03       -------------GTQTPGPALAPNNGMLPCGV--AEEPRQL--------
A0A3B5QK08_BMF-02       -------------GTQTPGPGQALHNGMLPCGV--VEEPRRL--------
A0A3B5QK08_BMF-01       -------------GTQTPGPGQALHNGMLPCGV--VEEPRRL--------
A0A096LRV0_BMF-01       -------------GTQTPGPGQALHNGMLPCGV--AEEPRRL--------
A0A3B3WU80_BMF-01       -------------GTQTPGPGQALHNGMLPCGV--AEEPRRL--------
A0A3P9Q8E2_BMF-01       -------------GTQTPGPGQALHNGMLPCGV--AEEPRRL--------
A0A3Q2CXC4_BMF-02       -------------GTQTPGPGVAPHNVMLPCGV--VEEPRPL--------
A0A3Q2CXC4_BMF-01       -------------GTQTPGPGVAPHNVMLPCGV--VEEPRPL--------
A0A3Q3GUU5_BMF-01       -------------GTQTPGPALAPNNGMLPCGV--AEEPRPL--------
A0A3B5B8F6_BMF-01       -------------GTQTPGPALQPNNGMLPCGV--AEEPRPL--------
A0A1S3P5K4_BMF-01       -------------GTQTPSPVLPLPNNMLPCGV--AQEPRPL--------
A0A1S3SNN2_BMF-01       -------------GTQTPSPALALPNDMLPCGV--AQEPRPL--------
A0A674EF64_BMF-01       -------------GTQTPSPALALPNDMLPCGV--AQEPRPL--------
A0A4W5N3A7_BMF-01       -------------GTQTPSPALALRNNMLPCG-----EPRPL--------
A0A4W5N721_BMF-01       -------------GTQTPSPVLPLPNNMLPCGV--AQEPRPL--------
A0A1S3P5K4_BMF-02       -------------GTQTPSPVLPLPNNMLPCGV--AQEPRPL--------
A0A6F9B4C5_BMF-01       -------------GTQTPSPVLALPNSMVPCGV--AQEPRPL--------
A0A6F9BGV6_BMF-01       -------------GTQTPSPALALPNDMLPCGV--AQEPRPL--------
A0A3P8ZIE7_BMF-01       -------------GTQTPTTALALLNDMLPCRL--DQDPRPL--------
A0A673YQV3_BMF-01       -------------GTQTPSPVLPLPNNMLPCGV--AQEPRPL--------
A0A673CKA1_BCL2L11      -------------PDSPSQIGVKAT-------------------------
A0A4W4H3Y1_BCL2L11      -------------SHPNQGDQFRGGIT--SS-------------------
A0A3B4BSH7_BCL2L11      -------------PEPGEGDPVRGGITMPNS-------------------
Q0GKC7_BMF-01           -----------------AGRPAGSRNGMLLCRH--LQQHGHF--------
A0A673HDR4_BMF-01       -----------------AGRPPLSPSGMLPCRV--HVEPRRF--------
A0A672JWL9_BMF-02       -----------------AGIPPLCPSGMLPCRV--HVEPRRF--------
A0A671MNR9_BMF-01       -----------------AGRPPLSPSGMLPCRV--NVEPRRF--------
A0A672JWL9_BMF-01       -----------------AGIPPLCPSGMLPCRV--HVEPRRF--------
A0A3B4CPH6_BAD-01       -------------GDGAADGDSFRR----RCRS--APPA-----------
M3XHJ5_BCL2L11-01       -------------PTQRPDQPPFVKQEGCYCII--SPLSKVI--------
A0A671M0H4_BMF-01       -----------------AGTPPVSPSGMLPCRV--HVEPTRF--------
A0A671M0H4_BMF-02       -----------------AGTPPVSPSGMLPCRV--HVEPTRF--------
A0A2K5QXZ1_BIK-01       -------------P--EEDLDPVED--PLEC-------------------
O70337_BIK-04           --------------------------------------------------
Q925D2_BIK-01           -------------PVGVEDVSPVRDLDFMRC-------------------
O70337_BIK-03           ---------------------PVRDVDLMEC-------------------
O70337_BIK-01           ---------------------PVRDVDLMEC-------------------
O70337_BIK-02           ---------------------PVRDVDLMEC-------------------
G1TZR9_BIK-01           -------------PVEEGDLD------LMEC-------------------
H0XAE7_BIK-01           -------------------------PNPMEC-------------------
A0A2K6FM79_BIK-01       -------------N--------EENPDPSGC-------------------
A0A2K5CLG5_BIK-01       -------------P--EEDLDPVED--PLEC-------------------
A0A2K6TBD7_BIK-01       -------------P--EEDPDSVED--PLEC-------------------
G1S1X2_BIK-01           -------------P--EEDLDPMEDFDPLQC-------------------
H2P4N6_BIK-01           -------------S--EEDLDPMEDFSPLEC-------------------
G3QCT2_BIK-01           -------------S--EEDLDPMEDFDSLEC-------------------
A0A2R8ZXD2_BIK-01       -------------S--EEDLDPMEDFDSLEC-------------------
H2QLU7_BIK-01           -------------S--EEDLDPMEDFDSLEC-------------------
Q13323_BIK-01           -------------S--EEDLDPMEDFDSLEC-------------------
A0A2K6MCW0_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
A0A2K6QK74_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
A0A0D9QZY8_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
F6SUD3_BIK-01           -------------P--EEDLDPMEDFNPLEC-------------------
A0A2K6DBJ4_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
A0A2K5J4Q7_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
A0A096NKG5_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
A0A2K5LDM6_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
A0A2K5XSA1_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
H0W025_BIK-01           -------------PLWAEDLSPPGDTNLMEC-------------------
A0A2K5VW94_BIK-01       -------------P--EEDLDPMEDFDPLEC-------------------
G1MV54_BCL2L11-01       -------------FVPVSNALFLLCA------------------------
C1C3S9_BAD-01           --------------FSGTNPPGFGGD------------------------
A0A452IFQ4_BAD-01       -------------SKQPDTPTAEVRS------------------------
A0A674I2R9_BAD-01       -------------SKQPDTPTAEVRS------------------------
A0A672TST9_BCL2L11      -------------QLRPGAPAALPGSAATAT-------------------
A0A674H354_BCL2L11      -------------QLRPGAPAALPG-AGPVS-------------------
O43521_BCL2L11-13       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-16       --------------LRPGAPTSLQTE---PQVS-----------------
A0A7N4NUH6_BCL2L11      --------------LRPGAPTSIQTQ---YQ-------------------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A5F8H037_BCL2L11      -------------QLRPGAPTSIQTQ---YQGN--S--------------
A0A5F9C9V3_BCL2L11      --------------LRPGAPTSLQSE---PQ-------------------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2Y9Q753_BCL2L11      --------------LRPGAPISLQTE---RQ-------------------
M3YDI3_BCL2L11-01       --------------LRPGAPTSLQTE---QQ-------------------
F7HHA1_BCL2L11-02       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A096NYC3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
F7HHA1_BCL2L11-03       --------------LRPGAPTSLQTE---PQ-------------------
A0A096NYC3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A674IAI8_BCL2L11      -------------HLRPGAPTSIQTQ---YQGN--HSGEGDF--------
A0A7N4NUH6_BCL2L11      --------------LRPGAPTSIQTQ---YQ-------------------
A0A2K6GE22_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-20       --------------LRPGAPTSLQTE---PQ-------------------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-07       --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-22       --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
C1KGB8_BCL2L11-01       --------------LRPGAPTSLQTE---RQ-------------------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A673SRF7_BCL2L11      --------------LRPGAPTSLQTQ---RQ-------------------
A0A2I2UX96_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A667H9R7_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
U6CTE3_BCL2L11-04       --------------LRPGAPTSLQTE---QQ-------------------
A0A3Q2GRS5_BCL2L11      --------------LRPGAPTSLQIE---QQ-------------------
A0A287AEC6_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A4X1VMQ3_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A671FCV3_BCL2L11      --------------LRPGAPTSVQIE---RQ-------------------
O54918_BCL2L11-06       --------------LRPGAPTSLQTE---PQ-------------------
O54918_BCL2L11-08       --------------LRPGAPTSLQTE---PQ-------------------
O54918_BCL2L11-05       --------------LRPGAPTSLQTE---PQ-------------------
C1KGB7_BCL2L11-01       --------------LRPGAPTSLQTE---RQ-------------------
U6CTE3_BCL2L11-03       --------------LRPGAPTSLQTE---QQ-------------------
A0A0D9RWE0_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-09       --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-14       --------------LRPGAPTSLQTE---PQ-------------------
A0A3Q1MV27_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A2K6GE22_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A286XJN2_BCL2L11      --------------LRAGAPTSLQTE---PQ-------------------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-04       --------------LRPGAPTSLQTE---PQ-------------------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2Y9T3Y6_BCL2L11      --------------LRPGAPISLQTE---RQ-------------------
A0A452SBG5_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A4X1VMQ3_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A2I2UX96_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A667H9R7_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A3Q7S5V2_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
G3H020_BCL2L11-01       --------------LRPGAPTSLQTE---PQ-------------------
A0A287DFJ0_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A4W2D2G6_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A4W2G3J8_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
L8IVA4_BCL2L11-01       --------------LRPGAPTSLQTE---RQ-------------------
A0A3Q1MV27_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A4W2D2G6_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A4W2G3J8_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A452FCR6_BCL2L11      --------------LRPGAPTSLQTE---RQ-------------------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-23       --------------LRPGAPTSLQTE---PQ-------------------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-03       --------------LRPGAPTSLQTE---PQ-------------------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A096NYC3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O54918_BCL2L11-03       --------------LRPGAPTSLQTE---PQ-------------------
A0A452U4S4_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A3Q2GRS5_BCL2L11      --------------LRPGAPTSLQIE---QQ-------------------
O43521_BCL2L11-17       --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A096NYC3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-02       --------------LRPGAPTSLQTE---PQ-------------------
O43521_BCL2L11-15       --------------LRPGAPTSLQTE---PQ-------------------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQ-------------------
A0A673SRF7_BCL2L11      --------------LRPGAPTSLQTQ---RQ-------------------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQ-------------------
O43521_BCL2L11-01       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-08       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-21       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-12       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-06       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-18       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A667H9R7_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PE-------------
A0A671FCV3_BCL2L11      --------------LRPGAPTSVQIE---RQGN--PE-------------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSPG---------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSPG---------
A0A2K6GE22_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSRE---------
A0A2K6GE22_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSRE---------
O54918_BCL2L11-01       --------------LRPGAPTSLQTE---PQGN--PDG------------
G3H020_BCL2L11-02       --------------LRPGAPTSLQTE---PQGN--PDG------------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
F7HHA1_BCL2L11-01       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-05       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSPG---------
A0A2K6GE22_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSRE---------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5CA52_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Q1U2_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R8M6L7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6TRJ7_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A096NYC3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-11       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-19       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5NTQ5_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5HZ87_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5X1Y3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6E1Z6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K5Z7V3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A096NYC3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2K6KJM8_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2K6QIJ1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEDNHG---------
A0A2I2Y4B3_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
O43521_BCL2L11-10       --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3GAA1_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2R9BZX9_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A2I3S5F6_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGNHG---------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSPG---------
A0A1U7SU38_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSPG---------
A0A4X1VMQ3_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PE-------------
C1KGB6_BCL2L11-01       --------------LRPGAPTSLQTE---RQGN--PE-------------
A0A3Q2GRS5_BCL2L11      --------------LRPGAPTSLQIE---QQGN--PG-------------
A0A673SRF7_BCL2L11      --------------LRPGAPTSLQTQ---RQGN--PE-------------
A0A671FCV3_BCL2L11      --------------LRPGAPTSVQIE---RQGN--PE-------------
A0A2Y9T3Y6_BCL2L11      --------------LRPGAPISLQTE---RQGN--PE-------------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PE-------------
U6CTE3_BCL2L11-02       --------------LRPGAPTSLQTE---QQGN--PE-------------
A0A4X1VMQ3_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PE-------------
A0A2I2UX96_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PE-------------
A0A667H9R7_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PE-------------
A0A287DFJ0_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEG------------
A0A2K6GE22_BCL2L11      --------------LRPGAPTSLQTE---PQGN--PEGSRE---------
A0A5F9C9V3_BCL2L11      --------------LRPGAPTSLQSE---PQGN--PEG------------
A0A4W2D2G6_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A4W2G3J8_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
L8IVA4_BCL2L11-02       --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A3Q1MV27_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A4W2D2G6_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A4W2G3J8_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A452FCR6_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
W5PY58_BCL2L11-01       --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A286XJN2_BCL2L11      --------------LRAGAPTSLQTE---PQGN--PEG------------
A0A286XJN2_BCL2L11      --------------LRAGAPTSLQTE---PQGN--PEG------------
H0XW23_BCL2L11-01       --------------LRPGAPTSLHTE---PQGN--PEGNPE---------
A0A671FCV3_BCL2L11      --------------LRPGAPTSVQIE---RQGN--PEG------------
A0A2Y9Q753_BCL2L11      --------------LRPGAPISLQTE---RQGN--PEG------------
A0A2Y9T3Y6_BCL2L11      --------------LRPGAPISLQTE---RQGN--PEG------------
U6CTE3_BCL2L11-01       --------------LRPGAPTSLQTE---QQGN--PEG------------
A0A4X1VMQ3_BCL2L11      --------------LRPGAPTSLQTE---RQGN--PEG------------
A0A673SRF7_BCL2L11      --------------LRPGAPTSLQTQ---RQGN--PEG------------
A0A7N5JE15_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PEG------------
A0A2I2UX96_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PEG------------
A0A667H9R7_BCL2L11      --------------LRPGAPTSLQTE---QQGN--PEG------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      -------------PLRPGAPAALPGA------------------------
A0A669QMB4_BCL2L11      -------------PLRPGAPAALPGA------------------------
A0A2K6E1Z6_BCL2L11      -------------QLRPGAPTSLQTDPGPFA-------------------
A0A5F8H037_BCL2L11      -------------QLRPGAPTSIQTQ---YQ-------------------
A0A4X2L9J9_BCL2L11      -------------QLRPGAPTSIQTQ---YQ-------------------
A0A7N4NUH6_BCL2L11      -------------QLRPGAPTSIQTQ---YQGN---SGEGDS--------
A0A7N4NUH6_BCL2L11      -------------QLRPGAPTSIQTQ---YQGN---SGEGDS--------
G3SU55_BCL2L11-01       -------------QLRPGAPTSLLTE---PQGN--PDGEGDS--------
A0A670KEZ9_BCL2L11      -------------HLRPGAPTSLQTV---YQGN--HSGERDT--------
A0A670Y3D3_BCL2L11      -------------HLRPGAPTSLQTE---YQGN--HLGERDS--------
A0A6I8NCK5_BCL2L11      -------------QLRPGAPTSIRTQ---YQGN--LSGGGES--------
A0A6I8NCK5_BCL2L11      -------------QLRPGAPTSIRTQ---YQ-------------------
A0A6I8NCK5_BCL2L11      -------------QLRPGAPTSIRTQ---YQ-------------------
A0A6I8NCK5_BCL2L11      -------------QLRPGAPTSIRTQ---YQ-------------------
A0A6I8NCK5_BCL2L11      -------------QLRPGAPTSIRTQ---YQ-------------------
A0A667ZMY7_BCL2L11      -------------SGGR----CRGHA---APPG--GKGDS----------
A0A2I2YVQ5_PMAIP1-      -------------PAGP-----AGTA---RDQA--GFGIEMQ--------
A0A2I3SX38_PMAIP1-      -------------PAGP-----AGTA---RDQA--GFGIGMQ--------
H2NWG2_PMAIP1-01        -------------PAGA---GTAGTA---RDQA--GFGIGMQ--------
A0A2I3HX97_PMAIP1-      -------------PAGTDPLGTAGTA---RNQA--GFGIGMQ--------
A0A2K5JY17_PMAIP1-      -------------QAG---TDPLGPA---KTQA--GRGRG----------
A0A2K5NJZ2_PMAIP1-      -------------QAGQ--AGTAGTA---RDQA--GFGIGMQ--------
A0A2K5ZWH1_PMAIP1-      -------------QAGQ--AGTAGTA---RDQA--GFGIGMQ--------
A0A2K5VPX2_PMAIP1-      -------------QAGPGTAGTAGTA---RDQA--GFGIGMQ--------
A0A2K6BV43_PMAIP1-      -------------QAGP--AGTAGTA---RDQA--GFGIGMQ--------
A0A2K6KJF1_PMAIP1-      -------------QAGP--AGTAGTA---RDQA--GLGIGMQ--------
A0A2K6NC45_PMAIP1-      -------------QAGP--AGTAGTA---RDQA--GLGIGMQ--------
Q13794_PMAIP1-02        -------------PAGP--AGTAGTA---RDQA--GFAIGMQ--------
A0A2R9AKC9_PMAIP1-      -------------PAGP-----AGTA---RDQA--GFGIGMQ--------
A0A3P8RLE2_BCL2L11      -------------GPEQKKRNGGNL-------------------------
A0A7M4F197_BCL2L11      -------------RAEPGGLGAELLG---SQVS--LQNVMAF--------
K7GA86_BCL2L11-01       -------------R----GLAEELL-------------------------
W5QCU2_BIK-01           ------------------MYQARPLS---RNLF--LYTFLQN--------
A0A3Q2LHE3_BIK-01       ------------------MSQVGPVS---RDLF--LDAFLHE--------
A0A452QUG1_BIK-01       ------------------FHTTRRCA---QRVV--APSLHHQ--------
A0A452V3L2_BIK-01       -------------RSREEMSHTGPLS---RNLF--LSTFLQE--------
A0A4W4HE29_BAD-01       -------------TSAAGQLSEVVFT---MAQM--FTISDTE--------
A0A673NIJ7_BCL2L11      -----------------PLRGGISMS---NSHQ--SRSPMCR--------
B2KKY9_BCL2L11-01       -------------GEGDPLRGGISMS---NN-Q--SRSPMNR--------
B8JK68_BCL2L11-01       -------------GEGDPLRGGISMS---NN-Q--SRSPMNR--------
A0A671M057_BCL2L11      -------------SDGDPLRGGISMS---NSHQ--SRSPMCR--------
A0A672L1R2_BCL2L11      -------------SDGDPLRGGIAMS---SSHQ--SRSPMSR--------
A0A671SJ75_BCL2L11      -------------SDGDPLRGGIAMS---NSHQ--SRSPMSR--------
A0A673IWZ7_BCL2L11      -------------SDGDPLRGGIAMS---NSHQ--SRSPMSR--------
A0A3Q1ELG4_BCL2L11      -------------APHADTT------------------------------
A0A3Q1CI15_BCL2L11      -------------AARCFTS------------------------------
A0A3B4BSH7_BCL2L11      -------------GEGD-PVRGGITM---P-NS--LLGYQSR--------
A0A3B4BSH7_BCL2L11      -------------GEGD-PVRGGITM---P-NS--LLGYQSR--------
A0A3B1JXK6_BCL2L11      -------------GDGD-PVRGPPAL---H-NS--LLGYQTR--------
A0A4W4H3Y1_BCL2L11      -------------NQGD-QFRG--GI---T-SS--LSGYHSR--------
A0A4W5NF23_BCL2L11      -------------CEGDQQSRGGIMI---P-NS--LLGFQSR--------
A0A4W5R3N6_BCL2L11      -------------SEGDQQSRGGIMM---P-NS--LLGFQSR--------
A0A1S3SAH9_BCL2L11      -------------SERDQQSRGGIMM---P-NS--LLGFQSR--------
A0A673WET2_BCL2L11      -------------SERDQQSRGGIMM---P-NS--LLGFQSR--------
A0A3P8XIA2_BCL2L11      -------------CEGNQQSRGGIMM---PTNS--LLGFQSR--------
A0A673XGV4_BCL2L11      -------------CEGDQQSLGGIMI---P-NS--LLGFQSR--------
A0A4W5R3N6_BCL2L11      -------------SEGDQQSRGGIMM---P-NS--LLGFQSR--------
A0A4W5R3N6_BCL2L11      -------------SEGDQQSRGGIMM---P-NS--LLGFQSR--------
A0A3Q3FKT9_BAD-01       -------------NDQSSAVEEPHVP---QRHS--LTLPELR--------
A0A3B1IH05_BAD-01       -------------TAEPSRSGQHITV---PEKL--RVEP-----------
A0A3B3QC78_BCL2L11      -------------EQTPIQAGPRTAK---VPGQ--LQATPRF--------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A669C520_BCL2L11      -------------LPHAFPIRQTEMY---LPPV--GATGAQT--------
A0A674AVP9_BAD-01       -------------DECESDHSGTTHN---SEFQ--LHVSTTM--------
A0A1S3L0Z2_BAD-01       -------------DECESDHSGTTRN---SEFQ--LHVSTTM--------
B5XEF1_BAD-01           -------------DECESDHSGTTRN---SEFQ--LHVSTTM--------
A0A4W5MZR2_BAD-01       -------------DECESDHSGTTHN---SEFQ--LHVSTTM--------
A0A060W8W7_BAD-01       -------------DECESDHSGTTHN---SEFQ--LHVSTTM--------
E7FBJ6_BAD-01           -------------TLDEKERSHLKGT---IKNH--GQHQDRT--------
A0A673J5Q9_BAD-01       -------------TWNDKKKGR-EET---IKNQ--GQHQDQT--------
A0A671PX91_BAD-01       -------------TWNDKKKGR-EET---IKNQ--GQHQDQT--------
A0A672LB88_BAD-01       -------------TWNDKKKGR-EET---IKNQ--GQHQDQT--------
A0A673I6H5_BAD-01       -------------TLNDKKKGR-EET---INTH--GQHQDQT--------
A0A671SBB4_BAD-01       -------------TLNDKKKGR-EET---INTH--GQHQDQT--------
A0A672R7P6_BAD-01       -------------TLNDRKKGR-EET---INTR--GQHQDQT--------
A0A3P8Y761_BAD-02       -------------GTRDGTGAYGLFW---LRNT--HIHPLIL--------
A0A3Q2QC80_BAD-01       -------------GK------VEPLR---QRHA--LTLPELR--------
A0A4W6EMZ7_BAD-02       -------------EQ------EQQIP---QRNT--VTLPELR--------
A0A3Q3FKT9_BAD-02       -------------VE------EPHVP---QRHS--LTLPELR--------
A0A3Q3FKT9_BAD-03       -------------VE------EPHVP---QRHS--LTLPELR--------
A0A3B5L9R9_BAD-01       -------------EK------EKPLS---QRHT--LTLPELR--------
A0A667ZNC6_BAD-01       -------------HQ------EQNHH---LGHA--LTTPELR--------
A0A3P9B2E4_BAD-01       -------------QA--------QES---KPQT--LSLPVTK--------
A0A668V3Q4_BAD-01       -------------QD--------QES---KPQT--LALPVIK--------
I3K7B6_BAD-01           -------------QD--------QES---KPQT--LALPVIK--------
A0A3Q3C680_BAD-01       -------------QA--------QES---KPQT--LSLPVIK--------
A0A3P8QRJ7_BAD-01       -------------QA--------QES---KPQT--LSLPVTK--------
A0A3Q4GGN3_BAD-01       -------------QV--------QES---KPQT--LSLPVIK--------
A0A3B4GXJ6_BAD-01       -------------QA--------QES---KPQT--LSLPVIK--------
A0A3Q2D5S0_BAD-01       -------------RN--------------------------S--------
A0A3Q0QNQ2_BAD-01       -------------SQ----------A---IGHD--QNTSPMR--------
A0A3P8WI83_BAD-02       -------------DP------EQVVP---HRHN--LTLPELR--------
A0A3P8WI83_BAD-01       -------------DP------EQVVP---HRHN--LTLPELR--------
A0A3P9HNZ2_BAD-01       -------------GG-GGGGEGEHLH---DRHS--LTLPELR--------
A0A3B3BQF7_BAD-01       -------------GGEGGGGGGGHLH---DRHA--LTLPELR--------
A0A672JQ68_BAD-01       -------------PA------DQRVR---RRLD--LSLNEFN--------
A0A2U9BAC9_BAD-01       -------------GP------GEQVP---PRHT--LALPELR--------
A0A4W6EMZ7_BAD-01       -------------EQ------EQQIP---QRNT--VTLPELR--------
A0A3B4VFC5_BAD-01       -------------GQ------EQELS---QRHT--LTLPELR--------
A0A3B4W9T1_BAD-01       -------------GQ------EQELS---QRHT--LTLPELR--------
A0A3Q1K1C7_BAD-01       -------------GQ------EQQVF---PRHT--LTLPELR--------
A0A672YF93_BAD-01       -------------EQ------EQQIS---YSHS--LTLPELR--------
A0A3Q1GWH9_BAD-01       -------------TE------AMPVF---ARRN--MALPELR--------
A0A3Q1CPU7_BAD-01       -------------TQ------AMPVF---ARRN--MALPELR--------
A0A3P8TWH6_BAD-01       -------------TQ------AMPVF---ARRN--MALPELR--------
H3D8J8_BAD-01           -------------S------------------------------------
A0A6F9CQZ0_BAD-02       -------------GQ-----GMTGGP---LGHT--LTVPEMR--------
A0A6F9CA11_BAD-02       -------------GK-----GMTGGP---LGHA--LT-------------
A0A1S3N9Q3_BAD-01       -------------GK-----GMTGGP---IGHA--LTVPEMR--------
A0A6F9BAV3_BAD-01       --------------------------------------MSTR--------
A0A3P8YI30_BAD-02       -------------THYPEFQ---------FCNT--STNTSNR--------
A0A4W5R1T6_BAD-01       -------------THYPEFQ---------LHTV--STTTSTR--------
A0A060W8P9_BAD-01       -------------THYPEFQ---------LHNV--STTTSIR--------
B5X1T1_BAD-01           -------------THYPEFQ---------RHYV--STRTGIR--------
A0A673ZHY7_BAD-01       -------------THYPEFQ---------LHYV--STRTSIR--------
A0A671NP27_BAD-01       -------------NSGSPQK-----T---NHDL--AVPD-----------
A0A672SAE4_BAD-01       -------------NSGSPQK-----T---NHDL--AVPD-----------
A0A672SAE4_BAD-02       -------------NSGSPQK-----T---NHDL--AVPD-----------
A0A671RUV0_BAD-01       -------------NSGSPQR-----K---QH-L--AVPD-----------
A0A673HRQ3_BAD-01       -------------NSGSPQR-----K---QH-L--AVPD-----------
A0A672RGH0_BAD-01       -------------NSGSPQR-----T---QH-L--AVPG-----------
Q4V925_BAD-02           -------------KSGSAQK-----K---QH-L--TVPD-----------
Q4V925_BAD-03           -------------KSGSAQK-----K---QH-L--TVPD-----------
A7MCM4_BAD-01           -------------KSGSAQK-----K---QH-L--TVPD-----------
Q4V925_BAD-01           -------------KSGSAQK-----K---QH-L--TVPD-----------
Q4V925_BAD-04           -------------KSGSAQK-----K---QH-L--TVPD-----------
A0A3B3QX41_BAD-01       -------------LGNNLKN------------------TKNP--------
A0A3Q3RXS8_BAD-01       -------------SARQEQQ--V-SQ---RHAL--ALPELRT--------
A0A3Q0QNQ2_BAD-02       -------------EGSFLLL--VSVI---SFFW--SLPKAFS--------
A0A3Q3WTY4_BAD-01       -------------QTEQEQQ--V-FQ---RHTL--TLPELRM--------
A0A3P8Y761_BAD-01       -------------IAGQGKT-GS-RL---GLSL--NLP------------
A0A4W5JLL9_BAD-01       -------------AAGKGMT-GG-PI---GHAL--TVPEMRL--------
A0A3B5Q2N7_BAD-01       -------------MQEKEKP--L-SQ---RHTL--TLPELRS--------
A0A087X8P8_BAD-01       -------------MQVKERP--L-SQ---RHTL--TLPELRS--------
A0A3B3UA11_BAD-01       -------------MQVKERP--L-SQ---RHTL--TLPELRS--------
A0A3B3YFR1_BAD-01       -------------MQVKERP--L-SQ---RHTL--TLPELRS--------
A0A3P9Q7C3_BAD-01       -------------MQVKERP--L-SQ---RHTL--TLPELRS--------
A0A3B3HDU2_BAD-01       -------------AAAGGEGEHL-HD---RHSL--TLPELRL--------
A0A3P9KSL7_BAD-02       -------------AAAGGEGEHL-HD---RHSL--TLPELRL--------
A0A3P9KSL7_BAD-01       -------------AAAGGEGEHL-HD---RHSL--TLPELRL--------
A0A3B5BAL2_BAD-01       -------------PAEQPMH--V-FE---RRNL--ALPELRT--------
A0A665TUH3_BAD-01       -------------L---EQE--V-FQ---RHNL--TLPEIRT--------
A0A674MXC1_BAD-04       -------------LSEQERQ--V-LQ---RHTL--TLPELRL--------
A0A674MXC1_BAD-01       -------------LSEQERQ--V-LQ---RHTL--TLPELRL--------
A0A674MXC1_BAD-02       -------------LSEQERQ--V-LQ---RHTL--TLPELRL--------
A0A674MXC1_BAD-03       -------------LSEQERQ--V-LQ---RHTL--TLPELRL--------
A0A671TL42_BAD-01       -------------PAEEGQQ--V-SQ---RHAL--TLPELRM--------
A0A3Q3AEL8_BAD-01       -------------AAGPEDG-----V---RQRL--TLPELRH--------
A0A3Q3AEL8_BAD-02       -------------AAGPEDG-----V---RQRL--TLPELRH--------
A0A1A8AQV0_BAD-01       -------------SAGQEES-----V---RPHP--NLPELRL--------
G3Q8B3_BAD-01           -------------SSGQEQQ--R-LQ---RHTL--TLPELRL--------
A0A3Q2Y0E4_BAD-01       -------------AAEKEQEQCL-RQ---GLRL--TLPELPM--------
A0A3Q3R5S3_BAD-01       -------------STSQEQQ--V-PP---CHSL--TLPELRM--------
F7GL32_BBC3-02          -------------VEGLPRESPRTFP---LGRL--M--------------
A0A4X2LVY2_BBC3-01      -------------VEGLPREGPRTFP---LGRL--M--------------
A0A4X2LVY2_BBC3-02      -------------VEGLPREGPRTFP---LGRL--M--------------
A0A3Q3ESW6_BCL2L11      -------------PQTSRSDNSGGRN------------FGRT--------
A0A3P9N073_BCL2L11      -------------ASSARTPRSSKHT---ERSC--APQAGAS--------
A0A3Q3B113_BCL2L11      -------------PPSAGAARGSAHA---TR-----PVRGRA--------
A0A3B5M375_BCL2L11      -------------ASSARTPRSSKHT---ERSR--APQAGAS--------
A0A3B5QAM1_BCL2L11      -------------ASSARTPRSSKHT---ERSR--APQAGAS--------
A0A3B5QAM1_BCL2L11      -------------ASSARTPRSSKHT---ERSR--APQAGAS--------
A0A672RK14_BMF-01       -------------GEVGQTANRHGRF---EDRS--TQTASSV--------
A0A673JJ10_BMF-01       -------------GEVGQTANRHGRF---EDRS--TQTARTV--------
A0A4W6ETK4_BCL2L11      -------------WLDRSNGKRGERR---RSTR--RRCRWSL--------
A0A4W6ETK4_BCL2L11      -------------HVDGAAGASAQTS---RSND--GGG------------
A0A4W6ETK4_BCL2L11      -------------HVDGAAGASAQTS---RSND--GGG------------
A0A3B4V919_BCL2L11      -------------WLDRSNGKRGERR---GSTT--RRCRWSP--------
A0A3B4XZH1_BCL2L11      -------------WLDRSNGKRGERR---GSTT--RRCRWSP--------
A0A3Q2SZH6_BCL2L11      -------------ASSARTPRLSKHR---EGSC--AQPPGAV--------
A0A3B3VNE0_BCL2L11      -------------ASSARTPRSSKHT---ERSC--APQTGAS--------
A0A3B3YII5_BCL2L11      -------------ASSARTPRSSKHT---ERSC--APQAGAS--------
A0A3B3YII5_BCL2L11      -------------ASSARTPRSSKHT---ERSC--APQAGAS--------
A0A3Q3K6I5_BCL2L11      -------------PSVGAAGTSAQSS---RSNG--GSERSFG--------
A0A3Q1ICY2_BCL2L11      -------------PPVGAAGVSTPTS---RSND--GGERRFG--------
A0A671W556_BCL2L11      -------------SPAGAAGASAQTS---RSDT--GGVPSSG--------
A0A6I8NF73_BMF-01       -------------AQPGGPAPAAPLT---PGQP--YSYLVGQ--------
Q9GL49_PMAIP1-01        -------------IRGLLESAGWE--------------------------
A0A5F8GA49_BAD-01       --------------------------------------------------
H3ANP3_BAD-03           -------------LQSGGGRGEGSEP---SEKT-----------------
H3ANP3_BAD-01           -------------LQSGGGRGEGSEP---SEKT-----------------
H3ANP3_BAD-02           -------------LQSGGGRGEGSEP---SEKT-----------------
H3ANP3_BAD-04           -------------LQSGGGRGEGSEP---SEKT-----------------
G3VRY3_BAD-03           ----------------PGEDPS----------------------------
G3VRY3_BAD-02           ----------------PGEDPS----------------------------
G3VRY3_BAD-01           ----------------PGEDPS----------------------------
A0A4X2KAA5_BAD-01       -------------AYAPGESRGLG--------------------------
A0A672V9F8_BAD-01       ----------------PSAAMSPA--------------------------
A0A674GQ16_BAD-01       -------------SPSPSQPGTPS--------------------------
A0A6I8NVP2_BAD-01       -------------GGDPSQAPAGP--------------------------
G3TP47_BAD-01           -------------GLGPSPEGYWP--------------------------
Q61337_BAD-05           -------------GLGPSLTEDQP--------------------------
Q61337_BAD-06           -------------GLGPSLTEDQP--------------------------
Q61337_BAD-03           -------------GLGPSLTEDQP--------------------------
Q61337_BAD-04           -------------GLGPSLTEDQP--------------------------
Q61337_BAD-02           -------------GLGPSLTEDQP--------------------------
Q61337_BAD-01           -------------GLGPSLTEDQP--------------------------
A0A287CT05_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A287CT05_BAD-02       -------------GLGPSPAGDRP--------------------------
G5B6Q3_BAD-01           -------------ALGPTPTGDRL--------------------------
G5B6Q3_BAD-02           -------------ALGPTPTGDRL--------------------------
G1P8C5_BAD-01           -------------GLGPCPTGDQP--------------------------
A0A452ER54_BAD-02       -------------GLGPSPTGDRP--------------------------
W5P8G9_BAD-01           -------------GLGPSPTGDRP--------------------------
Q61337_BAD-07           -------------GLGPSLTEDQP--------------------------
H0WVR2_BAD-01           -------------GLGPSPSGDQP--------------------------
A0A2K6GWV0_BAD-01       -------------GLGPSPSGDRP--------------------------
F7DN67_BAD-01           -------------GLGPSPTGDWP--------------------------
Q45KI9_BAD-01           -------------GLGPSPTGDRP--------------------------
A0A3Q7SWS0_BAD-01       -------------GLGPSPTGDRP--------------------------
B4DZQ9_BAD-01           -------------GLGPSPAGDGP--------------------------
A0A2J8TYJ3_BAD-02       -------------GLGPSPAGDRP--------------------------
A0A2I2YFH2_BAD-02       -------------GLGPSPAGDGP--------------------------
A0A2I2YFH2_BAD-01       -------------GLGPSPAGDGP--------------------------
Q92934_BAD-01           -------------GLGPSPAGDGP--------------------------
Q92934_BAD-02           -------------GLGPSPAGDGP--------------------------
A0A2I3TBK7_BAD-02       -------------GLGPSPAGDGP--------------------------
A0A2R8Z674_BAD-01       -------------GLGPSPAGDGP--------------------------
A0A2J8TYJ3_BAD-03       -------------GLGPSPAGDRP--------------------------
H0V608_BAD-01           -------------GLGPSPTGDEL--------------------------
A0A2K5PDB1_BAD-01       -------------GLNPSTAGDSP--------------------------
U3F2S3_BAD-01           -------------GLSPSTAGDRP--------------------------
A0A2K5E6A6_BAD-01       -------------GLSPSTAGDRP--------------------------
A0A2K6TG62_BAD-01       -------------GLSPSTAGDSP--------------------------
A0A2K5M0A7_BAD-01       -------------GLGPSLAGDRP--------------------------
A0A1D5QBW1_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A2K6E7I4_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A2K5XJR2_BAD-01       -------------GLGPSLAGDRP--------------------------
A0A2K6N196_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A2K6PUL3_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A2K5HKU7_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A0D9R491_BAD-01       -------------GLGPSPAGNRP--------------------------
A0A2K5VCA1_BAD-01       -------------GLGPSPAGNRP--------------------------
A0A4X1VE31_BAD-02       -------------GLGPSPTGDRP--------------------------
A0A4X1VE31_BAD-01       -------------GLGPSPTGDRP--------------------------
A0A287AEF3_BAD-01       -------------GLGPSPTGTDP--------------------------
A0A4X1VE31_BAD-03       -------------GLGPSPTGDRP--------------------------
A0A671ELU4_BAD-01       -------------GLGPSPTGDQP--------------------------
A0A452ER54_BAD-01       -------------GLGPSPTGDRP--------------------------
A0A452RJM6_BAD-01       -------------GLGPSPTGDQP--------------------------
A0A384DJL2_BAD-01       -------------GLGPSPTGDQP--------------------------
M3YNE7_BAD-01           -------------GLGPSPTGDQP--------------------------
A0A667H8Z9_BAD-01       -------------GLGPSPTGDRP--------------------------
A0A673V6P8_BAD-01       -------------GLGPSPTGDRP--------------------------
A0A4W2C9A8_BAD-01       -------------GLGPSPTGDRP--------------------------
A0A4W2C9A8_BAD-01       -------------GLGPSPTGDRP--------------------------
F1MUT9_BAD-01           -------------GLGPSPTGDRP--------------------------
Q3SYZ0_BAD-01           -------------GLGPSPTGDRP--------------------------
A0A4U1FMC3_BAD-01       -------------GLGPSPTGDRP--------------------------
A0A2Y9EHU3_BAD-01       -------------GLGPSPTGDKP--------------------------
A0A2I3TBK7_BAD-01       -------------GLGPSPAGDGP--------------------------
A0A2R8Z674_BAD-02       -------------GLGPSPAGDGP--------------------------
A0A2I2YFH2_BAD-03       -------------GLGPSPAGDGP--------------------------
Q92934_BAD-03           -------------GLGPSPAGDGP--------------------------
A0A2K5M0A7_BAD-02       -------------GLGPSLAGDRP--------------------------
A0A2K5XJR2_BAD-02       -------------GLGPSLAGDRP--------------------------
A0A2K6E7I4_BAD-02       -------------GLGPSPAGDRP--------------------------
A0A2K5PDB1_BAD-02       -------------GLNPSTAGDSP--------------------------
A0A2K5E6A6_BAD-02       -------------GLSPSTAGDRP--------------------------
A0A2K6TG62_BAD-02       -------------GLSPSTAGDSP--------------------------
A0A2K5HKU7_BAD-02       -------------GLGPSPAGDRP--------------------------
A0A2K6N196_BAD-02       -------------GLGPSPAGDRP--------------------------
A0A2K6PUL3_BAD-02       -------------GLGPSPAGDRP--------------------------
A0A2J8TYJ3_BAD-01       -------------GLGPSPAGDRP--------------------------
A0A2K5M0A7_BAD-03       -------------GLGPSLAGDRP--------------------------
A0A2K5XJR2_BAD-03       -------------GLGPSLAGDRP--------------------------
A0A2K6E7I4_BAD-03       -------------GLGPSPAGDRP--------------------------
A0A2I2YFH2_BAD-04       -------------GLGPSPAGDGP--------------------------
Q92934_BAD-04           -------------GLGPSPAGDGP--------------------------
A0A2I3TBK7_BAD-03       -------------GLGPSPAGDGP--------------------------
A0A2R8Z674_BAD-03       -------------GLGPSPAGDGP--------------------------
A0A2K5E6A6_BAD-03       -------------GLSPSTAGDRP--------------------------
A0A2K5PDB1_BAD-03       -------------GLNPSTAGDSP--------------------------
A0A2K6TG62_BAD-03       -------------GLSPSTAGDSP--------------------------
A0A2K6KS56_BBC3-01      -------------VEGW-PRRPSPLP---ARP--------VL--------
A0A2I3RGH5_BBC3-04      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
A0A2K5F6X4_BBC3-03      -------------RRGPGPRRPAPLP------------------------
A0A2K6FQZ1_BBC3-02      -------------RRGPGPRRPAPLP---ARPP--GALGRVL--------
A0A671F3X5_BBC3-01      -------------RRGPGPRRPAPLP---TQPP--GALGCVL--------
A0A5F5PGZ4_BBC3-01      -------------GRGPGPRRPAPLP---AQPP--GALGRVL--------
A0A2I3HWI8_BBC3-02      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
A0A2K5QNS7_BBC3-01      -------------RRGPGPRRPAPLP---ARPP--GALGRVL--------
A0A2K5P2T8_BBC3-01      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
A0A2K6QZT2_BBC3-02      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
A0A2K6ASP2_BBC3-01      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
A0A2I3N2Z9_BBC3-01      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
Q9BXH1_BBC3-03          -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
A0A2I3RGH5_BBC3-02      -------------RRGPGPRRPAPLP---ARPP--GALGSVL--------
H2NZD3_BBC3-01       &nbs