Dataset for protein classical BH3-containing proteins of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

567 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2R8MW85_BBC3-03      -------------------------------------RKPPALHRRPLRR
C1KGB6_BCL2L11-02       ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
C1KGB6_BCL2L11-03       ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
C1KGB6_BCL2L11-01       ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
J9NWV6_BCL2L11-01       TRPA----------------------------------------------
A0A3Q2GRS5_BCL2L11      MFPA----------------------------------------------
A0A3Q2GRS5_BCL2L11      MFPA----------------------------------------------
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A2AV74_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           --------------------------------------------------
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       ------------------------------------MGTPENPLSAPTHV
A0A2R8MW85_BBC3-03      VHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQCGRPA---------
C1KGB6_BCL2L11-02       HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
C1KGB6_BCL2L11-03       HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
C1KGB6_BCL2L11-01       HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
J9NWV6_BCL2L11-01       ------------------------GGRAGGARRGTRPGHPRLYLLEPERA
A0A3Q2GRS5_BCL2L11      ------------------------AAAGAARARGA---------------
A0A3Q2GRS5_BCL2L11      ------------------------AAAGAARARGA---------------
J9NTK9_BBC3-03          ----------------------------------MPCVTPRL--------
J9NTK9_BBC3-02          ----------------------------------MPCVTPRL--------
A0A3Q2GWE8_BBC3-01      ------------------------VRVSAGAARACLCQAPGASFSPWVPQ
Q9BXH1_BBC3-03          ------------------------MKFGMGSAQACPCQVPRAASTTWVPC
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A2AV74_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           --------------------------------------------------
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       PGPGMSGTEQREARKGPRTKAVGR--------------------------
A0A2R8MW85_BBC3-03      ----SPHCASPQTPRGTLGWGRGE--------------------------
C1KGB6_BCL2L11-02       SGC-SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAP
C1KGB6_BCL2L11-03       SGC-SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAP
C1KGB6_BCL2L11-01       SGC-SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAP
J9NWV6_BCL2L11-01       SRCGAAGRGGASGPRGGAGPGGGG--------------------------
A0A3Q2GRS5_BCL2L11      ----ARGALGCPAERGGGGRAASG--------------------------
A0A3Q2GRS5_BCL2L11      ----ARGALGCPAERGGGGRAASG--------------------------
J9NTK9_BBC3-03          ---GPRERHGPSTPGGQLPGARRG--------------------------
J9NTK9_BBC3-02          ---GPRERHGPSTPGGQLPGARRG--------------------------
A0A3Q2GWE8_BBC3-01      QTRGPRERHGPSTPGGQLPGAGRG--------------------------
Q9BXH1_BBC3-03          QICGPRERHGPRTPGGQLPGARRG--------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A2AV74_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           --------------------------------------------------
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       ----------------------EQVPRRGRRLGRKRPRPLASPGDISKAD
A0A2R8MW85_BBC3-03      -------------GGGSALGRLVWAHRCLGGLAGLFTNNGVRARQRPLAA
C1KGB6_BCL2L11-02       RSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAA------
C1KGB6_BCL2L11-03       RSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAA------
C1KGB6_BCL2L11-01       RSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAA------
J9NWV6_BCL2L11-01       -------------ARGDWLRARGRQSERSCRAVQVSLRSAQPPG------
A0A3Q2GRS5_BCL2L11      ------------------------------RLCAVLAPLSASPG------
A0A3Q2GRS5_BCL2L11      ------------------------------RLCAVLAPLSASPG------
J9NTK9_BBC3-03          ---------------PGPRRSAPVSPQPPGALGRVLRPLRARPARRPCCP
J9NTK9_BBC3-02          ---------------PGPRRSAPVSPQPPGALGRVLRPLRARPARRPCCP
A0A3Q2GWE8_BBC3-01      ---------------PGPRRPAPLPAQPPGALGRVLRPLRARPARRARRA
Q9BXH1_BBC3-03          ---------------PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRP
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A2AV74_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           --------------------------------------------------
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       -------------------------------------------------M
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      -----------------------------------MFPAAATRAARARGA
M3YDI3_BCL2L11-01       -----------------------------------MFPAAAAGAARARGA
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          ---------MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQG
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          ------------MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLG
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       WAGSVTV-------PVAQATRAGLPQYW----------------------
A0A2R8MW85_BBC3-03      SATPGKRVDPGVPQPPKSGRGGGAARRG---GHTQGARPLGAATGGGSRA
C1KGB6_BCL2L11-02       SIASDCW-----VRPAPAAATHSAPFPW----------------------
C1KGB6_BCL2L11-03       SIASDCW-----VRPAPAAATHSAPFPW----------------------
C1KGB6_BCL2L11-01       SIASDCW-----VRPAPAAATHSAPFPW----------------------
J9NWV6_BCL2L11-01       LGLARGLRPASPPPPPPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLW
A0A3Q2GRS5_BCL2L11      LCLPRCL----------SGDNQGAPGRR----------------------
A0A3Q2GRS5_BCL2L11      LCLPRCL----------SGDNQGAPGRR----------------------
J9NTK9_BBC3-03          CPAARCL----PLRPHRPARRHRRPGGP-------------PLAWGSPQP
J9NTK9_BBC3-02          CPAARCL----PLRPHRPARRHRRPGGP-------------PLAWGSPQP
A0A3Q2GWE8_BBC3-01      RPAARCL----PLRPRRPARRHRRPGGP-------------PLAWGPPQP
Q9BXH1_BBC3-03          HPAARCL----PLRPHRPTRRHRRPGGF-------------PLAWGSPQP
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------MTRTSPGQKKRPRWEWLW
A0A337ST43_BMF-04       --------------------------------MTRTSPGQKKRPRWEWLW
A2AV74_BMF-01           ----------------------------------------MPGAGVFWKQ
A0A286XXB0_BMF-02       --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           ------------------------------------------MPRAGVFW
A0A287CXH0_BMF-01       --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           --------------------------------------------------
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      ----------------------------------MPARVCAPVSQAVDIV
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       GRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERRGLA
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      ARGAVGCPAERSGGLAGRRGLCAAPGTLNPSPGLCLLHCLRGDGQGPPGR
M3YDI3_BCL2L11-01       ARGALGCRTARGGGRAASGRLCAAPGALKASPRLCLPRFFRAEGQGAPGR
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      -----------------------------------------------MPL
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       ----------------------------------------MSNQYLLKLR
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          LGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARG
J9NTK9_BBC3-01          -------MQGLPGHVPVRCSGFPSG----------PVGPPSDLCQARLDV
F1RM01_BBC3-04          LVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDAPCTSQLTV
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      ---------------MKLSVGAARACSCQVPRVASCGWAHALFVWSLARC
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       REAAGPGQGPRDRAWAQSMFQIPEFEPSEQEDSSPTDRGLGPSPTGDR--
A0A2R8MW85_BBC3-03      VESAAPAGGGCAPA----TAGYWPRARLAGGAGARGGGGGGCDSGVGRLG
C1KGB6_BCL2L11-02       -----PSSPQCLTL----TLGLRNARKKDQMAKQPSDVSSECDREGGQLQ
C1KGB6_BCL2L11-03       -----PSSPQCLTL----TLGLRNARKKDQMAKQPSDVSSECDREGGQLQ
C1KGB6_BCL2L11-01       -----PSSPQCLTL----TLGLRNARKKDQMAKQPSDVSSECDREGGQLQ
J9NWV6_BCL2L11-01       RPFLGPRPPQCLTL----TLGLRNARKKDQMAKQPSDVSSECDREGGQLQ
A0A3Q2GRS5_BCL2L11      KARAGRRGARARTR----RSEGKGRIKKDQMAKQPSDVSSECDREGGQLQ
A0A3Q2GRS5_BCL2L11      KARAGRRGARARTR----RSEGKGRIKKDQMAKQPSDVSSECDREGGQLQ
J9NTK9_BBC3-03          APRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVG
J9NTK9_BBC3-02          APRPAPRRSSALTVAGGTAPGIAGAQRPGGPGGRSHPSSPGSPGGGGAVG
A0A3Q2GWE8_BBC3-01      SPSPAPRRSTALTLAGRAAPGVAGAQRPGGPGGRPHPGSPGSPGGGGAVG
Q9BXH1_BBC3-03          APRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVG
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       EGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISVGPHFPQVEGKGER
A0A337ST43_BMF-04       EGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVISVGPHFPQVEGKGER
A2AV74_BMF-01           YRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVF
A0A286XXB0_BMF-02       ------------------------MPGAGVFWKQYRARRRRRGPDPPRVF
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           KQYRTVLSLVHQRPPALAAAAVRSPRLPPLPAELFPSFPIESGRQAPRVL
A0A287CXH0_BMF-01       --MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVF
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           ------------------------------------------MGAREGLG
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------MSTAARAAAGTCDSTAVSQPSKLD
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           ---------------------------GPPENPSPASTHAQGVRMSGAEH
A0A1U7Q4V0_BAD-01       --------------------------MGTPKQPSLAPAHALGVRKS---D
Q61337_BAD-01           --------------------------MGTPKQPSLAPAHALGLRKS---D
A0A287CT05_BAD-02       --------------------------MGIPEKALIASTHAPGARKSGKEG
A0A287CT05_BAD-01       --------------------------MGIPEKALIASTHAPGARKSGKEG
O35147_BAD-01           ----------------------------MGTPKQPSLAPAHALGLRKSDP
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------MGIPENPSSASTHTQGIRKSGAEP
G1MI17_BAD-01           ----------------------------VGTPENPSSAPTHGPGKRKSGT
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       ----------------------------------MGTPENPSAAPTTRKL
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       -----------------------MSNQYLQKLRRARFNCEEERYKKVIKT
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       ---------MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLP-
A0A3Q3FKT9_BAD-03       -------------MKCNNKCYHF--IRLVFVKKQSVICAGYGTVNTFGPA
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
Q6P7C5_BAD-01           ---------------------------------------MGTPKQPSLAP
A3KND0_BMF-01           ---------------------------------------MDELDDDVFYP
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           -------------------------MVQGSHQVALRLACIGDEMDLCFQD
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------MRKRRRHAAAKRQTWDSNSGPLVS
F7FUT7_BIK-02           --------METPECAPVSGAGKTATHETKQVCRTAGGREAVNKPTGRTCS
F7FUT7_BIK-01           --------------------------------MPQGAVRHYPSPRGRLPP
O61667_EGL1-01          --------------MLMLTFASTSSDLLPMSNVFDVQSSVFYNEKNMFYS
A0A3G3M2M0_BCL2L11      -----------------------MSDTSREQTPGNVPASRGSGESAGVGA
A0A3Q1ELG4_BCL2L11      -----------------------SSSAASPAAPHADTTEGGGADPEPVGA
A0A3Q1CI15_BCL2L11      -----------------------PTKSGPDAAARCFTSGSRCRDSERL--
F1SMU1_PMAIP1-01        ----------------------------ARAAAGAPTSEAFGRSGCCFSS
Q9BXH1_BBC3-04          ------------MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAAAAP
A0A3B4UNJ0_BMF-01       ---------------------------------------MDDEEEDMSQP
B2KKY9_BCL2L11-01       ---------------------------------------MSDTSREQTLA
B8JK68_BCL2L11-01       ---------------------------------------MSDTSREQTLA
A0A3B4B6Y3_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3P9ICE1_BMF-01       ----------------------MCLSGISGHSSYSAPPRMDDEEDDVFEP
Q0GKC7_BMF-01           ---------------------------------------MDEDEDDVFRK
A0A3B3RH63_BMF-01       ---------------------------------------MDDDDDDVFHT
W5N4P7_BMF-01           ---------------------------------------MEEDEDDVFHP
A0A3B1K1X5_BMF-01       ---------------------------------------MDDEEDDVFVT
A0A3B4CNJ8_BMF-01       ---------------------------------------MDEDEDDVFVM
A0A2U9CJH3_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q2YCX7_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3Q2YCX7_BMF-02       ---------------------------------------MEDEEDDVFEP
A0A3P8ZIE7_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3Q2PJX9_BMF-02       ---------------------------------------MEDEEDDVFEP
A0A3Q3QZ16_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q3QZ16_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3Q2PJX9_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3Q2PJX9_BMF-03       ---------------------------------------MEDEEDDVFEP
A0A3B5QK08_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3B5QK08_BMF-02       ---------------------------------------MEDEEDDVFEP
A0A096LRV0_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3B3WU80_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3P9Q8E2_BMF-01       ---------------------------------------MEDEEDDVFEP
A0A3Q2CXC4_BMF-02       ---------------------------------------MEEEEDDVFEP
A0A3Q2CXC4_BMF-01       ---------------------------------------MEEEEDDVFEP
A0A3Q3GUU5_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3B5B8F6_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q3VLX6_BMF-01       ---------------------------------------MDDDEDDVFEP
A0A3P8UA78_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3P8UA78_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3P8UA78_BMF-03       ---------------------------------------MDDEEDDVFEP
A0A3B3CGR9_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3P9K487_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3P9K487_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3B3HAU1_BMF-03       ---------------------------------------MDDEEDDVFEP
A0A3B3HAU1_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3B3HAU1_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3B3HAU1_BMF-04       ---------------------------------------MDDEEDDVFEP
A0A3P9ICE1_BMF-04       ---------------------------------------MDDEEDDVFEP
A0A3Q2ZA20_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3P8NFE2_BMF-02       ---------------------------------------MDDEEDDVFEP
I3K2D6_BMF-01           ---------------------------------------MDDEEDDVFEP
A0A3P8NFE2_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q3C5V2_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3P9DPJ5_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3P9DPJ5_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3B4ETH0_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q4G1I4_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q1FVH7_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3Q1FVH7_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q3RVI2_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q1D1K3_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3P8RKY9_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q3RVI2_BMF-02       ---------------------------------------MDDEEDDVFEP
A0A3Q1IPR4_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3B4U5H8_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3B4WM88_BMF-01       ---------------------------------------MDDEEDDVFEP
A0A3Q3SYA1_BCL2L11      --------------------MATEESGDPPAGDPRVSAQTSRSNGGTDQS
R4G9R5_BCL2L11-01       -----------------------------MLVVGSSQPQLCLL-------
A0A3B3QC78_BCL2L11      -------------------------MGQILLTIPCSVCSAEDKITRMAES
F7CXT2_BCL2L11-01       -----------------------------MAKQPSDLNSECDREGGQLQP
F7FTC8_BCL2L11-01       -----------------------------MAKQPSDLNSECDSEGGRLEP
A0A2R8M6L7_BCL2L11      TVFCLGLRSLVPPSTKQKLCLYYFRKRDQMAKQPSDVSSECDREGRQLQP
G3SU55_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
G3W979_BCL2L11-01       -----------------------------MAKQPSDLNSECDREGGQLQP
U3IW89_BCL2L11-01       -----------------------------GGAGKHGAGTGRDGRGGQRQP
A0A3Q2U844_BCL2L11      -----------------------------MAKQPPEAKAPRDRRAGRLPP
C1C3S9_BAD-01           -----------------------------MGDSPHKSMFSIE----EFPP
A0A3P8XIA2_BCL2L11      --------------------------------RESSCEGNQQSRGGIMMP
A0A452IFQ4_BAD-01       --------------------------MFRIQEFPDEVFPGRGKEAPAPPE
K7GA86_BCL2L11-01       EELLLEPDSLLFRQSLSASYSLDAGKGDQMAKQPSDLNSECDGEGGQFQS
O43521_BCL2L11-20       -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2R8M6L7_BCL2L11      RKARVGRRGAPSRARTLRSEGKARTKRDQMAKQPSDVSSECDREGRQLQP
M3YDI3_BCL2L11-01       RRTRAGRRGA--RARTRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQP
F7CXT2_BCL2L11-02       -----------------------------MAKQPSDLNSECDREGGQLQP
G1SSY0_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
J9NWV6_BCL2L11-06       -----------------------------MAKQPSDVSSECDREGGQLQP
C1KGB8_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A3Q2GRS5_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
U6CTE3_BCL2L11-04       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A1U7T0R1_BCL2L11      -----------------------------MAKQPSVVSSECDREGGQLQP
J9NWV6_BCL2L11-02       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A2K6TRU4_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5NU92_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2I2YQ13_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5X1Y3_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6QIL2_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5HZI5_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2I3GVB2_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2R9C366_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2I3SN61_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5HZI5_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2I2YQ13_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6QIL2_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5Q1Y0_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6GE31_BCL2L11      -----------------------------MAKQPSDVGSECDREGGQLQS
A0A1U7T0R1_BCL2L11      -----------------------------MAKQPSVVSSECDREGGQLQP
A0A1U7T0R1_BCL2L11      -----------------------------MAKQPSVVSSECDREGGQLQP
O54918_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
O88498_BCL2L11-01       -----------------------------MAKQPSDVNSECDREGGQLQP
A0A2K5Z7V3_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A096NYC3_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5X1Y3_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6E212_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5NU92_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A096NYC3_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6KJP8_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2I3SN61_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2R8M6L7_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5CA89_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5Q1Y0_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A1U7T0R1_BCL2L11      -----------------------------MAKQPSVVSSECDREGGQLQP
A0A1U7T0R1_BCL2L11      -----------------------------MAKQPSVVSSECDREGGQLQP
A0A3Q2GRS5_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
J9NWV6_BCL2L11-04       -----------------------------MAKQPSDVSSECDREGGQLQP
U6CTE3_BCL2L11-02       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A1U8BW10_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A1U7T0R1_BCL2L11      -----------------------------MAKQPSVVSSECDREGGQLQP
A0A2K6GE31_BCL2L11      -----------------------------MAKQPSDVGSECDREGGQLQS
A0A287DFJ0_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A452FCR6_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
W5PY58_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
L8IVA4_BCL2L11-02       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A286XJN2_BCL2L11      -----------------------------MAKQPSDVSCECDREGGQLQP
A0A286XJN2_BCL2L11      -----------------------------MAKQPSDVSCECDREGGQLQP
G1SSY0_BCL2L11-02       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A250YBV9_BCL2L11      -----------------------------MAKQPSDASSECDREGGQLQP
H0XW23_BCL2L11-01       -----------------------------MAKQPSDVGSECDREGGQLQP
A0A1S3FFM9_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
U6CTE3_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
G1LDR8_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
J9NWV6_BCL2L11-03       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A2I2UX96_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
O54918_BCL2L11-03       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A1U8BW10_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
J9NWV6_BCL2L11-05       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A3Q2GRS5_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A452U4S4_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A2R9C366_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2I3GVB2_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6TRU4_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A0D9RWE0_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
U6CTE3_BCL2L11-03       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A2K6E212_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
H2P5E2_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGRQLQP
A0A250YBV9_BCL2L11      -----------------------------MAKQPSDASSECDREGGQLQP
A0A286XJN2_BCL2L11      -----------------------------MAKQPSDVSCECDREGGQLQP
A0A2I2UX96_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A1S3FFM9_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A452SBG5_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A3Q1MV27_BCL2L11      SVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQLQP
A0A1U8BW10_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A287DFJ0_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
L8IVA4_BCL2L11-01       -----------------------------MAKQPSDVSSECDREGGQLQP
A0A3Q1MV27_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A452FCR6_BCL2L11      -----------------------------MAKQPSDVSSECDREGGQLQP
A0A2K5CA89_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K5Z7V3_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A2K6KJP8_BCL2L11      -----------------------------MAKQPSDVSSECDREGRQLQP
A0A3P8RLE2_BCL2L11      --------------------------------ANRTPSLVGPEQKKRNGG
A0A3B1JLM2_BAD-01       RARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWNSSGSTVFTMEKTPP
Q61337_BAD-05           -----------------------MFQIPEFEPSEQEDA----------SA
A0A3B1JXK6_BCL2L11      ----------------------------MSRPSNRATRPPFLKEQGERGQ
A0A3B4BVX1_BCL2L11      ---LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQ
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          -----------------------MARAQQDG--------------SSPEP
F7GL32_BBC3-01          VAPPLTCSAHLSVSLRRLPPHWGMARAQQDG--------------SSPEP
J9NTK9_BBC3-01          PAPECVPISGPVTRNLLQAPGSAMARARQEG--------------SSPEP
F1RM01_BBC3-04          PLCP-----------VLQAPGSAMARARQEG--------------SSPEP
G3T2N1_BBC3-01          -----------------------MARARQEG--------------SSPEP
A0A250YBU3_BBC3-01      AQSGVCPASGPVSRNLSQAPGSAMARARQEG--------------SSPEP
M3Y0R3_BBC3-01          -----------------QAPGSAMARARQEG--------------SSPEP
A0A1U7R5N5_BBC3-01      -----------------------MARARQEG--------------SSPEP
Q99ML1_BBC3-02          -----------------------MARARQEG--------------SSPEP
Q80ZG6_BBC3-01          -----------------------MARARQEG--------------SSPEP
H0XQ00_BBC3-01          -----------------------MARARQEG--------------SSPEP
A0A0D9S2H2_BBC3-01      -----------------QAPGSAMARARQEG--------------SSPEP
B4DQK3_BBC3-01          -----------------MAPGSAMARARQEG--------------SSPEP
A0A250YBU3_BBC3-02      -----------------------MARARQEG--------------SSPEP
A0A3Q1LXZ6_BBC3-01      -----------------------MARARQEG--------------SSPEP
A0A452E3G1_BBC3-01      -----------------------MARARQEG--------------SSPEP
F1RM01_BBC3-03          -----------------------MARARQEG--------------SSPEP
A0A2I3RGH5_BBC3-01      -----------------------MARARQEG--------------SSPEP
H2NZD3_BBC3-01          -----------------------MARARQEG--------------SSPEP
A0A2K6QZT2_BBC3-01      -----------------------MARARQEG--------------SSPEP
A0A2K6FQZ1_BBC3-01      -----------------------MARARQEG--------------SSPEP
A0A337SAW2_BAD-01       ------------PRGPGKHQRTTPGLLGEAG--------------HQQGQ
A0A2R8MW85_BBC3-03      PPWERACAGLWICRCLAWAPGSAMARARQEG--------------SSPEP
C1KGB6_BCL2L11-02       PA----------ERPPQLRPGAPTSLQT-----------------ERQ--
C1KGB6_BCL2L11-03       PA----------ERPPQLRPGAPTSLQT-----------------ERQGN
C1KGB6_BCL2L11-01       PA----------ERPPQLRPGAPTSLQT-----------------ERQGN
J9NWV6_BCL2L11-01       PA----------ERPPQLRPGAPTSLQT-----------------EQQ--
A0A3Q2GRS5_BCL2L11      PA----------ERPPQLRPGAPTSLQI-----------------EQQ--
A0A3Q2GRS5_BCL2L11      PA----------ERPPQLRPGAPTSLQI-----------------EQQGN
J9NTK9_BBC3-03          PG----------DRGPAAADGGRPQRAVRAAGECWGRGRRQVGLPAREGA
J9NTK9_BBC3-02          PG----------DRGPAAADGGRPQRAVRAA--------------ETRGA
A0A3Q2GWE8_BBC3-01      PG----------DRGPAAADGGRPERAVRAA--------------ETRGA
Q9BXH1_BBC3-03          PG----------DRGPAAADGGRPQRTVRAA--------------ETRGA
A0A493T7X1_BMF-01       --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
A0A452H3N6_BMF-01       --------------------------MDPPNYLEDDYSSLDGLDDDVFHS
A0A287AIU8_BMF-02       --------------------------MEPPQCVEE-------LEDDVFQP
G1PAU1_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
A0A287AIU8_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQP
A0A1U8CPE0_BMF-02       ---------------------IFPGEMEPPQCVEE-------LEDDVFQS
A0A286XXB0_BMF-03       ---------------------VFPREMEPPQCVEE-------LEDDVFQP
A0A287CXH0_BMF-02       ---------------------VFPEEMEPPQCVEE-------LEDDVFQP
A0A1S3EQA2_BMF-02       ---------------------IVPGEMEPPQCVEE-------LEDDVFQA
A2AV74_BMF-02           ---------------------MSPGEMEPPQCVEE-------LEDDVFQS
H9GL49_BMF-01           --------------------------MDPPGYLDDDFSTLDGLEDDVFHA
A0A3Q2UCA0_BMF-02       --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
A0A3Q2UCA0_BMF-01       --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
K7FRX2_BMF-01           --------------------------MDPPSYLEEDYSSLDGLDDDVFHS
U3JS06_BMF-01           --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
A0A493T7X1_BMF-02       --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
A0A3Q2UCA0_BMF-03       --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
A0A3Q2UCA0_BMF-04       --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
G1NHG8_BMF-01           --------------------------MDRPSYLEEDYSSLDGLDDDVFHS
A0A337ST43_BMF-02       --------------------------MEPPQCVEE-------LEDDVFQP
A0A2K5KGP2_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6FFN3_BMF-02       --------------------------MEPSHCVEE-------LEDDVFQP
A0A2K5E1Q4_BMF-02       --------------------------MEPSQCVEE-------LEDDVFQS
A0A2K5RN49_BMF-02       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2K6TW78_BMF-03       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2K6RAW1_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2I2Z168_BMF-02       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2R9BS98_BMF-02       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2J8QDD5_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2K5MJW4_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5VLE9_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6B5F6_BMF-03       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5Z4A9_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
A0A096NTE9_BMF-03       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2I3HD83_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
A0A1S3EQA2_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQA
Q8K589_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
A0A337ST43_BMF-05       KGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQCVEE-------LEDDVFQP
A0A337ST43_BMF-04       KGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQCVEE-------LEDDVFQP
A2AV74_BMF-01           FTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEE-------LEDDVFQS
A0A286XXB0_BMF-02       VTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEE-------LEDDVFQP
G3WDQ2_BMF-01           --------------------------MESPHYVEE-------LEDDVFHP
G3T7Z4_BMF-01           VTLDPGAEPWRHDPETDTLSWSHPGEMEPSQCVEE-------LEDDVFQP
A0A287CXH0_BMF-01       ITLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEE-------LEDDVFQP
A0A1S3WU31_BMF-01       --------------------------MELPQCVDE-------LEDDVFQP
A0A337ST43_BMF-03       --------------------------MEPPQCVEE-------LEDDVFQP
A0A337ST43_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQP
A0A1U8CPE0_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQS
G1SR62_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
M3YAD5_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
U6CSY8_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
A0A452SED0_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQP
A0A384D070_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQP
W5QFV1_BMF-01           ----------------------LTGEMEPPQCVEE-------LEDDVFQP
L8IXF5_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
A0A452F2E0_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQP
A0A452F2E0_BMF-02       --------------------------MEPPQCVEE-------LEDDVFQP
Q05KI3_BMF-02           --------------------------MEPPQCVEE-------LEDDVFQP
Q05KI3_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
A0A2K6FFN3_BMF-01       --------------------------MEPSHCVEE-------LEDDVFQP
H0WYH6_BMF-01           --------------------------MEPSQCVEE-------LEDDVFQP
A0A096NTE9_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6L919_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5E1Q4_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQS
A0A2K6TW78_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2K6TW78_BMF-02       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2K5RN49_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2I2Z168_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2R9BS98_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2J8QDD5_BMF-02       --------------------------MEPSQCVEE-------LEDDVFQP
A0A2J8T301_BMF-01       --------------------------MEPSQCVEE-------LEDDVFQP
F7CM09_BMF-01           --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5MJW4_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5KGP2_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5VLE9_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
F7CM09_BMF-03           --------------------------MEPSRCVEE-------LEDDVFQP
F7CM09_BMF-02           --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6B5F6_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6B5F6_BMF-02       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6B5F6_BMF-04       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K5Z4A9_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6L919_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6L919_BMF-03       --------------------------MEPSRCVEE-------LEDDVFQP
A0A2K6RAW1_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
A0A0D9R4R5_BMF-01       --------------------------MEPSRCVEE-------LEDDVFQP
J9PB65_BMF-04           CGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQCVEE-------LEDDVFQP
J9PB65_BMF-03           --------------------------MEPPQCVEE-------LEDDVFQP
J9PB65_BMF-02           --------------------------MEPPQCVEE-------LEDDVFQP
J9PB65_BMF-01           --------------------------MEPPQCVEE-------LEDDVFQP
A0A3Q2HR24_BMF-01       --------------------------MEPPQCVEE-------LEDDVFQP
A0A3Q2HR24_BMF-02       --------------------------MEPPQCVEE-------LEDDVFQP
A0A2I2YVQ5_PMAIP1-      -------------------------------------------------M
A0A2I3SX38_PMAIP1-      -------------------------------------------------M
A0A2K5JY17_PMAIP1-      -------------------------------------------------M
A0A2R9AKC9_PMAIP1-      -------------------------------------------------M
A0A2K6KJF1_PMAIP1-      -------------------------------------------------M
A0A2K6NC45_PMAIP1-      -------------------------------------------------M
A0A096MPU8_PMAIP1-      -------------------------------------------------M
A0A2K5ZWH1_PMAIP1-      -------------------------------------------------M
A0A2K5VPX2_PMAIP1-      -------------------------------------------------M
A0A2K6BV43_PMAIP1-      -------------------------------------------------M
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------MAHMFTLSDDSD-----------T
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      ----------MFDSSRPQNRSNGTTTLIGRGKIGESHP--------CGGA
G1LNV7_BBC3-01          -----------------------------GSGARGD--------------
A0A2K5F6X4_BBC3-02      -----------------------------KCGVGSAWA--------C--P
F1RM01_BBC3-02          -------------------------------MASGACP--------I--S
A0A3B4V919_BCL2L11      ----------------------------MKAQADGAAL--------F--I
A0A3B4XZH1_BCL2L11      ----------------------------MKAQADGAAL--------F--I
A0A3Q1ICY2_BCL2L11      ------------MDPRQPNRSDGSTAVTATGESGGDPP--------PVGA
A0A3Q3K6I5_BCL2L11      -----------MHLSRPPNRSDGSTAVTATEES-GDPP--------SVGA
A0A3Q3ESW6_BCL2L11      ----------MHRPSRPPNRLDGSPTVTESHGTRGDPP--------Q--T
A0A3Q2SZH6_BCL2L11      -------MVTLCSSNRPPNLRDGSTEVTPPEGTGGDPA--------S--S
A0A3B3VNE0_BCL2L11      -----------MHSSRPPNLLDGSTEVTPAEGTGGDPA--------S--S
A0A3B3YII5_BCL2L11      -----------MHSLRPPNLLDGSTEVTPAEGTGGDPA--------S--S
A0A3B3YII5_BCL2L11      -----------MHSLRPPNLLDGSTEVTPAEGTGGDPA--------S--S
A0A3P9N073_BCL2L11      -----------------------------------DPA--------S--S
A0A3Q3B113_BCL2L11      ----------MRSPSRPPNLRDGSTEVKATEGSSGGAP--------P--S
A0A3B5M375_BCL2L11      -----MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPA--------S--S
A0A3B5QAM1_BCL2L11      -----MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPA--------S--S
A0A3B5QAM1_BCL2L11      -----------MHSLRPPNLLDGSTEVTPAEGTGGDPA--------S--S
A0A3B4BVX1_BCL2L11      --------------------MQNSN-YCCFEQGESGQS--------S--G
Q9GL49_PMAIP1-01        ---------MRSSGSLGSRIRGLLE-SAGWEELVRSQ---------P--R
A0A3B1IH05_BAD-01       FTMDH-----------------MFT-ISDESDASEELG--------D--S
H3ANP3_BAD-01           ----------------------MFQ-ISDSDSDAYEDDRTGPLPLQS--G
H3ANP3_BAD-02           ----------------------MFQ-ISDSDSDAYEDDRTGPLPLQS--G
H3ANP3_BAD-03           ----------------------MFQ-ISDSDSDAYEDDRTGPLPLQS--G
A0A3B3QX41_BAD-01       --------------MSGVTMAHMFT-ISGNESDTSESD--------T---
A0A2I3TBK7_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2I2Z8C7_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A8MXU7_BAD-03           ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5M0A7_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5XJR2_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5VCA9_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6E7I4_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5HKU7_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6N196_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6PUL3_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5M0A7_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5VCA9_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A096MLD5_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6E7I4_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A8MXU7_BAD-04           ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2I3TBK7_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2R8Z688_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5E6A6_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5PDB1_BAD-03       ----------------------MFQ-IPEFEPSEQEGS--------S--S
A0A2K6TG62_BAD-03       ----------------------MFQ-IPEFEPSEQEDS--------S--S
G3VRY3_BAD-01           ----------------------MFQ-ISEFEPSEPGED--------P--S
G3VRY3_BAD-02           ----------------------MFQ-ISEFEPSEPGED--------P--S
G1P8C5_BAD-01           -----------------PTAQSMFQ-IPEFEHSEQEDS--------S--P
A0A452ER54_BAD-02       ---------------YRAWAQSMFQ-IPEFEQSEQEDS--------S--P
W5P8G9_BAD-01           -----------QGPRYRAWAQSMFQ-IPEFEQSEQEDS--------S--P
G3TP47_BAD-01           PEKKKGRRRSSGGLQS------MFQ-IPEFEQSDREDS--------T--P
A0A1U7Q4V0_BAD-01       PGIRSLGNDAGGRRRRPA-AQSMFQ-IPEFEPSEQEDS--------N--T
Q61337_BAD-01           PGIRSLGSDAGGRRWRPA-AQSMFQ-IPEFEPSEQEDA--------S--A
A0A287CT05_BAD-02       PGRKAVGPAGRRRGWHPAWTQSMFQ-IPEFEPSEQEDS--------S--S
A0A287CT05_BAD-01       PGRKAVGPAGRRRGWHPAWTQSMFQ-IPEFEPSEQEDS--------S--S
O35147_BAD-01           GIRSLGSDAGGRRWRPAA--QSMFQ-IPEFEPSEQEDA--------S--T
A0A091DDU4_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A287AEF3_BAD-01       GTPEEGGGRGRSRSGPAS--QSMFQ-IPEFEQSEQEDS--------S--P
G1MI17_BAD-01           DRRETRKGPRTTALAPTA--QSMFQ-IPEFEPSEQEDS--------S--P
M3YNE7_BAD-01           ----------------------MFQ-IPEFEPSEQEDS--------S--P
A0A452RJM6_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--P
A0A384DJL2_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--P
A0A452ER54_BAD-01       SIRRRRRESGGRQWAGPR--GSMFQ-IPEFEQSEQEDS--------S--P
F1MUT9_BAD-01           ----------------------MFQ-IPEFEQSEQEDS--------S--P
Q3SYZ0_BAD-01           ----------------------MFQ-IPEFEQSEQEDS--------S--R
F7DN67_BAD-01           ----------------------MFQ-IPEFEQSEPEDS--------S--P
F1PK10_BAD-01           ----------------------MFQ-IPEFEPSEQEDS--------S--P
Q45KI9_BAD-01           ----------------------MFQ-IPEFEPSEQEDS--------S--P
H0WVR2_BAD-01           ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6GWV0_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
H0V608_BAD-01           ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A1S3FL84_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5PDB1_BAD-01       ----------------------MFQ-IPEFEPSEQEGS--------S--S
A0A2K5E6A6_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6TG62_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A0D9R491_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5HKU7_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K5XJR2_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6N196_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2K6PUL3_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
B4DZQ9_BAD-01           ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A096MLD5_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2I2Z8C7_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2I2Z8C7_BAD-02       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2R8Z688_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A2J8TYJ3_BAD-01       ----------------------MFQ-IPEFEPSEQEDS--------S--S
A0A3B4DUY7_BAD-01       LTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQ--------D--E
E7FBJ6_BAD-01           --------------------------MENTSHDHQDDS------------
B5XEF1_BAD-01           ---------------------------MDYTHDCVDEC--------E--S
A0A3Q3FKT9_BAD-01       ----------MTLTASDVTMAAKFT-ISDSESGSEEEV--------K--E
A0A3P9A5G8_BAD-01       -------------------MAFKMDHTQDCVGDIPENI--------N--E
A0A3P9A5G8_BAD-02       -------------------MAFKMDHTQDCVGDIPENI--------N--E
B5X1T1_BAD-01           -----------------------MDHTHDCVDDNPETM--------N--E
A0A3Q2QC80_BAD-01       ----------------DDTMAAKFT-ISDSDSEPPEEV--------E--E
A0A3Q3FKT9_BAD-03       YSRDSTENKISCLGVLDVTMAAKFT-ISDSESGSEEEV--------K--E
H3D8J8_BAD-01           -------------------MAAKFSLCSDSDSEPSEEV--------E--E
A0A3B5L9R9_BAD-01       -------------------MDTKFTI-SDGESDPSEDV--------E--E
A0A3P9B2E4_BAD-01       -------------------MAANFK-ISDSDSEASEEV--------G--E
I3K7B6_BAD-01           -------------------MAANFT-ISDSESETSEEV--------G--E
A0A3Q3C680_BAD-01       -------------------MAANFK-ISDSDSEASEEV--------G--E
A0A3P8QRJ7_BAD-01       -------------------MAANFK-ISDSDSEASEEV--------G--E
A0A3Q4GGN3_BAD-01       -------------------MAANFK-ISDSDSETSEEV--------G--E
A0A3B4GXJ6_BAD-01       -------------------MAANFK-ISDSDSEASEEV--------G--E
A0A3Q0QNQ2_BAD-01       -------------------FIHFLP-FIQGRGQQPSHL------------
A0A3P8WI83_BAD-02       -------MNVEVSIFPDVTMAAQFT-ISDSESEPEEEV--------E--G
A0A3P8WI83_BAD-01       -------------------MAAQFT-ISDSESEPEEEV--------E--G
A0A3Q2D5S0_BAD-01       --------MAQSVETSDPIMAATFT-ISDSDTEPSEEV--------E--E
A0A3P9HNZ2_BAD-01       -------------------MAAKFT-ISD-DSESSEEV--------E--G
A0A3B3BQF7_BAD-01       -------------------MAAKFS-ISDNDSESSEEV--------E--G
A0A3Q1K1C7_BAD-02       -------------------MAARFT-ISDSDSDPSEGM--------E--E
A0A3Q1K1C7_BAD-01       -------------------MAARFT-ISDSDSDPSEGM--------E--E
A0A3Q1GWH9_BAD-01       -------------------MAAKFS-ISDGDSEPEE----------V--E
A0A3Q1CPU7_BAD-01       -------------------MAAKFT-ISDSESEPSEEV--------E--E
A0A3P8TWH6_BAD-01       -------------------MAAKFT-ISDSESEPSEEV--------E--E
A0A2U9BAC9_BAD-01       -------------------MAANFT-ISDSESEPSEEV--------E--E
A0A3B4VFC5_BAD-01       -------------------MAANFT-ISDSESEPSEEV--------D--E
A0A3B4W9T1_BAD-01       -------------------MAANFT-ISDSESEPSEEV--------D--E
Q4V925_BAD-03           -------------------MAHMFNISDDSETETMEDS--------E--D
Q4V925_BAD-02           -------------------MAHMFNISDDSETETMEDS--------E--D
A7MCM4_BAD-01           -------------------MAHMFNISDDSETETMEDS--------E--A
Q4V925_BAD-01           -------------------MAHMFNISDDSETETMEDS--------E--D
Q4V925_BAD-04           -------------------MAHMFNISDDSETETMEDS--------E--D
A0A3P8Y761_BAD-01       -------------------MENIFT-ISDTESESSDVE--------E--T
A0A3B5Q2N7_BAD-01       -------------------MDTKFT-ISDGESDPSEDV--------E--E
A0A087X8P8_BAD-01       -------------------MDAKFT-ISDSDSEPSEDV--------E--E
A0A3B3UA11_BAD-01       -------------------MDAKFT-ISDSDSEPSEDV--------E--E
A0A3B3YFR1_BAD-01       -------------------MDAKFT-ISDSDSEPSEDV--------E--E
A0A3P9Q7C3_BAD-01       -------------------MDAKFT-ISDSDSEPSEDV--------E--E
A0A3B3HDU2_BAD-01       -------------------MAAKFT-ISD-DSESSEEV--------E--G
A0A3P9KSL7_BAD-01       -------------------MAAKFT-ISD-DSESSEEV--------E--G
A0A3P9KSL7_BAD-02       -------------------MAAKFT-ISD-DSESSEEV--------E--G
A0A3B5BAL2_BAD-01       -------------------MAAQFS-ISGSESDP-EEV--------E--E
A0A3Q3AEL8_BAD-01       -------------------MAAKFT-ISDSESEPSDEV--------E--E
A0A3Q3AEL8_BAD-02       -------------------MAAKFT-ISDSESEPSDEV--------E--E
G3Q8B3_BAD-01           -------------------MAAHFT-ISDSESEPSDGV--------E--E
A0A3Q2Y0E4_BAD-01       -------------------MAANFS-ISDSESEPSEEV--------E--E
A0A3Q3R5S3_BAD-01       -------------------MAANFT-ISDSESESSEEV--------E--E
A0A3Q3RXS8_BAD-01       -------------------MAAKFS-ISESESDSSEEV--------E--G
A0A3Q3RXS8_BAD-02       -------------------MAAKFS-ISESESDSSEEV--------E--G
A0A3Q0QNQ2_BAD-02       --------------------------MPEPPRLVLFDV--------E--E
A0A3Q3WTY4_BAD-01       -------------------MATNFTISSDSESELSEEI--------E--E
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           ---DDFGLAGNAGY----------------RLHVPPVGFAL---------
Q6P7C5_BAD-01           A--HALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQI-------------
A3KND0_BMF-01           ---DAFGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCC---------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           L-------QLAQLPGMAMHSLALSYSQARVTGVLRSLAQGL---------
A0A286XF37_PMAIP1-      --------MPGKVCKSAQ--------------------------------
A0A1U7QLK6_PMAIP1-      --------MLQSVARQNA--------------------------------
Q9JM54_PMAIP1-01        --------MPGRKARRNA--------------------------------
Q5U777_PMAIP1-01        --------MPGRKARRNA--------------------------------
A0A3Q2LHE3_BIK-02       EPRSSSSY---------------------------SVPKAV---------
F7FUT7_BIK-02           GSVANAIQTPVQHSALGVREAAPGAGRRGAGPGRGGASRSI---------
F7FUT7_BIK-01           PTPPGTFL--IYLSLVGLWGPSQQVCRWAPCPQFSPGPAPL---------
O61667_EGL1-01          SSQDF---------------------------------------------
A0A3G3M2M0_BCL2L11      ALRPGHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFS-----------
A0A3Q1ELG4_BCL2L11      AGVSAKTSRSNSTGGEPDSPSWSR--ASLGVFQTRSIFHLP---------
A0A3Q1CI15_BCL2L11      --------PPNPSHGSPDSPSWSRAQASLGVFQTRSIFHLP---------
F1SMU1_PMAIP1-01        S-------------------------------------------------
Q9BXH1_BBC3-04          P-------------------------------------------------
A0A3B4UNJ0_BMF-01       I--SH---------------------------------------------
B2KKY9_BCL2L11-01       N-------------------------------------------------
B8JK68_BCL2L11-01       N-------------------------------------------------
A0A3B4B6Y3_BMF-01       D--LH---------------------------------------------
A0A3P9ICE1_BMF-01       D--PN---------------------------------------------
Q0GKC7_BMF-01           G--LQ---------------------------------------------
A0A3B3RH63_BMF-01       D--PL---------------------------------------------
W5N4P7_BMF-01           SHFSH---------------------------------------------
A0A3B1K1X5_BMF-01       D--PE---------------------------------------------
A0A3B4CNJ8_BMF-01       D--TQ---------------------------------------------
A0A2U9CJH3_BMF-01       D--PH---------------------------------------------
A0A3Q2YCX7_BMF-01       D--PH---------------------------------------------
A0A3Q2YCX7_BMF-02       D--PH---------------------------------------------
A0A3P8ZIE7_BMF-01       D--SY---------------------------------------------
A0A3Q2PJX9_BMF-02       D--PN---------------------------------------------
A0A3Q3QZ16_BMF-01       D--PH---------------------------------------------
A0A3Q3QZ16_BMF-02       D--PH---------------------------------------------
A0A3Q2PJX9_BMF-01       D--PN---------------------------------------------
A0A3Q2PJX9_BMF-03       D--PN---------------------------------------------
A0A3B5QK08_BMF-01       D--PN---------------------------------------------
A0A3B5QK08_BMF-02       D--PN---------------------------------------------
A0A096LRV0_BMF-01       D--PN---------------------------------------------
A0A3B3WU80_BMF-01       D--PN---------------------------------------------
A0A3P9Q8E2_BMF-01       D--PN---------------------------------------------
A0A3Q2CXC4_BMF-02       D--PN---------------------------------------------
A0A3Q2CXC4_BMF-01       D--PN---------------------------------------------
A0A3Q3GUU5_BMF-01       D--PH---------------------------------------------
A0A3B5B8F6_BMF-01       D--PH---------------------------------------------
A0A3Q3VLX6_BMF-01       E--AH---------------------------------------------
A0A3P8UA78_BMF-02       D--PH---------------------------------------------
A0A3P8UA78_BMF-01       D--PH---------------------------------------------
A0A3P8UA78_BMF-03       D--PH---------------------------------------------
A0A3B3CGR9_BMF-01       D--PN---------------------------------------------
A0A3P9K487_BMF-02       D--PN---------------------------------------------
A0A3P9K487_BMF-01       D--PN---------------------------------------------
A0A3B3HAU1_BMF-03       D--PN---------------------------------------------
A0A3B3HAU1_BMF-02       D--PN---------------------------------------------
A0A3B3HAU1_BMF-01       D--PN---------------------------------------------
A0A3B3HAU1_BMF-04       D--PN---------------------------------------------
A0A3P9ICE1_BMF-04       D--PN---------------------------------------------
A0A3Q2ZA20_BMF-01       D--PS---------------------------------------------
A0A3P8NFE2_BMF-02       K--AN---------------------------------------------
I3K2D6_BMF-01           K--AN---------------------------------------------
A0A3P8NFE2_BMF-01       K--AN---------------------------------------------
A0A3Q3C5V2_BMF-01       K--AN---------------------------------------------
A0A3P9DPJ5_BMF-01       K--AN---------------------------------------------
A0A3P9DPJ5_BMF-02       K--AN---------------------------------------------
A0A3B4ETH0_BMF-01       K--AN---------------------------------------------
A0A3Q4G1I4_BMF-01       K--AN---------------------------------------------
A0A3Q1FVH7_BMF-02       D--TH---------------------------------------------
A0A3Q1FVH7_BMF-01       D--TH---------------------------------------------
A0A3Q3RVI2_BMF-01       D--PH---------------------------------------------
A0A3Q1D1K3_BMF-01       D--PH---------------------------------------------
A0A3P8RKY9_BMF-01       D--PH---------------------------------------------
A0A3Q3RVI2_BMF-02       D--PH---------------------------------------------
A0A3Q1IPR4_BMF-01       D--PH---------------------------------------------
A0A3B4U5H8_BMF-01       D--PH---------------------------------------------
A0A3B4WM88_BMF-01       D--PH---------------------------------------------
A0A3Q3SYA1_BCL2L11      S--VS---PSRGRTRSIA------------HLDSLSV-------------
R4G9R5_BCL2L11-01       --------PKQLNVLSAN------------AFAIS---------------
A0A3B3QC78_BCL2L11      R--NPVAEQTPIQAGPRTAKVPG-------QLQATPR-------------
F7CXT2_BCL2L11-01       T--ERPTQPQQLRPGAPT------------SIQTQYQ-------------
F7FTC8_BCL2L11-01       A--EGPAQPPQLRPGAPT------------SIRTQYQ-------------
A0A2R8M6L7_BCL2L11      A--ERP---PQLRPGAPT------------SLQTEPQ-------------
G3SU55_BCL2L11-01       A--ERPPQPPQLRPGAPT------------SLLTEPQGN-----------
G3W979_BCL2L11-01       T--ERPTQ-PQLRPGAPT------------SIQTQYQGN-----------
U3IW89_BCL2L11-01       R--A----------------------------------------------
A0A3Q2U844_BCL2L11      G--EGPGPAVPLRPGAPA------------ALPGAAR-------------
C1C3S9_BAD-01           T--ER---GSAFSGTNPP------------GFGGDPGHKSS---------
A0A3P8XIA2_BCL2L11      T--NS---LLGFQSRSPL--------------------------------
A0A452IFQ4_BAD-01       S--QRGHTPGSKQPDTPTAEVRSRIGSDTPSLEPEVQDEPG---------
K7GA86_BCL2L11-01       I--ERPSQPQHLRPGAPT------------SIQTQYQ-------------
O43521_BCL2L11-20       A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A2R8M6L7_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
M3YDI3_BCL2L11-01       V--ER---PPQLRPGAPT------------SLQTEQQ-------------
F7CXT2_BCL2L11-02       T--ERPTQPQQLRPGAPT------------SIQTQYQGN-----------
G1SSY0_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQSEPQ-------------
J9NWV6_BCL2L11-06       A--ER---PPQLRPGAPT------------SLQTEQQ-------------
C1KGB8_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTERQ-------------
A0A3Q2GRS5_BCL2L11      A--ER---PPQLRPGAPT------------SLQIEQQ-------------
U6CTE3_BCL2L11-04       V--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A1U7T0R1_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
J9NWV6_BCL2L11-02       A--ER---PPQLRPGAPT------------SLQTEQQGNPE---------
A0A2K6TRU4_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5NU92_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2I2YQ13_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5X1Y3_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K6QIL2_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5HZI5_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2I3GVB2_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2R9C366_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2I3SN61_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5HZI5_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2I2YQ13_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K6QIL2_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5Q1Y0_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K6GE31_BCL2L11      V--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A1U7T0R1_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A1U7T0R1_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
O54918_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTEPQGN-----------
O88498_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTESQGN-----------
A0A2K5Z7V3_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A096NYC3_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5X1Y3_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K6E212_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5NU92_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A096NYC3_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K6KJP8_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2I3SN61_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2R8M6L7_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5CA89_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K5Q1Y0_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A1U7T0R1_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A1U7T0R1_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A3Q2GRS5_BCL2L11      A--ER---PPQLRPGAPT------------SLQIEQQGNPG---------
J9NWV6_BCL2L11-04       A--ER---PPQLRPGAPT------------SLQTEQQGNPE---------
U6CTE3_BCL2L11-02       V--ER---PPQLRPGAPT------------SLQTEQQGNPE---------
A0A1U8BW10_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQGN-----------
A0A1U7T0R1_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A2K6GE31_BCL2L11      V--ER---PPQLRPGAPT------------SLQTEPQGNPE---------
A0A287DFJ0_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQGN-----------
A0A452FCR6_BCL2L11      A--ER---PPQLRPGAPT------------SLQTERQGN-----------
W5PY58_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTERQGN-----------
L8IVA4_BCL2L11-02       A--ER---PPQLRPGAPT------------SLQTERQGN-----------
A0A286XJN2_BCL2L11      A--ER---PSQLRAGAPT------------SLQTEPQGN-----------
A0A286XJN2_BCL2L11      A--ER---PSQLRAGAPT------------SLQTEPQGN-----------
G1SSY0_BCL2L11-02       A--ER---PPQLRPGAPT------------SLQSEPQGNP----------
A0A250YBV9_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPPGNPE---------
H0XW23_BCL2L11-01       A--ER---PPQLRPGAPT------------SLHTEPQGNPE---------
A0A1S3FFM9_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQGNPE---------
U6CTE3_BCL2L11-01       V--ER---PPQLRPGAPT------------SLQTEQQGN-----------
G1LDR8_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTEQQGN-----------
J9NWV6_BCL2L11-03       A--ER---PPQLRPGAPT------------SLQTEQQGN-----------
A0A2I2UX96_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQGN-----------
O54918_BCL2L11-03       A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A1U8BW10_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQ-------------
J9NWV6_BCL2L11-05       A--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A3Q2GRS5_BCL2L11      A--ER---PPQLRPGAPT------------SLQIEQQ-------------
A0A452U4S4_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A2R9C366_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A2I3GVB2_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A2K6TRU4_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A0D9RWE0_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
U6CTE3_BCL2L11-03       V--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A2K6E212_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
H2P5E2_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A250YBV9_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPP-------------
A0A286XJN2_BCL2L11      A--ER---PSQLRAGAPT------------SLQTEPQ-------------
A0A2I2UX96_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A1S3FFM9_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A452SBG5_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A3Q1MV27_BCL2L11      A--ER---PPQLRPGAPT------------SLQTERQ-------------
A0A1U8BW10_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEQQ-------------
A0A287DFJ0_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
L8IVA4_BCL2L11-01       A--ER---PPQLRPGAPT------------SLQTERQ-------------
A0A3Q1MV27_BCL2L11      A--ER---PPQLRPGAPT------------SLQTERQ-------------
A0A452FCR6_BCL2L11      A--ER---PPQLRPGAPT------------SLQTERQ-------------
A0A2K5CA89_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A2K5Z7V3_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A2K6KJP8_BCL2L11      A--ER---PPQLRPGAPT------------SLQTEPQ-------------
A0A3P8RLE2_BCL2L11      N--LR---GGGADPEPVG------------AAGVSAKTSRL---------
A0A3B1JLM2_BAD-01       H--SK---EDDISPIDDH------------DESRWSEAVKS---------
Q61337_BAD-05           T--DR---GLGPSLTEDQ------------PG------------------
A0A3B1JXK6_BCL2L11      S--GG---GGGTLSRAEQ------------CEQPEPGDGDP---------
A0A3B4BVX1_BCL2L11      S--SG---AASSRA-AEQ------------CEQPEPGEGDP---------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          V--EG---LPRESPRTFP------------LGRLMPSAVSC---------
F7GL32_BBC3-01          V--EG---LPRESPRTFP------------LGRLMPSAVSC---------
J9NTK9_BBC3-01          V--EG---LARDGPRPFP------------LSRLVPSAVSC---------
F1RM01_BBC3-04          V--EG---LARDGPRPFP------------LSRLVPSAVSC---------
G3T2N1_BBC3-01          V--EG---LARESPRPFP------------LGSLVPSAVSC---------
A0A250YBU3_BBC3-01      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
M3Y0R3_BBC3-01          V--EG---LSRDGPRPFP------------LSRLVPSAVSC---------
A0A1U7R5N5_BBC3-01      V--EG---LARDSPRPFP------------LGRLVPSAVSC---------
Q99ML1_BBC3-02          V--EG---LARDSPRPFP------------LGRLMPSAVSC---------
Q80ZG6_BBC3-01          V--EG---LARDSPRPFP------------LGRLMPSAVSC---------
H0XQ00_BBC3-01          V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
A0A0D9S2H2_BBC3-01      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
B4DQK3_BBC3-01          V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
A0A250YBU3_BBC3-02      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
A0A3Q1LXZ6_BBC3-01      V--EG---LARDGPRPFP------------LSRLVPSAVSC---------
A0A452E3G1_BBC3-01      V--EG---LARDGPRPFP------------LSRLVPSAVSC---------
F1RM01_BBC3-03          V--EG---LARDGPRPFP------------LSRLVPSAVSC---------
A0A2I3RGH5_BBC3-01      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
H2NZD3_BBC3-01          V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
A0A2K6QZT2_BBC3-01      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
A0A2K6FQZ1_BBC3-01      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
A0A337SAW2_BAD-01       P--AS---SNHH--------------------------------------
A0A2R8MW85_BBC3-03      V--EG---LARDGPRPFP------------LGRLVPSAVSC---------
C1KGB6_BCL2L11-02       --------------------------------------------------
C1KGB6_BCL2L11-03       P--EG---EGDRCPQGSP------------QGPLAP--------------
C1KGB6_BCL2L11-01       P--EG---EGDRCPQGSP------------QGPLAP--------------
J9NWV6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      P--GG---EGDRCPQGSP------------LGPLAP--------------
J9NTK9_BBC3-03          A--GG---PARC--AAAA------------ARRGGV--------------
J9NTK9_BBC3-02          A--AT---PPLTLEGPVQ------------SHHGTP--------------
A0A3Q2GWE8_BBC3-01      A--AT---PPLALEGPVQ------------SHHGTP--------------
Q9BXH1_BBC3-03          A--AA---PPLTLEGPVQ------------SHHGTP--------------
A0A493T7X1_BMF-01       D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
A0A452H3N6_BMF-01       D--FG---LTG-QPGEMT------------PPGIFTQNQSY---------
A0A287AIU8_BMF-02       E--EG---EPGTQPRR-V------------SADPFVQSQ-L---------
G1PAU1_BMF-01           E--D----ELGTQPGSLP------------SADLFAQSQ-L---------
A0A287AIU8_BMF-01       E--EG---EPGTQPRR-V------------SADPFVQSQ-L---------
A0A1U8CPE0_BMF-02       E--DG---EPGTQPGSLL------------SADPFAQSQ-L---------
A0A286XXB0_BMF-03       E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A287CXH0_BMF-02       E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A1S3EQA2_BMF-02       E--DG---EPGTQPGSLL------------SATLFAQSQ-L---------
A2AV74_BMF-02           E--DG---EPGTQPGGLL------------SADLFAQSQ-L---------
H9GL49_BMF-01           E--DC---GLASQPSEMT------------FPGIFTQSKSY---------
A0A3Q2UCA0_BMF-02       D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
A0A3Q2UCA0_BMF-01       D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
K7FRX2_BMF-01           D--DF---GLTGQPGEMT------------PTGIFTQNQSY---------
U3JS06_BMF-01           D--DF---GLAGQPGEMT------------ATGFFTQNQSY---------
A0A493T7X1_BMF-02       D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
A0A3Q2UCA0_BMF-03       D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
A0A3Q2UCA0_BMF-04       D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
G1NHG8_BMF-01           D--DF---GLAGQPGEMT------------ATGIFTQNQSY---------
A0A337ST43_BMF-02       E--DV---EPGTQPGSLL------------SANLFAQSQ-L---------
A0A2K5KGP2_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6FFN3_BMF-02       E--DG---ESGTQPGSVL------------SADLFAQSQ-L---------
A0A2K5E1Q4_BMF-02       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2K5RN49_BMF-02       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2K6TW78_BMF-03       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2K6RAW1_BMF-02       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2I2Z168_BMF-02       E--DG---EPVTQPGSLL------------SADLFAQSL-L---------
A0A2R9BS98_BMF-02       E--DG---EPVTQPGSLL------------SADLFAQSL-L---------
A0A2J8QDD5_BMF-01       E--DG---EPVTQPGSLL------------SADLFAQSL-L---------
A0A2K5MJW4_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5VLE9_BMF-01       E--DG---EPGSQPGSSL------------SADLFAQSL-L---------
A0A2K6B5F6_BMF-03       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5Z4A9_BMF-02       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A096NTE9_BMF-03       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2I3HD83_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A1S3EQA2_BMF-01       E--DG---EPGTQPGSLL------------SATLFAQSQ-L---------
Q8K589_BMF-01           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A337ST43_BMF-05       E--DV---EPGTQPGSLL------------SANLFAQSQ-L---------
A0A337ST43_BMF-04       E--DV---EPGTQPGSLL------------SANLFAQSQ-L---------
A2AV74_BMF-01           E--DG---EPGTQPGGLL------------SADLFAQSQ-L---------
A0A286XXB0_BMF-02       E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
G3WDQ2_BMF-01           E--DS---EPGAQPGGLT------------SPALFAQSQ-P---------
G3T7Z4_BMF-01           E--EG---EPGTQPGGLL------------SADLFAQSQ-L---------
A0A287CXH0_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A1S3WU31_BMF-01       E--DG---EPGTTPGSLL------------SSDLFAQSP-M---------
A0A337ST43_BMF-03       E--DV---EPGTQPGSLL------------SANLFAQSQ-L---------
A0A337ST43_BMF-01       E--DV---EPGTQPGSLL------------SANLFAQSQ-L---------
A0A1U8CPE0_BMF-01       E--DG---EPGTQPGSLL------------SADPFAQSQ-L---------
G1SR62_BMF-01           E--DG---EPGTQPQSLL------------SADPFAQSQ-L---------
M3YAD5_BMF-01           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
U6CSY8_BMF-01           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A452SED0_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A384D070_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
W5QFV1_BMF-01           E--DG---EPGAQPRRLL------------SADLFAQSQ-L---------
L8IXF5_BMF-01           E--DG---EPGTQPRSLL------------SADLFAQSQ-L---------
A0A452F2E0_BMF-01       E--DG---EPGAQPRRLL------------SADLFAQSQ-L---------
A0A452F2E0_BMF-02       E--DG---EPGAQPRRLL------------SADLFAQSQ-L---------
Q05KI3_BMF-02           E--DG---EPGTQPRSLL------------SADLFAQSQ-L---------
Q05KI3_BMF-01           E--DG---EPGTQPRSLL------------SADLFAQSQ-L---------
A0A2K6FFN3_BMF-01       E--DG---ESGTQPGSVL------------SADLFAQSQ-L---------
H0WYH6_BMF-01           E--DG---ELGT--GNVL------------SADLFAQSQ-L---------
A0A096NTE9_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6L919_BMF-02       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5E1Q4_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2K6TW78_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2K6TW78_BMF-02       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2K5RN49_BMF-01       E--DG---EPGTQPGSLL------------SADLFAQSL-L---------
A0A2I2Z168_BMF-01       E--DG---EPVTQPGSLL------------SADLFAQSL-L---------
A0A2R9BS98_BMF-01       E--DG---EPVTQPGSLL------------SADLFAQSL-L---------
A0A2J8QDD5_BMF-02       E--DG---EPVTQPGSLL------------SADLFAQSL-L---------
A0A2J8T301_BMF-01       E--DG---EPGTQSGSLL------------SADLFAQSL-L---------
F7CM09_BMF-01           E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5MJW4_BMF-02       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5KGP2_BMF-02       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5VLE9_BMF-02       E--DG---EPGSQPGSSL------------SADLFAQSL-L---------
F7CM09_BMF-03           E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
F7CM09_BMF-02           E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6B5F6_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6B5F6_BMF-02       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6B5F6_BMF-04       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K5Z4A9_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6L919_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6L919_BMF-03       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A2K6RAW1_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
A0A0D9R4R5_BMF-01       E--DG---EPGAQPGSSL------------SADLFAQSL-L---------
J9PB65_BMF-04           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
J9PB65_BMF-03           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
J9PB65_BMF-02           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
J9PB65_BMF-01           E--DG---EPGTQPGSLL------------SADLFAQSQ-L---------
A0A3Q2HR24_BMF-01       E--DG---EPGTQPRSLL------------SADLFAPSQ-L---------
A0A3Q2HR24_BMF-02       E--DG---EPGTQPRSLL------------SADLFAPSQ-L---------
A0A2I2YVQ5_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2I3SX38_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2K5JY17_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2R9AKC9_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2K6KJF1_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2K6NC45_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A096MPU8_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2K5ZWH1_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2K5VPX2_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
A0A2K6BV43_PMAIP1-      P--GK---KARKNAQPSP--------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       S--ED---LGDADQPEAS------------KRAELSQSGQH---------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           ------------------------------------MSEVR---------
A0A2K5QXZ1_BIK-01       ------------------------------------MSEER---------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           ------------------------------------MSEAR---------
O70337_BIK-01           ------------------------------------MSEAR---------
Q925D2_BIK-01           ------------------------------------MSEAR---------
A0A1S3FUQ7_BIK-01       ------------------------------------MSEAG---------
H0XAE7_BIK-01           ------------------------------------MSAGR---------
A0A2K6FM79_BIK-01       ------------------------------------MSEVR---------
H0W025_BIK-01           ------------------------------------MSEAK---------
A0A2K5CLG5_BIK-01       ------------------------------------MSEVR---------
A0A2K6TBD7_BIK-01       ------------------------------------MSEDR---------
H2P4N6_BIK-01           ------------------------------------MSEVR---------
G1S1X2_BIK-01           ------------------------------------MSEVR---------
G3QCT2_BIK-01           ------------------------------------MSEVR---------
A0A2R8ZXD2_BIK-01       ------------------------------------MSEVR---------
H2QLU7_BIK-01           ------------------------------------MSEVR---------
A0A2K6MCW0_BIK-01       ------------------------------------MSGVR---------
A0A2K6QK74_BIK-01       ------------------------------------MSGVR---------
A0A0D9QZY8_BIK-01       ------------------------------------MSGVR---------
A0A2K5VW94_BIK-01       ------------------------------------MSGVR---------
A0A2K6DBJ4_BIK-01       ------------------------------------MSGVR---------
A0A2K5J4Q7_BIK-01       ------------------------------------MSGVR---------
A0A096NKG5_BIK-01       ------------------------------------MSGVR---------
A0A2K5LDM6_BIK-01       ------------------------------------MSGVR---------
A0A2K5XSA1_BIK-01       ------------------------------------MSGVR---------
A0A3P8XIA2_BCL2L11      T--SS---SKLSDYPQSC------------EGNQQSRGGIM---------
G1LNV7_BBC3-01          ---PI---SRPQ--------------------------------------
A0A2K5F6X4_BBC3-02      C--QV---PRAS--------------------------------------
F1RM01_BBC3-02          G--PV---SRNL----------------------SQAPGSAMARARQEGS
A0A3B4V919_BCL2L11      Q--QT---TKPVRWLDRS------------NGKRGERRGSTTRRCRWSPS
A0A3B4XZH1_BCL2L11      Q--QT---TKPVRWLDRS------------NGKRGERRGSTTRRCRWSPG
A0A3Q1ICY2_BCL2L11      A--GV---STPTSRSNDG------------GERRFGRPDSS------GGG
A0A3Q3K6I5_BCL2L11      A--GT---SAQSSRSNGG------------SERSFGHPGSA------GGG
A0A3Q3ESW6_BCL2L11      S--RS----------DNS------------GGRNFGRTDST------GGG
A0A3Q2SZH6_BCL2L11      A--RT---PRLSKHREGS------------CAQPPGAVTAA------GGG
A0A3B3VNE0_BCL2L11      A--RT---PRSSKHTERS------------CAPQTGASTAG------GGG
A0A3B3YII5_BCL2L11      A--RT---PRSSKHTERS------------CAPQAGASTAG------GGG
A0A3B3YII5_BCL2L11      A--RT---PRSSKHTERS------------CAPQAGASTAG------GGG
A0A3P9N073_BCL2L11      A--RT---PRSSKHTERS------------CAPQAGASTAG------GGG
A0A3Q3B113_BCL2L11      A--GA---ARGSAHATR---------------PVRGRAPSA------AGG
A0A3B5M375_BCL2L11      A--RT---PRSSKHTERS------------RAPQAGASTAG------GGG
A0A3B5QAM1_BCL2L11      A--RT---PRSSKHTERS------------RAPQAGASTAG------GGG
A0A3B5QAM1_BCL2L11      A--RT---PRSSKHTERS------------RAPQAGASTAG------GGG
A0A3B4BVX1_BCL2L11      A--AS---SRAAEQCEQP---------------E-PGEGDP---------
Q9GL49_PMAIP1-01        A--HQ---GLTSGRCGQT---------------RREELRGS---------
A0A3B1IH05_BAD-01       D--QP---EVSKTAE--------------------PSRSGQ---------
H3ANP3_BAD-01           G--GR---GEGSEPSEKT-----------------AGLKKH---------
H3ANP3_BAD-02           G--GR---GEGSEPSEKT-----------------AGLKKH---------
H3ANP3_BAD-03           G--GR---GEGSEPSEKT-----------------AGLKKH---------
A0A3B3QX41_BAD-01       -----------PDVTANS---------------Q-LGNNLK---------
A0A2I3TBK7_BAD-01       A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A2I2Z8C7_BAD-03       A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A8MXU7_BAD-03           A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A2K5M0A7_BAD-02       A--ER---GLGPSLAGDR---------------P-SDCGKH---------
A0A2K5XJR2_BAD-02       A--ER---GLGPSLAGDR---------------P-SDCGKH---------
A0A2K5VCA9_BAD-02       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K6E7I4_BAD-02       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K5HKU7_BAD-02       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K6N196_BAD-02       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K6PUL3_BAD-02       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K5M0A7_BAD-03       A--ER---GLGPSLAGDR---------------P-SDCGKH---------
A0A2K5VCA9_BAD-03       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A096MLD5_BAD-02       A--ER---GLGPSPAGDK---------------P-SDSGKH---------
A0A2K6E7I4_BAD-03       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A8MXU7_BAD-04           A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A2I3TBK7_BAD-03       A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A2R8Z688_BAD-03       A--ER---GLGPSPAGDG---------------P-SGSSKH---------
A0A2K5E6A6_BAD-03       A--ER---GLSPSTAGDR---------------P-PGSGKH---------
A0A2K5PDB1_BAD-03       A--ER---GLNPSTAGDS---------------P-PGSGKH---------
A0A2K6TG62_BAD-03       A--ER---GLSPSTAGDS---------------P-PGSGKH---------
G3VRY3_BAD-01           A--ST---APSLAPLRPG---------------PRAAPGAH---------
G3VRY3_BAD-02           A--ST---APSLAPLRPG---------------PRAAPGAH---------
G1P8C5_BAD-01           A--DR---GLGPCPTGDQ---------------P-PGLNKH---------
A0A452ER54_BAD-02       A--DR---GLGPSPTGDR---------------P-PGLSKH---------
W5P8G9_BAD-01           A--DR---GLGPSPTGDR---------------P-PGLSKH---------
G3TP47_BAD-01           A--DR---GLGPSPEGYW---------------P-SGPSDR---------
A0A1U7Q4V0_BAD-01       A--DR---GLGPSLTGDP---------------P-GPC------------
Q61337_BAD-01           T--DR---GLGPSLTEDQ---------------P-GPY------------
A0A287CT05_BAD-02       A--EG---GLGPSPAGDR---------------P-GCG------------
A0A287CT05_BAD-01       A--EG---GLGPSPAGDR---------------P-GCG------------
O35147_BAD-01           T--DR---GLGPSLTEDQ---------------P-GPY------------
A0A091DDU4_BAD-01       E--ER---GLGPSPIGDQ---------------L-GPS------------
A0A287AEF3_BAD-01       A--DR---GLGPSPTGTD---------------P-----QP---------
G1MI17_BAD-01           A--DR---GLGPSPTGDQ---------------P-PGPGKH---------
M3YNE7_BAD-01           A--DR---GLGPSPTGDQ---------------P-PGLGKH---------
A0A452RJM6_BAD-01       A--DR---GLGPSPTGDQ---------------P-PGPGKH---------
A0A384DJL2_BAD-01       A--DR---GLGPSPTGDQ---------------P-PGPGKH---------
A0A452ER54_BAD-01       A--DR---GLGPSPTGDR---------------P-PGLT-----------
F1MUT9_BAD-01           A--DR---GLGPSPTGDR---------------P-PGLSKH---------
Q3SYZ0_BAD-01           A--DR---GLGPSPTGDR---------------P-PGLSKH---------
F7DN67_BAD-01           A--DR---GLGPSPTGDW---------------P-SDPVRH---------
F1PK10_BAD-01           A--NR---GLGPSPTGDR---------------P-PSPGKH---------
Q45KI9_BAD-01           A--NR---GLGPSPTGDR---------------P-PSPGKH---------
H0WVR2_BAD-01           S--DR---GLGPSPSGDQ---------------P-LGPGKN---------
A0A2K6GWV0_BAD-01       A--GR---GLGPSPSGDR---------------P-SGPGKH---------
H0V608_BAD-01           E--ER---GLGPSPTGDE---------------L-GSS------------
A0A1S3FL84_BAD-01       A--DR---GLGPSLC-----------------------------------
A0A2K5PDB1_BAD-01       A--ER---GLNPSTAGDS---------------P-PGSGKH---------
A0A2K5E6A6_BAD-01       A--ER---GLSPSTAGDR---------------P-PGSGKH---------
A0A2K6TG62_BAD-01       A--ER---GLSPSTAGDS---------------P-PGSGKH---------
A0A0D9R491_BAD-01       A--ER---GLGPSPAGNR---------------P-SDSGKH---------
A0A2K5HKU7_BAD-01       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K5XJR2_BAD-01       A--ER---GLGPSLAGDR---------------P-SDCGKH---------
A0A2K6N196_BAD-01       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
A0A2K6PUL3_BAD-01       A--ER---GLGPSPAGDR---------------P-SDSGKH---------
B4DZQ9_BAD-01           A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A096MLD5_BAD-01       A--ER---GLGPSPAGDK---------------P-SDSGKH---------
A0A2I2Z8C7_BAD-01       A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A2I2Z8C7_BAD-02       A--ER---GLGPSPAGDG---------------P-SGSGKH---------
A0A2R8Z688_BAD-01       A--ER---GLGPSPAGDG---------------P-SGSSKH---------
A0A2J8TYJ3_BAD-01       A--ER---GLGPSPAGDR---------------P-SGSSKH---------
A0A3B4DUY7_BAD-01       S--NW---SETVKNGDSP------------QLDSQHSMASN---------
E7FBJ6_BAD-01           ---------STLDEKERS------------HLKGTIKNHGQ---------
B5XEF1_BAD-01           D--HS---GTTRNSEFQL------------HVSTTMSNRPR---------
A0A3Q3FKT9_BAD-01       E--EN---DQSSAVE------------------EPHVPQRH---------
A0A3P9A5G8_BAD-01       K--YD---LDHLGTT------------------HYPEFQFC---------
A0A3P9A5G8_BAD-02       K--YD---LDHLGTT------------------HYPEFQFC---------
B5X1T1_BAD-01           H--DE---SDHSGTT------------------HYPEFQRH---------
A0A3Q2QC80_BAD-01       E--GN---DQPADGK------------------VEPLRQRH---------
A0A3Q3FKT9_BAD-03       E--EN---DQSSAVE------------------EPHVPQRH---------
H3D8J8_BAD-01           G--ER---GS----------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       G--EN---QQSAG--------------------QAQESKPQ---------
I3K7B6_BAD-01           E--EN---QQPAG--------------------QDQESKPQ---------
A0A3Q3C680_BAD-01       E--EN---QQSAG--------------------QAQESKPQ---------
A0A3P8QRJ7_BAD-01       G--EN---QQSAG--------------------QAQESKPQ---------
A0A3Q4GGN3_BAD-01       G--EN---QQSAR--------------------QVQESKPQ---------
A0A3B4GXJ6_BAD-01       G--EN---QQSAG--------------------QAQESKPQ---------
A0A3Q0QNQ2_BAD-01       ----L---QLIWGTP------------------RHSQAIGH---------
A0A3P8WI83_BAD-02       G--KI---KHSLNDP------------------EQVVPHRH---------
A0A3P8WI83_BAD-01       G--KI---KHSLNDP------------------EQVVPHRH---------
A0A3Q2D5S0_BAD-01       T--RN---KE----------------------------------------
A0A3P9HNZ2_BAD-01       G--KL---DLGAAGG-GG------------GGEGEHLHDRH---------
A0A3B3BQF7_BAD-01       G--RL---DLAASGGEGG------------GGGGGHLHDRH---------
A0A3Q1K1C7_BAD-02       E--GH---NQSPPGQ------------------EQQVFPRH---------
A0A3Q1K1C7_BAD-01       E--GH---NQSPPGQ------------------EQQVFPRH---------
A0A3Q1GWH9_BAD-01       G--EN---NHSPATE------------------AMPVFARR---------
A0A3Q1CPU7_BAD-01       G--EN---NHSPATQ------------------AMPVFARR---------
A0A3P8TWH6_BAD-01       G--EN---NHSPATQ------------------AMPVFARR---------
A0A2U9BAC9_BAD-01       G--EV---SQPWTGP------------------GEQVPPRH---------
A0A3B4VFC5_BAD-01       G--EM---SQSLTGQ------------------EQELSQRH---------
A0A3B4W9T1_BAD-01       G--EM---SQSLTGQ------------------EQELSQRH---------
Q4V925_BAD-03           S--SL---DKHKSGSAQK---------------------KQ---------
Q4V925_BAD-02           S--SL---DKHKSGSAQK---------------------KQ---------
A7MCM4_BAD-01           S--SL---DKHKSGSAQK---------------------KQ---------
Q4V925_BAD-01           S--SL---DKHKSGSAQK---------------------KQ---------
Q4V925_BAD-04           S--SL---DKHKSGSAQK---------------------KQ---------
A0A3P8Y761_BAD-01       K--KE---WIAGQGKTGS-------------------RLGL---------
A0A3B5Q2N7_BAD-01       R--GD---LQLMQEKEKP-----------------L-SQRH---------
A0A087X8P8_BAD-01       R--GN---LQLMQVKERP-----------------L-SQRH---------
A0A3B3UA11_BAD-01       R--GN---LQLMQVKERP-----------------L-SQRH---------
A0A3B3YFR1_BAD-01       R--GN---LQLMQVKERP-----------------L-SQRH---------
A0A3P9Q7C3_BAD-01       R--GN---LQLMQVKERP-----------------L-SQRH---------
A0A3B3HDU2_BAD-01       G--KL---DLGAAAGGEG---------------EHL-HDRH---------
A0A3P9KSL7_BAD-01       G--KL---DLGAAAGGEG---------------EHL-HDRH---------
A0A3P9KSL7_BAD-02       G--KL---DLGAAAGGEG---------------EHL-HDRH---------
A0A3B5BAL2_BAD-01       G--EN---NHPPAEQPMH-----------------V-FERR---------
A0A3Q3AEL8_BAD-01       G--KS---KQPAAGPEDG--------------------VRQ---------
A0A3Q3AEL8_BAD-02       G--KS---KQPAAGPEDG--------------------VRQ---------
G3Q8B3_BAD-01           R--ED---GQLSSGQEQQ-----------------R-LQRH---------
A0A3Q2Y0E4_BAD-01       G--DD---GQGAAEKEQE---------------QCL-RQGL---------
A0A3Q3R5S3_BAD-01       G--KH---SQSSTSQEQQ-----------------V-PPCH---------
A0A3Q3RXS8_BAD-01       G--KQ---KKSSARQEQQ-----------------V-SQRH---------
A0A3Q3RXS8_BAD-02       G--KQ---KKSSARQEQQ-----------------V-SQRH---------
A0A3Q0QNQ2_BAD-02       G--QS---PFREGSFLLL-----------------VSVISF---------
A0A3Q3WTY4_BAD-01       G--EN---SQLQTEQEQQ-----------------V-FQRH---------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       --------------------------------------------------
F7FUT7_BIK-02           --------------------------------------------------
F7FUT7_BIK-01           --------------------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
C1KGB6_BCL2L11-02       --------------------------------------------------
C1KGB6_BCL2L11-03       --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A493T7X1_BMF-01       --------------------------------------------------
A0A452H3N6_BMF-01       --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
G1PAU1_BMF-01           --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-02       --------------------------------------------------
A0A286XXB0_BMF-03       --------------------------------------------------
A0A287CXH0_BMF-02       --------------------------------------------------
A0A1S3EQA2_BMF-02       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
H9GL49_BMF-01           --------------------------------------------------
A0A3Q2UCA0_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-01       --------------------------------------------------
K7FRX2_BMF-01           --------------------------------------------------
U3JS06_BMF-01           --------------------------------------------------
A0A493T7X1_BMF-02       --------------------------------------------------
A0A3Q2UCA0_BMF-03       --------------------------------------------------
A0A3Q2UCA0_BMF-04       --------------------------------------------------
G1NHG8_BMF-01           --------------------------------------------------
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       --------------------------------------------------
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       --------------------------------------------------
Q8K589_BMF-01           --------------------------------------------------
A0A337ST43_BMF-05       --------------------------------------------------
A0A337ST43_BMF-04       --------------------------------------------------
A2AV74_BMF-01           --------------------------------------------------
A0A286XXB0_BMF-02       --------------------------------------------------
G3WDQ2_BMF-01           --------------------------------------------------
G3T7Z4_BMF-01           --------------------------------------------------
A0A287CXH0_BMF-01       --------------------------------------------------
A0A1S3WU31_BMF-01       --------------------------------------------------
A0A337ST43_BMF-03       --------------------------------------------------
A0A337ST43_BMF-01       --------------------------------------------------
A0A1U8CPE0_BMF-01       --------------------------------------------------
G1SR62_BMF-01           --------------------------------------------------
M3YAD5_BMF-01           --------------------------------------------------
U6CSY8_BMF-01           --------------------------------------------------
A0A452SED0_BMF-01       --------------------------------------------------
A0A384D070_BMF-01       --------------------------------------------------
W5QFV1_BMF-01           --------------------------------------------------
L8IXF5_BMF-01           --------------------------------------------------
A0A452F2E0_BMF-01       --------------------------------------------------
A0A452F2E0_BMF-02       --------------------------------------------------
Q05KI3_BMF-02           --------------------------------------------------
Q05KI3_BMF-01           --------------------------------------------------
A0A2K6FFN3_BMF-01       --------------------------------------------------
H0WYH6_BMF-01           --------------------------------------------------
A0A096NTE9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-01       --------------------------------------------------
A0A2K6TW78_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-01       --------------------------------------------------
A0A2I2Z168_BMF-01       --------------------------------------------------
A0A2R9BS98_BMF-01       --------------------------------------------------
A0A2J8QDD5_BMF-02       --------------------------------------------------
A0A2J8T301_BMF-01       --------------------------------------------------
F7CM09_BMF-01           --------------------------------------------------
A0A2K5MJW4_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-02       --------------------------------------------------
A0A2K5VLE9_BMF-02       --------------------------------------------------
F7CM09_BMF-03           --------------------------------------------------
F7CM09_BMF-02           --------------------------------------------------
A0A2K6B5F6_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-02       --------------------------------------------------
A0A2K6B5F6_BMF-04       --------------------------------------------------
A0A2K5Z4A9_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-01       --------------------------------------------------
A0A2K6L919_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A0D9R4R5_BMF-01       --------------------------------------------------
J9PB65_BMF-04           --------------------------------------------------
J9PB65_BMF-03           --------------------------------------------------
J9PB65_BMF-02           --------------------------------------------------
J9PB65_BMF-01           --------------------------------------------------
A0A3Q2HR24_BMF-01       --------------------------------------------------
A0A3Q2HR24_BMF-02       --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      -----------------------MPTNSLLGFQSRSPLFRTTSTSSSGYF
G1LNV7_BBC3-01          ---------------------------------------------AQVWK
A0A2K5F6X4_BBC3-02      ---------------------------------------------SSTWV
F1RM01_BBC3-02          SPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYL
A0A3B4V919_BCL2L11      AKPQFERQRRAEPWPPRLHRRRRARLAAPVQNHSHLSCQHFSRRSSSGYF
A0A3B4XZH1_BCL2L11      AKPQFERQRRAETIA--------TSPGNSLGVFQKRSIFSYPRRSSSGYF
A0A3Q1ICY2_BCL2L11      -----------EPESQSRCRTKSSSSSDGLGVF--RSVFRLPRRSSSGYF
A0A3Q3K6I5_BCL2L11      -----------EPVSPSRCRTKAIAPLDSLSVFHTRSIFHLPRRSSSGYF
A0A3Q3ESW6_BCL2L11      -----------EPDSPSRCRFKPVSPVDSLGVFQKRSIFHLPRRASSGYF
A0A3Q2SZH6_BCL2L11      G-------GEPDSDSPPRS----IS-PNSLDVFQRRSIF----RKSSGYF
A0A3B3VNE0_BCL2L11      GGGGGG-GGEPDADSPPCS----VS-PASLDVFRSRSIFRPPRRSSSGYF
A0A3B3YII5_BCL2L11      GGGGGG-RGEPDSDSPPCS----VS-PASLDVFRSRSIFRPPRRSSSGYF
A0A3B3YII5_BCL2L11      GGGGGG-RGEPDSDSPPCS----VS-PASLDVFRSRSIFRPPRRSSSGYF
A0A3P9N073_BCL2L11      GGG----RGEPDSDSPPCT----VS-PASLDVFRSRSIFRPPRRSSSGYF
A0A3Q3B113_BCL2L11      -----------EPESPACS----SNPPAGLDVFRSRSIFRFPRRSSSGYF
A0A3B5M375_BCL2L11      GGEGEGRRGEPDSDSPPCS----VS-PASLDVFRSRSIFRPTRRSSSGYF
A0A3B5QAM1_BCL2L11      GGEGGGRRGEPDSDSPPCS----VS-PASLDVFRSRSIFRPPRRSSSGYF
A0A3B5QAM1_BCL2L11      GGEGGGRRGEPDSDSPPCS----VS-PASLDVFRSRSIFRPPRRSSSGYF
A0A3B4BVX1_BCL2L11      --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A3B1IH05_BAD-01       --------------------------------------------------
H3ANP3_BAD-01           --------------------------------------------------
H3ANP3_BAD-02           --------------------------------------------------
H3ANP3_BAD-03           --------------------------------------------------
A0A3B3QX41_BAD-01       --------------------------------------------------
A0A2I3TBK7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-03       --------------------------------------------------
A8MXU7_BAD-03           --------------------------------------------------
A0A2K5M0A7_BAD-02       --------------------------------------------------
A0A2K5XJR2_BAD-02       --------------------------------------------------
A0A2K5VCA9_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-02       --------------------------------------------------
A0A2K5HKU7_BAD-02       --------------------------------------------------
A0A2K6N196_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K5M0A7_BAD-03       --------------------------------------------------
A0A2K5VCA9_BAD-03       --------------------------------------------------
A0A096MLD5_BAD-02       --------------------------------------------------
A0A2K6E7I4_BAD-03       --------------------------------------------------
A8MXU7_BAD-04           --------------------------------------------------
A0A2I3TBK7_BAD-03       --------------------------------------------------
A0A2R8Z688_BAD-03       --------------------------------------------------
A0A2K5E6A6_BAD-03       --------------------------------------------------
A0A2K5PDB1_BAD-03       --------------------------------------------------
A0A2K6TG62_BAD-03       --------------------------------------------------
G3VRY3_BAD-01           --------------------------------------------------
G3VRY3_BAD-02           --------------------------------------------------
G1P8C5_BAD-01           --------------------------------------------------
A0A452ER54_BAD-02       --------------------------------------------------
W5P8G9_BAD-01           --------------------------------------------------
G3TP47_BAD-01           --------------------------------------------------
A0A1U7Q4V0_BAD-01       --------------------------------------------------
Q61337_BAD-01           --------------------------------------------------
A0A287CT05_BAD-02       --------------------------------------------------
A0A287CT05_BAD-01       --------------------------------------------------
O35147_BAD-01           --------------------------------------------------
A0A091DDU4_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
G1MI17_BAD-01           --------------------------------------------------
M3YNE7_BAD-01           --------------------------------------------------
A0A452RJM6_BAD-01       --------------------------------------------------
A0A384DJL2_BAD-01       --------------------------------------------------
A0A452ER54_BAD-01       --------------------------------------------------
F1MUT9_BAD-01           --------------------------------------------------
Q3SYZ0_BAD-01           --------------------------------------------------
F7DN67_BAD-01           --------------------------------------------------
F1PK10_BAD-01           --------------------------------------------------
Q45KI9_BAD-01           --------------------------------------------------
H0WVR2_BAD-01           --------------------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------------------
H0V608_BAD-01           --------------------------------------------------
A0A1S3FL84_BAD-01       --------------------------------------------------
A0A2K5PDB1_BAD-01       --------------------------------------------------
A0A2K5E6A6_BAD-01       --------------------------------------------------
A0A2K6TG62_BAD-01       --------------------------------------------------
A0A0D9R491_BAD-01       --------------------------------------------------
A0A2K5HKU7_BAD-01       --------------------------------------------------
A0A2K5XJR2_BAD-01       --------------------------------------------------
A0A2K6N196_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
B4DZQ9_BAD-01           --------------------------------------------------
A0A096MLD5_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-01       --------------------------------------------------
A0A2I2Z8C7_BAD-02       --------------------------------------------------
A0A2R8Z688_BAD-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01       --------------------------------------------------
A0A3B4DUY7_BAD-01       --------------------------------------------------
E7FBJ6_BAD-01           --------------------------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-01       --------------------------------------------------
A0A3P9A5G8_BAD-02       --------------------------------------------------
B5X1T1_BAD-01           --------------------------------------------------
A0A3Q2QC80_BAD-01       --------------------------------------------------
A0A3Q3FKT9_BAD-03       --------------------------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       --------------------------------------------------
I3K7B6_BAD-01           --------------------------------------------------
A0A3Q3C680_BAD-01       --------------------------------------------------
A0A3P8QRJ7_BAD-01       --------------------------------------------------
A0A3Q4GGN3_BAD-01       --------------------------------------------------
A0A3B4GXJ6_BAD-01       --------------------------------------------------
A0A3Q0QNQ2_BAD-01       --------------------------------------------------
A0A3P8WI83_BAD-02       --------------------------------------------------
A0A3P8WI83_BAD-01       --------------------------------------------------
A0A3Q2D5S0_BAD-01       --------------------------------------------------
A0A3P9HNZ2_BAD-01       --------------------------------------------------
A0A3B3BQF7_BAD-01       --------------------------------------------------
A0A3Q1K1C7_BAD-02       --------------------------------------------------
A0A3Q1K1C7_BAD-01       --------------------------------------------------
A0A3Q1GWH9_BAD-01       --------------------------------------------------
A0A3Q1CPU7_BAD-01       --------------------------------------------------
A0A3P8TWH6_BAD-01       --------------------------------------------------
A0A2U9BAC9_BAD-01       --------------------------------------------------
A0A3B4VFC5_BAD-01       --------------------------------------------------
A0A3B4W9T1_BAD-01       --------------------------------------------------
Q4V925_BAD-03           --------------------------------------------------
Q4V925_BAD-02           --------------------------------------------------
A7MCM4_BAD-01           --------------------------------------------------
Q4V925_BAD-01           --------------------------------------------------
Q4V925_BAD-04           --------------------------------------------------
A0A3P8Y761_BAD-01       --------------------------------------------------
A0A3B5Q2N7_BAD-01       --------------------------------------------------
A0A087X8P8_BAD-01       --------------------------------------------------
A0A3B3UA11_BAD-01       --------------------------------------------------
A0A3B3YFR1_BAD-01       --------------------------------------------------
A0A3P9Q7C3_BAD-01       --------------------------------------------------
A0A3B3HDU2_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-01       --------------------------------------------------
A0A3P9KSL7_BAD-02       --------------------------------------------------
A0A3B5BAL2_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-01       --------------------------------------------------
A0A3Q3AEL8_BAD-02       --------------------------------------------------
G3Q8B3_BAD-01           --------------------------------------------------
A0A3Q2Y0E4_BAD-01       --------------------------------------------------
A0A3Q3R5S3_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-01       --------------------------------------------------
A0A3Q3RXS8_BAD-02       --------------------------------------------------
A0A3Q0QNQ2_BAD-02       --------------------------------------------------
A0A3Q3WTY4_BAD-01       --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       ------------------------------WSSVG---------------
F7FUT7_BIK-02           ------------------------------RSRAGPRAADTTPLGWVADS
F7FUT7_BIK-01           ------------------------------LLSGSPRPEG----------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B4B6Y3_BMF-01       --------------------------------------------------
A0A3P9ICE1_BMF-01       --------------------------------------------------
Q0GKC7_BMF-01           --------------------------------------------------
A0A3B3RH63_BMF-01       --------------------------------------------------
W5N4P7_BMF-01           --------------------------------------------------
A0A3B1K1X5_BMF-01       --------------------------------------------------
A0A3B4CNJ8_BMF-01       --------------------------------------------------
A0A2U9CJH3_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-01       --------------------------------------------------
A0A3Q2YCX7_BMF-02       --------------------------------------------------
A0A3P8ZIE7_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-02       --------------------------------------------------
A0A3Q3QZ16_BMF-01       --------------------------------------------------
A0A3Q3QZ16_BMF-02       --------------------------------------------------
A0A3Q2PJX9_BMF-01       --------------------------------------------------
A0A3Q2PJX9_BMF-03       --------------------------------------------------
A0A3B5QK08_BMF-01       --------------------------------------------------
A0A3B5QK08_BMF-02       --------------------------------------------------
A0A096LRV0_BMF-01       --------------------------------------------------
A0A3B3WU80_BMF-01       --------------------------------------------------
A0A3P9Q8E2_BMF-01       --------------------------------------------------
A0A3Q2CXC4_BMF-02       --------------------------------------------------
A0A3Q2CXC4_BMF-01       --------------------------------------------------
A0A3Q3GUU5_BMF-01       --------------------------------------------------
A0A3B5B8F6_BMF-01       --------------------------------------------------
A0A3Q3VLX6_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-02       --------------------------------------------------
A0A3P8UA78_BMF-01       --------------------------------------------------
A0A3P8UA78_BMF-03       --------------------------------------------------
A0A3B3CGR9_BMF-01       --------------------------------------------------
A0A3P9K487_BMF-02       --------------------------------------------------
A0A3P9K487_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-03       --------------------------------------------------
A0A3B3HAU1_BMF-02       --------------------------------------------------
A0A3B3HAU1_BMF-01       --------------------------------------------------
A0A3B3HAU1_BMF-04       --------------------------------------------------
A0A3P9ICE1_BMF-04       --------------------------------------------------
A0A3Q2ZA20_BMF-01       --------------------------------------------------
A0A3P8NFE2_BMF-02       --------------------------------------------------
I3K2D6_BMF-01           --------------------------------------------------
A0A3P8NFE2_BMF-01       --------------------------------------------------
A0A3Q3C5V2_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-01       --------------------------------------------------
A0A3P9DPJ5_BMF-02       --------------------------------------------------
A0A3B4ETH0_BMF-01       --------------------------------------------------
A0A3Q4G1I4_BMF-01       --------------------------------------------------
A0A3Q1FVH7_BMF-02       --------------------------------------------------
A0A3Q1FVH7_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-01       --------------------------------------------------
A0A3Q1D1K3_BMF-01       --------------------------------------------------
A0A3P8RKY9_BMF-01       --------------------------------------------------
A0A3Q3RVI2_BMF-02       --------------------------------------------------
A0A3Q1IPR4_BMF-01       --------------------------------------------------
A0A3B4U5H8_BMF-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
A0A3Q3SYA1_BCL2L11      ---------------------------------------------FHTRS
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       -------------PDGEGDSCPQGSPQGPQAPPASPGPFATRSPLFIFVR
G3W979_BCL2L11-01       --------------SGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFVR
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      -----------------------------PASPGSPGPFAIRSPLFFFVR
C1C3S9_BAD-01           -----------PNLRRIKGKETRQRTESASEASETD--------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       -----------GAFRARSRSAP---------------------PILWAAM
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------SGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLR
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       ---------------GEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K6TRU4_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K5NU92_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2I2YQ13_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K5X1Y3_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K6QIL2_BCL2L11      -----------DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K5HZI5_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2I3GVB2_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2R9C366_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2I3SN61_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K5HZI5_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2I2YQ13_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K6QIL2_BCL2L11      -----------DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K5Q1Y0_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K6GE31_BCL2L11      -----------GSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A1U7T0R1_BCL2L11      -----------GSPGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A1U7T0R1_BCL2L11      -----------GSPGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
O54918_BCL2L11-01       -------------PDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
O88498_BCL2L11-01       -------------PDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K5Z7V3_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A096NYC3_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K5X1Y3_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K6E212_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K5NU92_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A096NYC3_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2K6KJP8_BCL2L11      -----------DNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2I3SN61_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMR
A0A2R8M6L7_BCL2L11      -----------GNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K5CA89_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K5Q1Y0_BCL2L11      -----------GNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A1U7T0R1_BCL2L11      -----------GSPGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A1U7T0R1_BCL2L11      -----------GSPGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A3Q2GRS5_BCL2L11      ---------------GEGDRCPQGSPLGPLAPPASPGPFATRSPFFIFVR
J9NWV6_BCL2L11-04       ---------------GEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
U6CTE3_BCL2L11-02       ---------------GEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
A0A1U8BW10_BCL2L11      -------------PDGEGDRCPHGSPQGPLAPPASPGPSATRSPLFIFVR
A0A1U7T0R1_BCL2L11      -----------GSPGGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2K6GE31_BCL2L11      -----------GSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A287DFJ0_BCL2L11      -------------PEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A452FCR6_BCL2L11      -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
W5PY58_BCL2L11-01       -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
L8IVA4_BCL2L11-02       -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
A0A286XJN2_BCL2L11      -------------PEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVR
A0A286XJN2_BCL2L11      -------------PEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVR
G1SSY0_BCL2L11-02       ----------------EGDRCAHGSPQGPLAPSASPGPFATRSPLFIFVR
A0A250YBV9_BCL2L11      -----------GSPAGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
H0XW23_BCL2L11-01       -----------GNPEVEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
A0A1S3FFM9_BCL2L11      -----------GSPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
U6CTE3_BCL2L11-01       -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
G1LDR8_BCL2L11-01       -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
J9NWV6_BCL2L11-03       -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
A0A2I2UX96_BCL2L11      -------------PEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JLM2_BAD-01       --------------------------------------------------
Q61337_BAD-05           -----------PYLAPGLL-------------------------------
A0A3B1JXK6_BCL2L11      -----------VRGPPALHNSLLGYQTRSPLFRTLSRSSS----------
A0A3B4BVX1_BCL2L11      -----------VRGGITMPNSLLGYQSRSPLFRTLSRSSS----------
A0A2I3HWI8_BBC3-03      -------------MKFGMG-----------SARACPCQVP----------
A0A3Q2GWE8_BBC3-02      -------------VRVSAG-----------AARACLCQAP----------
A0A2K6STD6_BBC3-02      -------------MKCGMG-----------SAWACPCQVP----------
A0A2R8MW85_BBC3-02      -------------MKCGVG-----------SAWACPCQVP----------
A0A2K5QNS7_BBC3-02      -------------MKCGVG-----------SAWACPCQVP----------
A0A2K6FQZ1_BBC3-04      -------------MKFGAG-----------SARACPCQVP----------
A0A2R9BZA9_BBC3-01      -------------MKFGMG-----------SAQACPCQVP----------
A0A2I3RGH5_BBC3-03      -------------MKFGMG-----------SAQACPCQVP----------
A0A2K5P2T8_BBC3-03      -------------IKFGVG-----------SARACPCQVP----------
A0A2K5V8J3_BBC3-03      -------------IKFGVG-----------SARACPCQVP----------
A0A2K6ASP2_BBC3-03      -------------IKFGVG-----------SARACPCQVP----------
A0A2I3N2Z9_BBC3-03      -------------IKFGVG-----------SARACPCQVP----------
A0A2K6QZT2_BBC3-04      -------------IKFGVG-----------SARACPCQVP----------
F7GL32_BBC3-02          -----------SLCEAGLNPSGDSMCPAPGPALAPSSLLP--LAYFCTRQ
F7GL32_BBC3-01          -----------SLCEAGLNPSGDSMCPAPGPALAPSSLLP--LAYFCTRQ
J9NTK9_BBC3-01          -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
F1RM01_BBC3-04          -----------GLCEPGLP-----------AAPAAPTLLP--AAYLCAPT
G3T2N1_BBC3-01          -----------GLCEPGLP-----------RV-AGPRLLPGPRTQLFPSP
A0A250YBU3_BBC3-01      -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
M3Y0R3_BBC3-01          -----------GLWESDCS-----------PRVAAHGLFRAGAAAVSQPP
A0A1U7R5N5_BBC3-01      -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
Q99ML1_BBC3-02          -----------SLCEPGLP-----------AAPAAPALLP--AAYLCAPT
Q80ZG6_BBC3-01          -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
H0XQ00_BBC3-01          -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
A0A0D9S2H2_BBC3-01      -----------GLCEPGLA-----------AAPAAPALLP--AAYLCAPT
B4DQK3_BBC3-01          -----------GLCEPGLA-----------AAPAAPTLLP--AAYLCAPT
A0A250YBU3_BBC3-02      -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
A0A3Q1LXZ6_BBC3-01      -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
A0A452E3G1_BBC3-01      -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
F1RM01_BBC3-03          -----------GLCEPGLP-----------AAPAAPTLLP--AAYLCAPT
A0A2I3RGH5_BBC3-01      -----------GLCEPGLA-----------AAPAAPTLLP--AAYLCAPT
H2NZD3_BBC3-01          -----------GLCEPGLA-----------AAPAAPALLP--AAYLCAPT
A0A2K6QZT2_BBC3-01      -----------GLCEPGLA-----------ATPAAPALLP--AAYLCAPT
A0A2K6FQZ1_BBC3-01      -----------GLCEPGLP-----------AAPAAPALLP--AAYLCAPT
A0A337SAW2_BAD-01       --------------------------------------------------
A0A2R8MW85_BBC3-03      -----------GLCESGLP-----------ATPAAPALLP--AAYLCAPA
C1KGB6_BCL2L11-02       --------------------------------------------------
C1KGB6_BCL2L11-03       ------------------P-----------TSPGPFATRS--PLFIFVRR
C1KGB6_BCL2L11-01       ------------------P-----------TSPGPFATRS--PLFIFVRR
J9NWV6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      ------------------P-----------ASPGPFATRS--PFFIFVRR
J9NTK9_BBC3-03          ------------------A-----------LGTGRWDGRR--AHGPAEGP
J9NTK9_BBC3-02          ------------------A-----------LTQGPWS-------------
A0A3Q2GWE8_BBC3-01      ------------------A-----------PTQGPSG-------------
Q9BXH1_BBC3-03          ------------------A-----------LTQGPQS-------------
A0A493T7X1_BMF-01       -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A452H3N6_BMF-01       -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A287AIU8_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
G1PAU1_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A287AIU8_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A1U8CPE0_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A286XXB0_BMF-03       -----------DCPLGRLH-----------LFPLTHCCGP----------
A0A287CXH0_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A1S3EQA2_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A2AV74_BMF-02           -----------DCPLSRLQ-----------LFPLTHCCGP----------
H9GL49_BMF-01           -----------NCLLGRFQ-----------LFPLTHCCGP----------
A0A3Q2UCA0_BMF-02       -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A3Q2UCA0_BMF-01       -----------SCLLGRFQ-----------LFPLTHCCGP----------
K7FRX2_BMF-01           -----------SCLLGRFQ-----------LFPLTHCCGP----------
U3JS06_BMF-01           -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A493T7X1_BMF-02       -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A3Q2UCA0_BMF-03       -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A3Q2UCA0_BMF-04       -----------SCLLGRFQ-----------LFPLTHCCGP----------
G1NHG8_BMF-01           -----------SCLLGRFQ-----------LFPLTHCCGP----------
A0A337ST43_BMF-02       -----------DCPLSHLQ-----------LFPLTHCCGP----------
A0A2K5KGP2_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6FFN3_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5E1Q4_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5RN49_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6TW78_BMF-03       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6RAW1_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2I2Z168_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2R9BS98_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2J8QDD5_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5MJW4_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5VLE9_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6B5F6_BMF-03       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5Z4A9_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A096NTE9_BMF-03       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2I3HD83_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A1S3EQA2_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
Q8K589_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A337ST43_BMF-05       -----------DCPLSHLQ-----------LFPLTHCCGP----------
A0A337ST43_BMF-04       -----------DCPLSHLQ-----------LFPLTHCCGP----------
A2AV74_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A286XXB0_BMF-02       -----------DCPLGRLH-----------LFPLTHCCGP----------
G3WDQ2_BMF-01           -----------DYMLDGLQ-----------LFPLTHCCGP----------
G3T7Z4_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A287CXH0_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A1S3WU31_BMF-01       -----------DCSLSRLQ-----------LFPLTHCCGP----------
A0A337ST43_BMF-03       -----------DCPLSHLQ-----------LFPLTHCCGP----------
A0A337ST43_BMF-01       -----------DCPLSHLQ-----------LFPLTHCCGP----------
A0A1U8CPE0_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
G1SR62_BMF-01           -----------DCPLGRLH-----------LFPLTHCCGP----------
M3YAD5_BMF-01           -----------DCPLSRLH-----------LFPLTHCCGP----------
U6CSY8_BMF-01           -----------DCPLSRLH-----------LFPLTHCCGP----------
A0A452SED0_BMF-01       -----------DCPLSRLH-----------LFPLTHCCGP----------
A0A384D070_BMF-01       -----------DCPLSRLH-----------LFPLTHCCGP----------
W5QFV1_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
L8IXF5_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A452F2E0_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A452F2E0_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
Q05KI3_BMF-02           -----------DCPLSRLQ-----------LFPLTHCCGP----------
Q05KI3_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6FFN3_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
H0WYH6_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A096NTE9_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6L919_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5E1Q4_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6TW78_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6TW78_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5RN49_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2I2Z168_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2R9BS98_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2J8QDD5_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2J8T301_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
F7CM09_BMF-01           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5MJW4_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5KGP2_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5VLE9_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
F7CM09_BMF-03           -----------DCPLSRLQ-----------LFPLTHCCGP----------
F7CM09_BMF-02           -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6B5F6_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6B5F6_BMF-02       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6B5F6_BMF-04       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K5Z4A9_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6L919_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6L919_BMF-03       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A2K6RAW1_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
A0A0D9R4R5_BMF-01       -----------DCPLSRLQ-----------LFPLTHCCGP----------
J9PB65_BMF-04           -----------DCPLSRLH-----------LFPLTHCCGP----------
J9PB65_BMF-03           -----------DCPLSRLH-----------LFPLTHCCGP----------
J9PB65_BMF-02           -----------DCPLSRLH-----------LFPLTHCCGP----------
J9PB65_BMF-01           -----------DCPLSRLH-----------LFPLTHCCGP----------
A0A3Q2HR24_BMF-01       -----------DCPLSHLR-----------LFPLTHCCGP----------
A0A3Q2HR24_BMF-02       -----------DCPLSHLR-----------LFPLTHCCGP----------
A0A2I2YVQ5_PMAIP1-      -----------ARAPAGP--------------------------------
A0A2I3SX38_PMAIP1-      -----------ARAPAGP--------------------------------
A0A2K5JY17_PMAIP1-      -----------ARAQAGT--------------------------------
A0A2R9AKC9_PMAIP1-      -----------ARAPAGP--------------------------------
A0A2K6KJF1_PMAIP1-      -----------ARAQAGPA-------------------------------
A0A2K6NC45_PMAIP1-      -----------ARAQAGPA-------------------------------
A0A096MPU8_PMAIP1-      -----------TRAQAGQA-------------------------------
A0A2K5ZWH1_PMAIP1-      -----------TRAQAGQA-------------------------------
A0A2K5VPX2_PMAIP1-      -----------TRAQAGQA-------------------------------
A0A2K6BV43_PMAIP1-      -----------TRAQAGPA-------------------------------
W5QCU2_BIK-01           --------------------------------------------------
A0A3Q2LHE3_BIK-01       --------------------------------------------------
A0A452QUG1_BIK-01       --------------------------------------------------
A0A452V3L2_BIK-01       --------------------------------------------------
A0A3B4CPH6_BAD-01       -----------PLVPERFR-------------------------------
M3XHJ5_BCL2L11-01       ---------------MPTE-------------------------------
G1TZR9_BIK-01           -----------PGSRDLFQ-------------------------------
A0A2K5QXZ1_BIK-01       -----------PLSIDILM-------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           -----------LMARDV-I-------------------------------
O70337_BIK-01           -----------LMARDV-I-------------------------------
Q925D2_BIK-01           -----------LMARDI-I-------------------------------
A0A1S3FUQ7_BIK-01       -----------SVTRDLFI-------------------------------
H0XAE7_BIK-01           -----------PVSMDHFM-------------------------------
A0A2K6FM79_BIK-01       -----------PVSTDLLM-------------------------------
H0W025_BIK-01           -----------PVARDPLM-------------------------------
A0A2K5CLG5_BIK-01       -----------PLSSDILM-------------------------------
A0A2K6TBD7_BIK-01       -----------PLSSDILM-------------------------------
H2P4N6_BIK-01           -----------PISRDILM-------------------------------
G1S1X2_BIK-01           -----------PISRDILM-------------------------------
G3QCT2_BIK-01           -----------PLSRDILM-------------------------------
A0A2R8ZXD2_BIK-01       -----------PLSRDILM-------------------------------
H2QLU7_BIK-01           -----------PLSRDILM-------------------------------
A0A2K6MCW0_BIK-01       -----------PVSRDILM-------------------------------
A0A2K6QK74_BIK-01       -----------PVSRDILM-------------------------------
A0A0D9QZY8_BIK-01       -----------PISRHILM-------------------------------
A0A2K5VW94_BIK-01       -----------PISRDTLM-------------------------------
A0A2K6DBJ4_BIK-01       -----------PISRDTLM-------------------------------
A0A2K5J4Q7_BIK-01       -----------PISRDILM-------------------------------
A0A096NKG5_BIK-01       -----------PISRDILM-------------------------------
A0A2K5LDM6_BIK-01       -----------PISRDTWM-------------------------------
A0A2K5XSA1_BIK-01       -----------PISRDTLM-------------------------------
A0A3P8XIA2_BCL2L11      -----------SFDCDSIP-------------------------------
G1LNV7_BBC3-01          LRPRCVTGGKHRLRGGSEG-------------------------------
A0A2K5F6X4_BBC3-02      PCQMC---------------------------------------------
F1RM01_BBC3-02          CAPTAPPAVTAALGGPRWP-------------------------------
A0A3B4V919_BCL2L11      -----------SFDSDSLP-------------------------------
A0A3B4XZH1_BCL2L11      -----------SFDSDSLP-------------------------------
A0A3Q1ICY2_BCL2L11      -----------SYDSDSQP-------------------------------
A0A3Q3K6I5_BCL2L11      -----------SNDSDSVP-------------------------------
A0A3Q3ESW6_BCL2L11      -----------SYDGDSLP-------------------------------
A0A3Q2SZH6_BCL2L11      -----------SFDCESLP-------------------------------
A0A3B3VNE0_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3B3YII5_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3B3YII5_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3P9N073_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3Q3B113_BCL2L11      -----------SFEGDSLP-------------------------------
A0A3B5M375_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3B5QAM1_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3B5QAM1_BCL2L11      -----------SFDCDSLP-------------------------------
A0A3B4BVX1_BCL2L11      -----------VRGGITMP-------------------------------
Q9GL49_PMAIP1-01        -----------FGPPPAAV-------------------------------
A0A3B1IH05_BAD-01       -----------HITVPEKL-------------------------------
H3ANP3_BAD-01           -----------SRTAPNLQ-------------------------------
H3ANP3_BAD-02           -----------SRTAPNLQ-------------------------------
H3ANP3_BAD-03           -----------SRTAPNLQ-------------------------------
A0A3B3QX41_BAD-01       -----------NTKNPGEA-------------------------------
A0A2I3TBK7_BAD-01       -----------HRQAPGLL-------------------------------
A0A2I2Z8C7_BAD-03       -----------HRQAPGLL-------------------------------
A8MXU7_BAD-03           -----------HRQAPGLL-------------------------------
A0A2K5M0A7_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K5XJR2_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K5VCA9_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K6E7I4_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K5HKU7_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K6N196_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K6PUL3_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K5M0A7_BAD-03       -----------HRQAPGLL-------------------------------
A0A2K5VCA9_BAD-03       -----------HRQAPGLL-------------------------------
A0A096MLD5_BAD-02       -----------HRQAPGLL-------------------------------
A0A2K6E7I4_BAD-03       -----------HRQAPGLL-------------------------------
A8MXU7_BAD-04           -----------HRQAPGLL-------------------------------
A0A2I3TBK7_BAD-03       -----------HRQAPGLL-------------------------------
A0A2R8Z688_BAD-03       -----------HRQAPGLL-------------------------------
A0A2K5E6A6_BAD-03       -----------PRQAPGLP-------------------------------
A0A2K5PDB1_BAD-03       -----------RRQAPGLP-------------------------------
A0A2K6TG62_BAD-03       -----------RRQAPGLP-------------------------------
G3VRY3_BAD-01           -----------HHEGAGAG-------------------------------
G3VRY3_BAD-02           -----------HHEKGGAQ-------------------------------
G1P8C5_BAD-01           -----------WSTVPGLL-------------------------------
A0A452ER54_BAD-02       -----------WLTAPGLL-------------------------------
W5P8G9_BAD-01           -----------WLTAPGLL-------------------------------
G3TP47_BAD-01           -----------HRVAPGFL-------------------------------
A0A1U7Q4V0_BAD-01       -------------LAPGLL-------------------------------
Q61337_BAD-01           -------------LAPGLL-------------------------------
A0A287CT05_BAD-02       -------------LAPGLP-------------------------------
A0A287CT05_BAD-01       -------------LAPGLP-------------------------------
O35147_BAD-01           -------------LAPGLL-------------------------------
A0A091DDU4_BAD-01       -------------PARGFL-------------------------------
A0A287AEF3_BAD-01       -----------WRTAPGHL-------------------------------
G1MI17_BAD-01           -----------RQTAPGLL-------------------------------
M3YNE7_BAD-01           -----------LQTAPGLL-------------------------------
A0A452RJM6_BAD-01       -----------RQTAPGLL-------------------------------
A0A384DJL2_BAD-01       -----------RQTAPGLL-------------------------------
A0A452ER54_BAD-01       ---------------PGLL-------------------------------
F1MUT9_BAD-01           -----------WLTAPGLL-------------------------------
Q3SYZ0_BAD-01           -----------WLTAPGLL-------------------------------
F7DN67_BAD-01           -----------QRTAPGLL-------------------------------
F1PK10_BAD-01           -----------QQTAPGLL-------------------------------
Q45KI9_BAD-01           -----------QQTAPGLL-------------------------------
H0WVR2_BAD-01           -----------RCTTPSLL-------------------------------
A0A2K6GWV0_BAD-01       -----------PCTAPSFL-------------------------------
H0V608_BAD-01           -------------PAGGFL-------------------------------
A0A1S3FL84_BAD-01       -------------PAPGLL-------------------------------
A0A2K5PDB1_BAD-01       -----------RRQAPGLP-------------------------------
A0A2K5E6A6_BAD-01       -----------PRQAPGLP-------------------------------
A0A2K6TG62_BAD-01       -----------RRQAPGLP-------------------------------
A0A0D9R491_BAD-01       -----------HHQAPGLL-------------------------------
A0A2K5HKU7_BAD-01       -----------HRQAPGLL-------------------------------
A0A2K5XJR2_BAD-01       -----------HRQAPGLL-------------------------------
A0A2K6N196_BAD-01       -----------HRQAPGLL-------------------------------
A0A2K6PUL3_BAD-01       -----------HRQAPGLL-------------------------------
B4DZQ9_BAD-01           -----------HRQAPGLL-------------------------------
A0A096MLD5_BAD-01       -----------HRQAPGLL-------------------------------
A0A2I2Z8C7_BAD-01       -----------HRQAPGLL-------------------------------
A0A2I2Z8C7_BAD-02       -----------HRQAPGLL-------------------------------
A0A2R8Z688_BAD-01       -----------HRQAPGLL-------------------------------
A0A2J8TYJ3_BAD-01       -----------HRQAPGLL-------------------------------
A0A3B4DUY7_BAD-01       -----------ISPASPDE-------------------------------
E7FBJ6_BAD-01           -----------HQDRTSAN-------------------------------
B5XEF1_BAD-01           --------------------------------------------------
A0A3Q3FKT9_BAD-01       -----------SLTLPELR-------------------------------
A0A3P9A5G8_BAD-01       -----------NTSTNTSN-------------------------------
A0A3P9A5G8_BAD-02       -----------NTSTNTSN-------------------------------
B5X1T1_BAD-01           -----------YVSTRTGI-------------------------------
A0A3Q2QC80_BAD-01       -----------ALTLPELR-------------------------------
A0A3Q3FKT9_BAD-03       -----------SLTLPELR-------------------------------
H3D8J8_BAD-01           --------------------------------------------------
A0A3B5L9R9_BAD-01       --------------------------------------------------
A0A3P9B2E4_BAD-01       -----------TLSLPVTK-------------------------------
I3K7B6_BAD-01           -----------TLALPVIK-------------------------------
A0A3Q3C680_BAD-01       -----------TLSLPVIK-------------------------------
A0A3P8QRJ7_BAD-01       -----------TLSLPVTK-------------------------------
A0A3Q4GGN3_BAD-01       -----------TLSLPVIK-------------------------------
A0A3B4GXJ6_BAD-01       -----------TLSLPVIK-------------------------------
A0A3Q0QNQ2_BAD-01       -----------DQNTSPMR-------------------------------
A0A3P8WI83_BAD-02       -----------NLTLPELR-------------------------------
A0A3P8WI83_BAD-01       -----------NLTLPELR-------------------------------
A0A3Q2D5S0_BAD-01       ---------------PRIR-------------------------------
A0A3P9HNZ2_BAD-01       -----------SLTLPELR-------------------------------
A0A3B3BQF7_BAD-01       -----------ALTLPELR-------------------------------
A0A3Q1K1C7_BAD-02       -----------TLTLPELR-------------------------------
A0A3Q1K1C7_BAD-01       -----------TLTLPELR-------------------------------
A0A3Q1GWH9_BAD-01       -----------NMALPELR-------------------------------
A0A3Q1CPU7_BAD-01       -----------NMALPELR-------------------------------
A0A3P8TWH6_BAD-01       -----------NMALPELR-------------------------------
A0A2U9BAC9_BAD-01       -----------TLALPELR-------------------------------
A0A3B4VFC5_BAD-01       -----------TLTLPELR-------------------------------
A0A3B4W9T1_BAD-01       -----------TLTLPELR-------------------------------
Q4V925_BAD-03           -----------HLTVPDRL-------------------------------
Q4V925_BAD-02           -----------HLTVPDRL-------------------------------
A7MCM4_BAD-01           -----------HLTVPDRL-------------------------------
Q4V925_BAD-01           -----------HLTVPDRL-------------------------------
Q4V925_BAD-04           -----------HLTVPDRL-------------------------------
A0A3P8Y761_BAD-01       -----------SLNLPG---------------------------------
A0A3B5Q2N7_BAD-01       -----------TLTLPELR-------------------------------
A0A087X8P8_BAD-01       -----------TLTLPELR-------------------------------
A0A3B3UA11_BAD-01       -----------TLTLPELR-------------------------------
A0A3B3YFR1_BAD-01       -----------TLTLPELR-------------------------------
A0A3P9Q7C3_BAD-01       -----------TLTLPELR-------------------------------
A0A3B3HDU2_BAD-01       -----------SLTLPELR-------------------------------
A0A3P9KSL7_BAD-01       -----------SLTLPELR-------------------------------
A0A3P9KSL7_BAD-02       -----------SLTLPELR-------------------------------
A0A3B5BAL2_BAD-01       -----------NLALPELR-------------------------------
A0A3Q3AEL8_BAD-01       -----------RLTLPELR-------------------------------
A0A3Q3AEL8_BAD-02       -----------RLTLPELR-------------------------------
G3Q8B3_BAD-01           -----------TLTLPELR-------------------------------
A0A3Q2Y0E4_BAD-01       -----------RLTLPELP-------------------------------
A0A3Q3R5S3_BAD-01       -----------SLTLPELR-------------------------------
A0A3Q3RXS8_BAD-01       -----------ALALPELR-------------------------------
A0A3Q3RXS8_BAD-02       -----------ALALPELR-------------------------------
A0A3Q0QNQ2_BAD-02       -----------FWSLPKAF-------------------------------
A0A3Q3WTY4_BAD-01       -----------TLTLPELR-------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           ----------------------DPNL--------QEEPQE----------
Q6P7C5_BAD-01           -----------------------PEF--------EPSEQEDASTTDRG--
A3KND0_BMF-01           ----------------------GPGC--------RGTDNEDKATQTLGSP
A0A2K6KS56_BBC3-02      ------------------LAE-RTWS---------RGASPGALAA--PG-
Q2PG01_BAD-01           ----------------MEEEP-SPFR--------GRSRSAPPN-------
A0A2I3H4B2_BAD-01       ----------------MGEEP-SPFR--------GRSRSAPPN-------
F7G1G0_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSSD-
A0A1U7R468_HRK-01       ------------------MCP-CPRH---------RGHGPPAVCGCGDT-
P62816_HRK-03           ------------------MCP-CPRH---------RGRGPPAVCGCGDA-
P62817_HRK-01           ------------------MCP-CPRH---------RGRGPPAVCGCGDA-
A0A2K5KZ69_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCDCSAG-
H2NIS8_HRK-01           ------------------MCP-CPLH---------RDRGPPAVCACSAG-
H2Q6Y8_HRK-01           ------------------MCP-CPLH---------RGRDPPAVCACSAG-
G3UH24_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A2K5BYA0_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
U3E722_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A452DXE5_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A0D9SC73_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A3Q2IBL3_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A337SQ56_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
G3QTJ6_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A2K6AYL7_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
G1QHD8_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSAG-
G1T7W1_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSAG-
H0Y001_HRK-01           ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A096N944_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A2K6GL98_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
A0A2K5PIE7_HRK-01       ------------------MCP-CPLH---------RGRGPPAVCACSAG-
I3LVX0_BIK-01           ----------------------ASLRENMWFWRPAAPSTRVPPA------
A0A286XF37_PMAIP1-      ----------------P-NSTRAELEVECAAQLRRVGDTLNSLGCTTEAL
A0A1U7QLK6_PMAIP1-      ----------------PSNPARAELAPEFIAQLRRIGDKLSSEWCEPDII
Q9JM54_PMAIP1-01        ----------------PVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDIT
Q5U777_PMAIP1-01        ----------------PLNPTRAELPPEFAAQLRKIGDKVYCTWSAPDIT
A0A3Q2LHE3_BIK-02       ----------------EEMSQVGPVSRDLFLDAFLHER--SPEALEVPG-
F7FUT7_BIK-02           AIIAATAAAAAAAAARGEMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGG
F7FUT7_BIK-01           ----------------GEMSEVRPLSSDIFMETLLCEQFVDPLTMEVVGG
O61667_EGL1-01          ----------------------------------SSCEDSSQFADDSGF-
A0A3G3M2M0_BCL2L11      -----------------------RSSSGYFSVD-SDSVPGSPLLPNISE-
A0A3Q1ELG4_BCL2L11      ----------------------RRSSSGYFSADGSDSVPSSPLSPKRLT-
A0A3Q1CI15_BCL2L11      ----------------------RRSSSGYFSADGADSVPSSPLSPKRLT-
F1SMU1_PMAIP1-01        ----------------------------------LPLARFCPTAPRAAC-
Q9BXH1_BBC3-04          ----------------------LTLEGPVQSHHGTPALTQGPQSPRDGAQ
A0A3B4UNJ0_BMF-01       ----------------LWGTSFRDVK-----YEDRATPIAAG--------
B2KKY9_BCL2L11-01       -----------------------------------GPASQGSGESTGGGV
B8JK68_BCL2L11-01       -----------------------------------GPASQGSGESTGGGV
A0A3B4B6Y3_BMF-01       ----------------CWHTTFRQIK-----CEDRATQTPGPALAPNKG-
A0A3P9ICE1_BMF-01       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
Q0GKC7_BMF-01           ----------------HWPPPHLQIK---------QTELAGRPAGSRNG-
A0A3B3RH63_BMF-01       ----------------TYQPPFRDIK-----CENRGTQTPGPALVQGLN-
W5N4P7_BMF-01           ----------------CWGTQFREIK-----YEDKGTQTPSPALVHGDN-
A0A3B1K1X5_BMF-01       ----------------PWRSPISVIK-----QEERGTQTPGRPPARTNG-
A0A3B4CNJ8_BMF-01       ----------------YWRSSIREIK-----QEERGTQTPGRPPARPNG-
A0A2U9CJH3_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALALNNG-
A0A3Q2YCX7_BMF-01       ----------------CWRTTFKEIK-----CEERATQTPGPVPASNNG-
A0A3Q2YCX7_BMF-02       ----------------CWRTTFKEIK-----CEERATQTPGPVPASNNG-
A0A3P8ZIE7_BMF-01       ----------------CWHTASREIK-----YEDRGTQTPTTALALLND-
A0A3Q2PJX9_BMF-02       ----------------CWRTPFREIK-----CEDRGTQTPGPALAPNNG-
A0A3Q3QZ16_BMF-01       ----------------CWRTAFREIK-----CEDRGTQTAGPTLAPNNS-
A0A3Q3QZ16_BMF-02       ----------------CWRTAFREIK-----CEDRGTQTAGPTLAPNNS-
A0A3Q2PJX9_BMF-01       ----------------CWRTPFREIK-----CEDRGTQTPGPALAPNNG-
A0A3Q2PJX9_BMF-03       ----------------CWRTPFREIK-----CEDRGTQTPGPALAPNNG-
A0A3B5QK08_BMF-01       ----------------CWRTPFREIK-----CEDRGTQTPGPGQALHNG-
A0A3B5QK08_BMF-02       ----------------CWRTPFREIK-----CEDRGTQTPGPGQALHNG-
A0A096LRV0_BMF-01       ----------------CWRTPFREIK-----CEDRGTQTPGPGQALHNG-
A0A3B3WU80_BMF-01       ----------------CWRTPFREIK-----CEDRGTQTPGPGQALHNG-
A0A3P9Q8E2_BMF-01       ----------------CWRTPFREIK-----CEDRGTQTPGPGQALHNG-
A0A3Q2CXC4_BMF-02       ----------------SWHTPFREIK-----FEDRGTQTPGPGVAPHNV-
A0A3Q2CXC4_BMF-01       ----------------SWHTPFREIK-----FEDRGTQTPGPGVAPHNV-
A0A3Q3GUU5_BMF-01       ----------------SWRTYFQEIK-----CEDRGTQTPGPALAPNNG-
A0A3B5B8F6_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALQPNNG-
A0A3Q3VLX6_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALAPYSG-
A0A3P8UA78_BMF-02       ----------------SWHTTFREIR-----CEDRGTQTPGPDLALNNG-
A0A3P8UA78_BMF-01       ----------------SWHTTFREIR-----CEDRGTQTPGPDLALNNG-
A0A3P8UA78_BMF-03       ----------------SWHTTFREIR-----CEDRGTQTPGPDLALNNG-
A0A3B3CGR9_BMF-01       ----------------NWRTAVRKIK-----CEDRGTQTPGPALVPNNG-
A0A3P9K487_BMF-02       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3P9K487_BMF-01       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3B3HAU1_BMF-03       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3B3HAU1_BMF-02       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3B3HAU1_BMF-01       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3B3HAU1_BMF-04       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3P9ICE1_BMF-04       ----------------KWRTTARKIK-----CEDRGTQTPGPALVPNNG-
A0A3Q2ZA20_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALVPHSG-
A0A3P8NFE2_BMF-02       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
I3K2D6_BMF-01           ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3P8NFE2_BMF-01       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3Q3C5V2_BMF-01       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3P9DPJ5_BMF-01       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3P9DPJ5_BMF-02       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3B4ETH0_BMF-01       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3Q4G1I4_BMF-01       ----------------CWRTTFREIK-----CEHRGTQTPGPALVPNNG-
A0A3Q1FVH7_BMF-02       ----------------CWRTTFREIK-----CEDRGTQTPGPALQPNNG-
A0A3Q1FVH7_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALQPNNG-
A0A3Q3RVI2_BMF-01       ----------------FWRTTFREIK-----CEDRGTQTPGPALALNNG-
A0A3Q1D1K3_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALQPNNG-
A0A3P8RKY9_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALQPNNG-
A0A3Q3RVI2_BMF-02       ----------------FWRTTFREIK-----CEDRGTQTPGPALALNNG-
A0A3Q1IPR4_BMF-01       ----------------CWRTTFREIK-----CQDRGTQTPGPALPQNNG-
A0A3B4U5H8_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALALNNG-
A0A3B4WM88_BMF-01       ----------------CWRTTFREIK-----CEDRGTQTPGPALALNNG-
A0A3Q3SYA1_BCL2L11      IFQLPRRSSSGYFSSDGDSLPSSPLSPRPVTAD-KATQTPSLTSQVMNH-
R4G9R5_BCL2L11-01       ----------------------CFLY-----RDVPWRRTGRRWCEAE---
A0A3B3QC78_BCL2L11      -FSTLSASSSGYHSLDISLPN-SPFM-----THNKSTQTPSPSNHLVCI-
F7CXT2_BCL2L11-01       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
F7FTC8_BCL2L11-01       -----------------DRSP-PPVS-----CD-KSTQTPSPHCQAFNH-
A0A2R8M6L7_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
G3SU55_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAINH-
G3W979_BCL2L11-01       RSPLLPRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
U3IW89_BCL2L11-01       RSPLLSRSSSGYFSFEAERSP-APMS-----CD-KATQTPSPPCQAVSH-
A0A3Q2U844_BCL2L11      RSPLLPRSSSGYFSFEAERSP-APMS-----CD-KATQTPSPPCQAVSH-
C1C3S9_BAD-01           -----SVGELQHFRSRSRSAP-SSLM-----VAARYGRELRRMSDEFDQ-
A0A3P8XIA2_BCL2L11      -FRTTSTSSSGYFSFDCDSIPSSPLL-----RNNKSTQTPSPSSQVITH-
A0A452IFQ4_BAD-01       RYGRELRRMSDEFDVALQVLP-RPKS-----AG---TTSQLHRGNSWKE-
K7GA86_BCL2L11-01       -----------------DRSP-VPMS-----CD-KSTQTPSPPCQAFNH-
O43521_BCL2L11-20       ----VSLCHPGWSALVRSWLT-ATSN-----SQVQAVLLPQPPK------
A0A2R8M6L7_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
M3YDI3_BCL2L11-01       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
F7CXT2_BCL2L11-02       RSPLLPRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
G1SSY0_BCL2L11-01       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6TRU4_BCL2L11      RSSVLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5NU92_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I2YQ13_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5X1Y3_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6QIL2_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5HZI5_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I3GVB2_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2R9C366_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I3SN61_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5HZI5_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I2YQ13_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6QIL2_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5Q1Y0_BCL2L11      RSSVLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPTCQAFNH-
A0A2K6GE31_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U7T0R1_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U7T0R1_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
O54918_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
O88498_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5Z7V3_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A096NYC3_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5X1Y3_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6E212_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5NU92_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A096NYC3_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6KJP8_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I3SN61_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2R8M6L7_BCL2L11      RSSVLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5CA89_BCL2L11      RSSVLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5Q1Y0_BCL2L11      RSSVLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPTCQAFNH-
A0A1U7T0R1_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U7T0R1_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A3Q2GRS5_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
J9NWV6_BCL2L11-04       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
U6CTE3_BCL2L11-02       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U8BW10_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U7T0R1_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6GE31_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A287DFJ0_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A452FCR6_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
W5PY58_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
L8IVA4_BCL2L11-02       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A286XJN2_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A286XJN2_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
G1SSY0_BCL2L11-02       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A250YBV9_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
H0XW23_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1S3FFM9_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
U6CTE3_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
G1LDR8_BCL2L11-01       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
J9NWV6_BCL2L11-03       RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I2UX96_BCL2L11      RSSLLSRSSSGYFSFDTDRSP-APMS-----CD-KSTQTPSPPCQAFNH-
O54918_BCL2L11-03       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U8BW10_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
J9NWV6_BCL2L11-05       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A3Q2GRS5_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A452U4S4_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2R9C366_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I3GVB2_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6TRU4_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A0D9RWE0_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
U6CTE3_BCL2L11-03       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6E212_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
H2P5E2_BCL2L11-01       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A250YBV9_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A286XJN2_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2I2UX96_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1S3FFM9_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A452SBG5_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A3Q1MV27_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A1U8BW10_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A287DFJ0_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
L8IVA4_BCL2L11-01       -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A3Q1MV27_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A452FCR6_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5CA89_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K5Z7V3_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A2K6KJP8_BCL2L11      -----------------DRSP-APMS-----CD-KSTQTPSPPCQAFNH-
A0A3P8RLE2_BCL2L11      -------------------NS-TGGE--------PDSPSWSRAQASLGV-
A0A3B1JLM2_BAD-01       ----------------VDSPQ-TDSG--------PSMYRDTSSDELLEV-
Q61337_BAD-05           ----------------GSNIH-QQGR--------AATNSHHGGAGAMET-
A0A3B1JXK6_BCL2L11      ----------------GYFSF-DSEP--------SSPLLMHSASTQTPS-
A0A3B4BVX1_BCL2L11      ----------------GYFSF-ESEP--------SSPLVTHSASTQTPS-
A0A2I3HWI8_BBC3-03      ----------------RASSV-TWVP--------CQIC------------
A0A3Q2GWE8_BBC3-02      ----------------GASFS-PWVP--------QQTRGPQPSLLPAEQ-
A0A2K6STD6_BBC3-02      ----------------RASSL-TWVP--------CQMCGSQPSLSLAEQ-
A0A2R8MW85_BBC3-02      ----------------RASSS-VWVP--------CQMCGPQPSLSLAEQ-
A0A2K5QNS7_BBC3-02      ----------------RASSS-VWVP--------CQMCGPQPSLSLAEQ-
A0A2K6FQZ1_BBC3-04      ----------------GTSFS-WWVL--------GHIPGPQPSLSLAEQ-
A0A2R9BZA9_BBC3-01      ----------------RAASV-TWVP--------CQICGPQPSLSLAEQ-
A0A2I3RGH5_BBC3-03      ----------------RAASA-TWVP--------CQICGPQPSLSLAEQ-
A0A2K5P2T8_BBC3-03      ----------------RAASA-TWVL--------CQICGPQPSLLLAEQ-
A0A2K5V8J3_BBC3-03      ----------------RASSA-TWVP--------CQICGPQPSLLLAEQ-
A0A2K6ASP2_BBC3-03      ----------------RASSA-TWVP--------CQICGPQPSLLLAEQ-
A0A2I3N2Z9_BBC3-03      ----------------RASSA-TWVP--------CQICGPQPSLLLAEQ-
A0A2K6QZT2_BBC3-04      ----------------RASSA-TWVP--------CQICGPQPSLSLAEQ-
F7GL32_BBC3-02          P-----RAYGGPRWARAARSP-AAGN--------QGQSGSLPSLGPRSA-
F7GL32_BBC3-01          P-----RAYGGPRWARAARSP-AAGN--------QGQSGSLPSLGPRSA-
J9NTK9_BBC3-01          APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAEQ-
F1RM01_BBC3-04          APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAEQ-
G3T2N1_BBC3-01          SPVWVSDLSGLQLERGGAEWE-DRAP--------RPLSGPQPSLSPAEQ-
A0A250YBU3_BBC3-01      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAQQ-
M3Y0R3_BBC3-01          PPPVWVSLTSQRTIVGGSVGR-ARGL--------LF-PGPQPSLSPAEP-
A0A1U7R5N5_BBC3-01      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAQQ-
Q99ML1_BBC3-02          APPAVTAALGGPRWPGGHRSR-PRGP--------RP-DGPQPSLSPAQQ-
Q80ZG6_BBC3-01          APPAVTAALGGPRWPGGHRSR-PRGP--------RP-DGPQPSLSPAQQ-
H0XQ00_BBC3-01          APPAVTATLGGPRWPGGPRSR-PRGP--------RL-DGPQPSLLPAEQ-
A0A0D9S2H2_BBC3-01      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
B4DQK3_BBC3-01          APPAVTAALGGSRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
A0A250YBU3_BBC3-02      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAQQ-
A0A3Q1LXZ6_BBC3-01      APPAVTAALGAPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAEQ-
A0A452E3G1_BBC3-01      APPAVTAALGAPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAEQ-
F1RM01_BBC3-03          APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSPAEQ-
A0A2I3RGH5_BBC3-01      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
H2NZD3_BBC3-01          APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
A0A2K6QZT2_BBC3-01      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
A0A2K6FQZ1_BBC3-01      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
A0A337SAW2_BAD-01       ------GGAGAVETRSRHSSY-PAGT--------EE-DEGTEE-------
A0A2R8MW85_BBC3-03      APPAVTAALGGPRWPGGPRSR-PRGP--------RP-DGPQPSLSLAEQ-
C1KGB6_BCL2L11-02       ----------------DRSPA-PMSC--------DK-STQTPS-------
C1KGB6_BCL2L11-03       SSLLSRSSSGYFSFDTDRSPA-PMSC--------DK-STQTPS-------
C1KGB6_BCL2L11-01       SSLLSRSSSGYFSFDTDRSPA-PMSC--------DK-STQTPS-------
J9NWV6_BCL2L11-01       ----------------DRSPA-PMSC--------DK-STQTPS-------
A0A3Q2GRS5_BCL2L11      ----------------DRSPA-PMSC--------DK-STQTPS-------
A0A3Q2GRS5_BCL2L11      SSLLSRSSSGYFSFDTDRSPA-PMSC--------DK-STQTPS-------
J9NTK9_BBC3-03          APRLARPGQGP-----GPPRA-PRRV--------R---GPRPR-------
J9NTK9_BBC3-02          ------PGDGAQL---GACTR-PVDI--------RD-LGGRTL-------
A0A3Q2GWE8_BBC3-01      ------PGDGAQL---GACTR-PGDV--------GD-LGGRTL-------
Q9BXH1_BBC3-03          ------PRDGAQL---GACTR-PVDV--------RD-SGGRPL-------
A0A493T7X1_BMF-01       ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
A0A452H3N6_BMF-01       ----------------GIRHA-EQQD--------KATQTLSPSSSTQDV-
A0A287AIU8_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
G1PAU1_BMF-01           ----------------GLRPI-SQED--------KATQTLSPASPSQGV-
A0A287AIU8_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A1U8CPE0_BMF-02       ----------------GLRPI-SQED--------KATQTLSPASPSQGV-
A0A286XXB0_BMF-03       ----------------GLRPT-SQED--------KATQTLSPSSPSQGV-
A0A287CXH0_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A1S3EQA2_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A2AV74_BMF-02           ----------------GLRPI-SQED--------KATQTLSPASPSQGV-
H9GL49_BMF-01           ----------------GSRQA-RQQD--------KATQTLNPSSSSQDV-
A0A3Q2UCA0_BMF-02       ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
A0A3Q2UCA0_BMF-01       ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
K7FRX2_BMF-01           ----------------GIRHA-EQQD--------KATQTLSPSSSTQDV-
U3JS06_BMF-01           ----------------GIRHP-EQQD--------KATQTLSPSSSSQDV-
A0A493T7X1_BMF-02       ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
A0A3Q2UCA0_BMF-03       ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
A0A3Q2UCA0_BMF-04       ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
G1NHG8_BMF-01           ----------------GVRHP-EQQD--------KATQTLSPSSSSQDV-
A0A337ST43_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K5KGP2_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6FFN3_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K5E1Q4_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K5RN49_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K6TW78_BMF-03       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K6RAW1_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2I2Z168_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2R9BS98_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2J8QDD5_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K5MJW4_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5VLE9_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6B5F6_BMF-03       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5Z4A9_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A096NTE9_BMF-03       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2I3HD83_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A1S3EQA2_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
Q8K589_BMF-01           ----------------GLRPV-SQED--------KATQTLSPASPSQGV-
A0A337ST43_BMF-05       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A337ST43_BMF-04       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A2AV74_BMF-01           ----------------GLRPI-SQED--------KATQTLSPASPSQGV-
A0A286XXB0_BMF-02       ----------------GLRPT-SQED--------KATQTLSPSSPSQGV-
G3WDQ2_BMF-01           ----------------GLRSV-GQED--------KATQTLSPASPSQGV-
G3T7Z4_BMF-01           ----------------GLRHT-SQED--------KATQTLSPASPSQGV-
A0A287CXH0_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A1S3WU31_BMF-01       ----------------GLRPA-SQED--------KATQTLSPASPSQGV-
A0A337ST43_BMF-03       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A337ST43_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A1U8CPE0_BMF-01       ----------------GLRPI-SQED--------KATQTLSPASPSQGV-
G1SR62_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
M3YAD5_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
U6CSY8_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A452SED0_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A384D070_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
W5QFV1_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
L8IXF5_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A452F2E0_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A452F2E0_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
Q05KI3_BMF-02           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
Q05KI3_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K6FFN3_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
H0WYH6_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A096NTE9_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6L919_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5E1Q4_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K6TW78_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K6TW78_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2K5RN49_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2I2Z168_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2R9BS98_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2J8QDD5_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2J8T301_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
F7CM09_BMF-01           ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5MJW4_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5KGP2_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5VLE9_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
F7CM09_BMF-03           ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
F7CM09_BMF-02           ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6B5F6_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6B5F6_BMF-02       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6B5F6_BMF-04       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K5Z4A9_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6L919_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6L919_BMF-03       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A2K6RAW1_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
A0A0D9R4R5_BMF-01       ----------------GLRPT-SQED--------KATQTLGPASPSQGV-
J9PB65_BMF-04           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
J9PB65_BMF-03           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
J9PB65_BMF-02           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
J9PB65_BMF-01           ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A3Q2HR24_BMF-01       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A3Q2HR24_BMF-02       ----------------GLRPT-SQED--------KATQTLSPASPSQGV-
A0A2I2YVQ5_PMAIP1-      ------------------AGT-ARDQ--------AGFGIEMQLRFTRGK-
A0A2I3SX38_PMAIP1-      ------------------AGT-ARDQ--------AGFGIGMQLRFTRGK-
A0A2K5JY17_PMAIP1-      ----------------DPLGP-AKTQ--------AGRGRG------RGK-
A0A2R9AKC9_PMAIP1-      ------------------AGT-ARDQ--------AGFGIGMQLRFTRGK-
A0A2K6KJF1_PMAIP1-      ----------------GTAGT-ARDQ--------AGLGIGMQLHFTRGK-
A0A2K6NC45_PMAIP1-      ----------------GTAGT-ARDQ--------AGLGIGMQLHFTRGK-
A0A096MPU8_PMAIP1-      ----------------GTAGT-ARDQ--------AGFGIGMQLHFTRSK-
A0A2K5ZWH1_PMAIP1-      ----------------GTAGT-ARDQ--------AGFGIGMQLHFTRGK-
A0A2K5VPX2_PMAIP1-      ----------------GTAGT-ARDQ--------AGFGIGMQLHYTRGK-
A0A2K6BV43_PMAIP1-      ----------------GTAGT-ARDQ--------AGFGIGMQLHYTRGK-
W5QCU2_BIK-01           --------------------------------------MYQARPLSRNL-
A0A3Q2LHE3_BIK-01       --------------------------------------MSQVGPVSRDL-
A0A452QUG1_BIK-01       --------------------------------------FHTTRRCAQRV-
A0A452V3L2_BIK-01       ----------------MAWSS-EEAR--------SREEMSHTGPLSRNL-
A0A3B4CPH6_BAD-01       ----------------ESRQR-NHSM--------NEDALQESGAVR----
M3XHJ5_BCL2L11-01       ----------------ESLQF-DKDQ--------GTSDVISECGHL----
G1TZR9_BIK-01           ----------------EALLD-EQVP--------EPLLTAEVPGLT----
A0A2K5QXZ1_BIK-01       ----------------ETLLC-EQFM--------DPLTMEVVGGGS----
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           ----------------KTVPH-DQVP--------QPPVASETPSMK----
O70337_BIK-01           ----------------KTVPH-DQVP--------QPPVASETPSMK----
Q925D2_BIK-01           ----------------KTLLH-DQVP--------QPAVVSGAPSMK----
A0A1S3FUQ7_BIK-01       ----------------KTLLY-QQMP--------GPRPAAGLFPIT----
H0XAE7_BIK-01           ----------------ETFPF-EQLL--------EPLTME-VLGMT----
A0A2K6FM79_BIK-01       ----------------ETFPF-EHLL--------DPLILE-VLSIM----
H0W025_BIK-01           ----------------ETPLF-EPPP--------GPLLAEGALGVT----
A0A2K5CLG5_BIK-01       ----------------ETLLC-EQFV--------HPLTME-VVGGS----
A0A2K6TBD7_BIK-01       ----------------ETLLC-EQFV--------DPLTME-VVGGS----
H2P4N6_BIK-01           ----------------ETLLY-EQLL--------EPPTME-VLGVT----
G1S1X2_BIK-01           ----------------ESLLY-EQLL--------EPPTME-VLGVT----
G3QCT2_BIK-01           ----------------ETLLY-EQLL--------EPPTME-VLGVT----
A0A2R8ZXD2_BIK-01       ----------------ETLLY-EQLL--------EPPTME-VLGVT----
H2QLU7_BIK-01           ----------------ETLLY-EQLL--------EPPTME-VLGVT----
A0A2K6MCW0_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A2K6QK74_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A0D9QZY8_BIK-01       ----------------ESLLY-EQLL--------EPLTME-VLGVT----
A0A2K5VW94_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A2K6DBJ4_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A2K5J4Q7_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A096NKG5_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A2K5LDM6_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A2K5XSA1_BIK-01       ----------------ETLLY-EQLL--------EPLTME-VLGVT----
A0A3P8XIA2_BCL2L11      ----------------SSPLL--------------RNNKSTQTPSPSSQ-
G1LNV7_BBC3-01          ----------------GGAGR-HLPN--------PSPPGPQPSLSPAEQ-
A0A2K5F6X4_BBC3-02      --------------------------------------GPQPSLSLAEQ-
F1RM01_BBC3-02          ----------------GGPRS-RPRG--------PRPDGPQPSLSPAEQ-
A0A3B4V919_BCL2L11      ----------------SSPLS--PRP--------ATVERTTQTPSPTSQ-
A0A3B4XZH1_BCL2L11      ----------------TSPLS--PRP--------ATAERTTQTPSPTSQ-
A0A3Q1ICY2_BCL2L11      ----------------SSPLS--PRP--------VTFDRATQTPSPTGQ-
A0A3Q3K6I5_BCL2L11      ----------------SSPLS--PRP--------VTADKVTQTPSPSSQ-
A0A3Q3ESW6_BCL2L11      ----------------SSPLS--PRP--------LTADKATQTPSPSGQ-
A0A3Q2SZH6_BCL2L11      ----------------STPLS--PHP--------LTADKATQTASPTGQ-
A0A3B3VNE0_BCL2L11      ----------------SSPLS--PHP--------VTADKATQTPSPTGQ-
A0A3B3YII5_BCL2L11      ----------------SSPLS--PHP--------VTADKATQTPSPTGQ-
A0A3B3YII5_BCL2L11      ----------------SSPLS--PHP--------VTADKATQTPSPTGQ-
A0A3P9N073_BCL2L11      ----------------SSPLS--PHP--------VTADKTTQTPSPTGQ-
A0A3Q3B113_BCL2L11      ----------------SSPLS--PKP--------VTAEKATQTPSPTGQ-
A0A3B5M375_BCL2L11      ----------------SSPLS--PHP--------VTADKATQTPSLTGQ-
A0A3B5QAM1_BCL2L11      ----------------SSPLS--PHP--------VTADKATQTPSLTGQ-
A0A3B5QAM1_BCL2L11      ----------------SSPLS--PHP--------VTADKATQTPSLTGQ-
A0A3B4BVX1_BCL2L11      ----------------NSLLG-YQSR--------SPLFRTLSR-SSSGY-
Q9GL49_PMAIP1-01        ----------------RGNQ---------------PTSEAFGR-SGCCF-
A0A3B1IH05_BAD-01       ----------------RVEPR-QRNF--------SMNEEALQE-SGAGR-
H3ANP3_BAD-01           ----------------NPGPH-QSHP---------PSHT-----------
H3ANP3_BAD-02           ----------------NPGPH-QSHP---------PSHT-----------
H3ANP3_BAD-03           ----------------NPGPH-QSHP---------PSHTGVYG--WVKL-
A0A3B3QX41_BAD-01       ----------------GGRVR-MRSE--------SQVSSIRSE-------
A0A2I3TBK7_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--EGT--
A0A2I2Z8C7_BAD-03       ----------------WDASH-QQEQ---------PTSSSHHG--EGT--
A8MXU7_BAD-03           ----------------WDASH-QQEQ---------PTSSSHHG--EGT--
A0A2K5M0A7_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GT---
A0A2K5XJR2_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GT---
A0A2K5VCA9_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GT---
A0A2K6E7I4_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GT---
A0A2K5HKU7_BAD-02       ----------------WDASH-QQEQ---------ATSSSHHG--GRAW-
A0A2K6N196_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GRAW-
A0A2K6PUL3_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GRAW-
A0A2K5M0A7_BAD-03       ----------------WDASH-QQEQ---------PTSSSHHG--GGAW-
A0A2K5VCA9_BAD-03       ----------------WDASH-QQEQ---------PTSSSHHG--GRAW-
A0A096MLD5_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GRAW-
A0A2K6E7I4_BAD-03       ----------------WDASH-QQEQ---------PTSSSHHG--GRAW-
A8MXU7_BAD-04           ----------------WDASH-QQEQ---------PTSSSHHG--GRTS-
A0A2I3TBK7_BAD-03       ----------------WDASH-QQEQ---------PTSSSHHG--GRTS-
A0A2R8Z688_BAD-03       ----------------WDASH-QQEQ---------PTSSSHHG--GRTS-
A0A2K5E6A6_BAD-03       ----------------GDASH-QQGQ---------PTSSSHHG--GE---
A0A2K5PDB1_BAD-03       ----------------GDASH-QQGQ---------PTSSSHHG-------
A0A2K6TG62_BAD-03       ----------------GDASH-QQGQ---------PTSSSHHG-------
G3VRY3_BAD-01           ----------------RPRLI-SYPP--------L---------------
G3VRY3_BAD-02           ----------------KSQTH-VSKE--------LKASASQGR-LGKGS-
G1P8C5_BAD-01           ----------------GEAGH-QQGQ---------PASSSHHD--GAGS-
A0A452ER54_BAD-02       ----------------GEAGH-QQGQ---------PAGSSHHG--GTGA-
W5P8G9_BAD-01           ----------------GEAGH-QQGQ---------PAGSSHHG--GTGA-
G3TP47_BAD-01           ----------------RDSSH-QQGQ---------PTSSGHHG--GAAA-
A0A1U7Q4V0_BAD-01       ----------------GNIRH-QQEQ---------AANSSHHG--GTGA-
Q61337_BAD-01           ----------------GSNIH-QQGR---------AATNSHHG--GAGA-
A0A287CT05_BAD-02       ----------------RDTGH-QQWQ---------ATSSSNHG--GAGA-
A0A287CT05_BAD-01       ----------------RDTGH-QQWQ---------ATSSSNHG--GAGA-
O35147_BAD-01           ----------------GSIVQ-QQPG--------QAANNSHHG--GAGT-
A0A091DDU4_BAD-01       ----------------GDTSH-QQRQ---------LFSSRHHG--GAGA-
A0A287AEF3_BAD-01       ----------------GEAGH-QQGQ---------PASSSHHG--GAGA-
G1MI17_BAD-01           ----------------GEAAH-PQGQ---------PASSNHHG--GAGA-
M3YNE7_BAD-01           ----------------GEAGH-QQGQ---------PASSSHHG--GAGA-
A0A452RJM6_BAD-01       ----------------GEAAQ-PQGQ---------PASSNHHG--GAGA-
A0A384DJL2_BAD-01       ----------------GEAAH-PQGQ---------PASSNHHG--GAGA-
A0A452ER54_BAD-01       ----------------GEAGH-QQGQ---------PAGSSHHG--GTGA-
F1MUT9_BAD-01           ----------------GEAGH-QQGQ---------PAGSSHHG--GTGA-
Q3SYZ0_BAD-01           ----------------GEAGH-QQGQ---------PAGSSHHG--GTGA-
F7DN67_BAD-01           ----------------GEAGH-QQGQ---------PASSSHHG--GAGA-
F1PK10_BAD-01           ----------------GEAGH-QQGQ---------PASRKHHG--GAGA-
Q45KI9_BAD-01           ----------------GEAGH-QQGQ---------PASRKHHG--GAGA-
H0WVR2_BAD-01           ----------------GDASH-LQGQ---------PASNTHHG-AGPGA-
A0A2K6GWV0_BAD-01       ----------------GDASH-QQGQ---------PSSSSHHG--GAGS-
H0V608_BAD-01           ----------------GDTSH-QQRQ--------LRSSRSHHG--GTVA-
A0A1S3FL84_BAD-01       ----------------GDHSP-QQGL---------PTSRSHHG--GAGA-
A0A2K5PDB1_BAD-01       ----------------GDASH-QQGQ---------PTSSSHHG--GAGA-
A0A2K5E6A6_BAD-01       ----------------GDASH-QQGQ---------PTSSSHHG--GAGA-
A0A2K6TG62_BAD-01       ----------------GDASH-QQGQ---------PTSSSHHG--GAGA-
A0A0D9R491_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2K5HKU7_BAD-01       ----------------WDASH-QQEQ---------ATSSSHHG--GAGA-
A0A2K5XJR2_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2K6N196_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2K6PUL3_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
B4DZQ9_BAD-01           ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A096MLD5_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2I2Z8C7_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2I2Z8C7_BAD-02       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2R8Z688_BAD-01       ----------------WDASH-QQEQ---------PTSSSHHG--GAGA-
A0A2J8TYJ3_BAD-01       ----------------RDASH-QQEQ---------PTSSSHHG--GAGA-
A0A3B4DUY7_BAD-01       ----------------LSEVG-CRVR--------LYSESQVYT-VSRWQ-
E7FBJ6_BAD-01           -----------------ISPQ-GRVR--------LYSESQVYT-VSRWQ-
B5XEF1_BAD-01           -------------------PG-ERVR--------LYSESQVRSQVGKRE-
A0A3Q3FKT9_BAD-01       -----------------LAGT-GRIR--------LNSESHAYT-VSRDE-
A0A3P9A5G8_BAD-01       ----------------RTLPG-VRVR--------LYSESQVCS-QVGRQ-
A0A3P9A5G8_BAD-02       ----------------RTLPG-VRVR--------LYSESQVCS-QVGRQ-
B5X1T1_BAD-01           ----------------RPRPG-GRVR--------LYSESQVCS-QVGRR-
A0A3Q2QC80_BAD-01       ------------------SGH-GRIR--------LNSESHAST-ISREE-
A0A3Q3FKT9_BAD-03       -----------------LAGT-GRIR--------LNSESHAYT-VSRDE-
H3D8J8_BAD-01           -----------------FSTS-GRIR--------VNSESQASA-VSRDE-
A0A3B5L9R9_BAD-01       --------------------R-GDLQ--------LMQEKEKPL-SQRHT-
A0A3P9B2E4_BAD-01       -----------------TTAA-GRLR--------VNSESHTSS-IARDE-
I3K7B6_BAD-01           -----------------TTGA-GRLR--------LNSESHTSS-VARDE-
A0A3Q3C680_BAD-01       -----------------TTAA-GRLR--------VNSESHTSS-IARDE-
A0A3P8QRJ7_BAD-01       -----------------TTAA-GRLR--------VNSESHTSS-IARDE-
A0A3Q4GGN3_BAD-01       -----------------TTAA-GRLR--------VNSESHTSS-IARDE-
A0A3B4GXJ6_BAD-01       -----------------TTAA-GRLR--------VNSESHTSS-IARDE-
A0A3Q0QNQ2_BAD-01       -----------------HPTA-RRIR--------MNSESHTSS-VSRDE-
A0A3P8WI83_BAD-02       -----------------VAGS-RRIR--------LNSESHAST-ISREE-
A0A3P8WI83_BAD-01       -----------------VAGS-RRIR--------LNSESHAST-ISREE-
A0A3Q2D5S0_BAD-01       -----------------NSGK-THRR--------IRLSSESHA-FTREE-
A0A3P9HNZ2_BAD-01       -----------------LTSN-GRTR--------LNSESTAST-YSRDE-
A0A3B3BQF7_BAD-01       -----------------LTSN-GRTR--------LNSESTVST-YSRDE-
A0A3Q1K1C7_BAD-02       -------------------AS-GRIR--------LNSESHAST-VYRDE-
A0A3Q1K1C7_BAD-01       -------------------AS-GRIR--------LNSESHAST-VYRDE-
A0A3Q1GWH9_BAD-01       -----------------TPAS-GRIR--------LNSESHAST-LSRDE-
A0A3Q1CPU7_BAD-01       -----------------TPAS-GRLR--------LNSESHAST-LSRDE-
A0A3P8TWH6_BAD-01       -----------------TPAS-GRLR--------LNSESHAST-LSRDE-
A0A2U9BAC9_BAD-01       -----------------MAAT-GRIR--------LNSESNAST-LSRDE-
A0A3B4VFC5_BAD-01       -----------------GAAT-GRTR--------LNSESHTST-VSRDE-
A0A3B4W9T1_BAD-01       -----------------GAAT-GRTR--------LNSESHTST-VSRDE-
Q4V925_BAD-03           ----------------KGEQL-GRQR------------------------
Q4V925_BAD-02           ----------------KGEQL-GRQR------------------------
A7MCM4_BAD-01           ----------------KGEQL-GRQR------------------------
Q4V925_BAD-01           ----------------KGEQL-GRQR------------------------
Q4V925_BAD-04           ----------------KGEQL-GRQR------------------------
A0A3P8Y761_BAD-01       --------------------E-GRIR--------LNSESQVFA-TSGGE-
A0A3B5Q2N7_BAD-01       ------------------STT-GRVR--------LNSESIAST-ISR-E-
A0A087X8P8_BAD-01       ------------------STT-GRVR--------LNSESIAST-ISR-E-
A0A3B3UA11_BAD-01       ------------------STT-GRVR--------LNSESIAST-ISR-E-
A0A3B3YFR1_BAD-01       ------------------STT-GRVR--------LNSESIAST-ISR-E-
A0A3P9Q7C3_BAD-01       ------------------STT-GRVR--------LNSESIAST-ISR-E-
A0A3B3HDU2_BAD-01       -----------------LTSN-GRTR--------LNSESTAST-YSRDE-
A0A3P9KSL7_BAD-01       -----------------LTSN-GRTR--------LNSESTAST-YSRDE-
A0A3P9KSL7_BAD-02       -----------------LTSN-GRTR--------LNSESTAST-YSRDE-
A0A3B5BAL2_BAD-01       -----------------TPAA-GRIR--------LNSESHATT-VSR-D-
A0A3Q3AEL8_BAD-01       -----------------HSKN-GRLR--------VNSESLSST-SSRGE-
A0A3Q3AEL8_BAD-02       -----------------HSKN-GRLR--------VNSESLSST-SSRGE-
G3Q8B3_BAD-01           ----------------LSGRK-SQRI--------VEKE------------
A0A3Q2Y0E4_BAD-01       ----------------MEAMS-GRIR--------LNSESHALA-VSR-E-
A0A3Q3R5S3_BAD-01       ----------------MAATS--RNR--------VSSESNAST-VQ----
A0A3Q3RXS8_BAD-01       -----------------TTAS-NRIR--------LSSES-----------
A0A3Q3RXS8_BAD-02       -----------------TTAS-NRIR--------LSSES-----------
A0A3Q0QNQ2_BAD-02       -----------------SR----------------DEEL-----------
A0A3Q3WTY4_BAD-01       -----------------MA----------------GRTL-----------
A0A493SWX7_PMAIP1-      -----------------MPCRTLR-K------------------------
A0A2I3HX97_PMAIP1-      ------------------KPGRAR-R------------------------
A0A452TE71_PMAIP1-      -----------------WGSLLSG-E------------------------
A0A452J430_PMAIP1-      -----------------MPGKTLR-K------------------------
A0A1D5PAR2_PMAIP1-      ----------------MMPGRTIR--------------------------
A0A2K6EM90_PMAIP1-      -----------------MPVKKAR-K------------------------
G1P8F9_PMAIP1-01        -----------------MPGKKAR-K------------------------
Q9JM54_PMAIP1-03        -----------------MPGKSQKSR------------------------
A0A3Q2I0H2_PMAIP1-      -----------------MPTRKAR-K------------------------
G3T0P7_PMAIP1-01        -----------------MPGKKAR-K------------------------
Q1PCT2_PMAIP1-01        -----------------MPGRKAR-K------------------------
G1LIZ7_PMAIP1-01        -----------------MPGKKAR-K------------------------
A0A452STA4_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K5NJZ2_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A0D9S003_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K5VPX2_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K6BV43_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K5ZWH1_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A096MPU8_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K5JY17_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K6KJF1_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K6NC45_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2K6S6C4_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2I2YVQ5_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2R9AKC9_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A2I3SX38_PMAIP1-      -----------------MPGKKAR-K------------------------
H2NWG2_PMAIP1-01        -----------------MPGKKAR-K------------------------
A0A2K5CFK7_PMAIP1-      -----------------MPGKKAR-K------------------------
F7GW45_PMAIP1-01        -----------------MPGKKAR-K------------------------
A0A2K5QQC6_PMAIP1-      -----------------MPGKKAR-K------------------------
A0A337SUX1_PMAIP1-      -----------------MPGKRTR-K------------------------
A0A3Q1NFP6_PMAIP1-      -----------------MPGRRAR-K------------------------
A0A452EST2_PMAIP1-      -----------------MPGRRAR-R------------------------
W5P738_PMAIP1-01        -----------------MPGRRAR-R------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       FLLCAASRWRS---------------------------------------
G1PDJ5_BCL2L11-01       ------SMQQS---------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           -----L--------------------------------------------
A3KND0_BMF-01           SQDIML--------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           --------------------------------------------------
A0A1U7R468_HRK-01       --------------------------------------------------
P62816_HRK-03           --------------------------------------------------
P62817_HRK-01           --------------------------------------------------
A0A2K5KZ69_HRK-01       --------------------------------------------------
H2NIS8_HRK-01           --------------------------------------------------
H2Q6Y8_HRK-01           --------------------------------------------------
G3UH24_HRK-01           --------------------------------------------------
A0A2K5BYA0_HRK-01       --------------------------------------------------
U3E722_HRK-01           --------------------------------------------------
A0A452DXE5_HRK-01       --------------------------------------------------
A0A0D9SC73_HRK-01       --------------------------------------------------
A0A3Q2IBL3_HRK-01       --------------------------------------------------
A0A337SQ56_HRK-01       --------------------------------------------------
G3QTJ6_HRK-01           --------------------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1T7W1_HRK-01           --------------------------------------------------
H0Y001_HRK-01           --------------------------------------------------
A0A096N944_HRK-01       --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K5PIE7_HRK-01       --------------------------------------------------
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      EVLAEMAGKKAR--------------------------------------
A0A1U7QLK6_PMAIP1-      AVLAEMPGKKAR--------------------------------------
Q9JM54_PMAIP1-01        VVLAQMPGKSQK--------------------------------------
Q5U777_PMAIP1-01        AVLAQMPGKKSR--------------------------------------
A0A3Q2LHE3_BIK-02       ------MTEL----------------------------------------
F7FUT7_BIK-02           SDPEEDLDPV----------------------------------------
F7FUT7_BIK-01           SDPEEDLDPV----------------------------------------
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
F1SMU1_PMAIP1-01        -------------------------------------------YLQSQGA
Q9BXH1_BBC3-04          LGACTRPVDVRD--------------------------------------
A0A3B4UNJ0_BMF-01       QALTAVTAAPLI-------------------------------LFVWWVP
B2KKY9_BCL2L11-01       VLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSD
B8JK68_BCL2L11-01       VLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSD
A0A3B4B6Y3_BMF-01       MLPCGVAEEPRP-------------------------------LFY----
A0A3P9ICE1_BMF-01       MLLCGLAEEPRP-------------------------------LFYGNAG
Q0GKC7_BMF-01           MLLCRHLQQHGH-------------------------------FLYGNAE
A0A3B3RH63_BMF-01       MLPCGVGQEPRR-------------------------------LFYGSAG
W5N4P7_BMF-01           MLPCGVGAEPRR-------------------------------LFYGNAA
A0A3B1K1X5_BMF-01       MLPCGISEEPRR-------------------------------LFYGSAG
A0A3B4CNJ8_BMF-01       MLPCGVSEEPRR-------------------------------LFYGSAG
A0A2U9CJH3_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q2YCX7_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q2YCX7_BMF-02       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3P8ZIE7_BMF-01       MLPCRLDQDPRP-------------------------------LFYGNAG
A0A3Q2PJX9_BMF-02       MLPCGVAEEPRQ-------------------------------LFYGNAG
A0A3Q3QZ16_BMF-01       MLPCGVAEDPRP-------------------------------LFYGNAG
A0A3Q3QZ16_BMF-02       MLPCGVAEDPRP-------------------------------LFYGNAG
A0A3Q2PJX9_BMF-01       MLPCGVAEEPRQ-------------------------------LFYGNAG
A0A3Q2PJX9_BMF-03       MLPCGVAEEPRQ-------------------------------LFYGNAG
A0A3B5QK08_BMF-01       MLPCGVVEEPRR-------------------------------LFYGNAG
A0A3B5QK08_BMF-02       MLPCGVVEEPRR-------------------------------LFYGNAG
A0A096LRV0_BMF-01       MLPCGVAEEPRR-------------------------------LFYGNAG
A0A3B3WU80_BMF-01       MLPCGVAEEPRR-------------------------------LFYGNAG
A0A3P9Q8E2_BMF-01       MLPCGVAEEPRR-------------------------------LFYGNAG
A0A3Q2CXC4_BMF-02       MLPCGVVEEPRP-------------------------------LFYRNAG
A0A3Q2CXC4_BMF-01       MLPCGVVEEPRP-------------------------------LFYRNAG
A0A3Q3GUU5_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3B5B8F6_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q3VLX6_BMF-01       MLPCGVAEEPRH-------------------------------LFY----
A0A3P8UA78_BMF-02       MLPCGVGEEPRP-------------------------------LFYGNAG
A0A3P8UA78_BMF-01       MLPCGVGEEPRP-------------------------------LFYGNAG
A0A3P8UA78_BMF-03       MLPCGVGEEPRP-------------------------------LFYGNAG
A0A3B3CGR9_BMF-01       MLLCGLAEEPRP-------------------------------LFYGNAG
A0A3P9K487_BMF-02       MLLCGLSEEPRP-------------------------------LFYGNAG
A0A3P9K487_BMF-01       MLLCGLSEEPRP-------------------------------LFYGNAG
A0A3B3HAU1_BMF-03       MLLCGLAEEPRP-------------------------------LFYGNAG
A0A3B3HAU1_BMF-02       MLLCGLAEEPRP-------------------------------LFYGNAG
A0A3B3HAU1_BMF-01       MLLCGLAEEPRP-------------------------------LFYGNAG
A0A3B3HAU1_BMF-04       MLLCGLAEEPRP-------------------------------LFYGNAG
A0A3P9ICE1_BMF-04       MLLCGLAEEPRP-------------------------------LFYGNAG
A0A3Q2ZA20_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3P8NFE2_BMF-02       MLPCGVAEEPRP-------------------------------LFYGNAG
I3K2D6_BMF-01           MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3P8NFE2_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q3C5V2_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3P9DPJ5_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3P9DPJ5_BMF-02       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3B4ETH0_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q4G1I4_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q1FVH7_BMF-02       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q1FVH7_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q3RVI2_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q1D1K3_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3P8RKY9_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q3RVI2_BMF-02       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3Q1IPR4_BMF-01       MLPCGVAEEPRP-------------------------------LFYGNAG
A0A3B4U5H8_BMF-01       MLPCGVAKEPRP-------------------------------LFYGNAG
A0A3B4WM88_BMF-01       MLPCGVAKEPRP-------------------------------LFYGNAG
A0A3Q3SYA1_BCL2L11      ALQRL---------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      YLSSV---------------------------------------------
F7CXT2_BCL2L11-01       YLSAM---------------------------------------------
F7FTC8_BCL2L11-01       YLSAM---------------------------------------------
A0A2R8M6L7_BCL2L11      YLSAM---------------------------------------------
G3SU55_BCL2L11-01       YLSAM---------------------------------------------
G3W979_BCL2L11-01       YLSAM---------------------------------------------
U3IW89_BCL2L11-01       YLSAM---------------------------------------------
A0A3Q2U844_BCL2L11      YLSAM---------------------------------------------
C1C3S9_BAD-01           IFTSIPRP------------------------------------------
A0A3P8XIA2_BCL2L11      AMR-----------------------------------------------
A0A452IFQ4_BAD-01       TLQAW---------------------------------------------
K7GA86_BCL2L11-01       YLSAMGKQ------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      YLSAM---------------------------------------------
M3YDI3_BCL2L11-01       YLSAM---------------------------------------------
F7CXT2_BCL2L11-02       YLSAMGKQ------------------------------------------
G1SSY0_BCL2L11-01       YLSAM---------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       YLSAM---------------------------------------------
A0A2K6TRU4_BCL2L11      YLSAM---------------------------------------------
A0A2K5NU92_BCL2L11      YLSAM---------------------------------------------
A0A2I2YQ13_BCL2L11      YLSAM---------------------------------------------
A0A2K5X1Y3_BCL2L11      YLSAM---------------------------------------------
A0A2K6QIL2_BCL2L11      YLSAM---------------------------------------------
A0A2K5HZI5_BCL2L11      YLSAM---------------------------------------------
A0A2I3GVB2_BCL2L11      YLSAM---------------------------------------------
A0A2R9C366_BCL2L11      YLSAM---------------------------------------------
A0A2I3SN61_BCL2L11      YLSAM---------------------------------------------
A0A2K5HZI5_BCL2L11      YLSAM---------------------------------------------
A0A2I2YQ13_BCL2L11      YLSAM---------------------------------------------
A0A2K6QIL2_BCL2L11      YLSAM---------------------------------------------
A0A2K5Q1Y0_BCL2L11      YLSAM---------------------------------------------
A0A2K6GE31_BCL2L11      YLSAM---------------------------------------------
A0A1U7T0R1_BCL2L11      YLSAM---------------------------------------------
A0A1U7T0R1_BCL2L11      YLSAM---------------------------------------------
O54918_BCL2L11-01       YLSAM---------------------------------------------
O88498_BCL2L11-01       YLSAM---------------------------------------------
A0A2K5Z7V3_BCL2L11      YLSAM---------------------------------------------
A0A096NYC3_BCL2L11      YLSAM---------------------------------------------
A0A2K5X1Y3_BCL2L11      YLSAM---------------------------------------------
A0A2K6E212_BCL2L11      YLSAM---------------------------------------------
A0A2K5NU92_BCL2L11      YLSAM---------------------------------------------
A0A096NYC3_BCL2L11      YLSAM---------------------------------------------
A0A2K6KJP8_BCL2L11      YLSAM---------------------------------------------
A0A2I3SN61_BCL2L11      YLSAM---------------------------------------------
A0A2R8M6L7_BCL2L11      YLSAM---------------------------------------------
A0A2K5CA89_BCL2L11      YLSAM---------------------------------------------
A0A2K5Q1Y0_BCL2L11      YLSAM---------------------------------------------
A0A1U7T0R1_BCL2L11      YLSAM---------------------------------------------
A0A1U7T0R1_BCL2L11      YLSAM---------------------------------------------
A0A3Q2GRS5_BCL2L11      YLSAM---------------------------------------------
J9NWV6_BCL2L11-04       YLSAM---------------------------------------------
U6CTE3_BCL2L11-02       YLSAM---------------------------------------------
A0A1U8BW10_BCL2L11      YLSAM---------------------------------------------
A0A1U7T0R1_BCL2L11      YLSAM---------------------------------------------
A0A2K6GE31_BCL2L11      YLSAM---------------------------------------------
A0A287DFJ0_BCL2L11      YLSAM---------------------------------------------
A0A452FCR6_BCL2L11      YLSAM---------------------------------------------
W5PY58_BCL2L11-01       YLSAM---------------------------------------------
L8IVA4_BCL2L11-02       YLSAM---------------------------------------------
A0A286XJN2_BCL2L11      YLSAM---------------------------------------------
A0A286XJN2_BCL2L11      YLSAM---------------------------------------------
G1SSY0_BCL2L11-02       YLSAM---------------------------------------------
A0A250YBV9_BCL2L11      YLSAM---------------------------------------------
H0XW23_BCL2L11-01       YLSAM---------------------------------------------
A0A1S3FFM9_BCL2L11      YLSAM---------------------------------------------
U6CTE3_BCL2L11-01       YLSAM---------------------------------------------
G1LDR8_BCL2L11-01       YLSAM---------------------------------------------
J9NWV6_BCL2L11-03       YLSAM---------------------------------------------
A0A2I2UX96_BCL2L11      YLSAM---------------------------------------------
O54918_BCL2L11-03       YLSAM---------------------------------------------
A0A1U8BW10_BCL2L11      YLSAM---------------------------------------------
J9NWV6_BCL2L11-05       YLSAM---------------------------------------------
A0A3Q2GRS5_BCL2L11      YLSAM---------------------------------------------
A0A452U4S4_BCL2L11      YLSAM---------------------------------------------
A0A2R9C366_BCL2L11      YLSAM---------------------------------------------
A0A2I3GVB2_BCL2L11      YLSAM---------------------------------------------
A0A2K6TRU4_BCL2L11      YLSAM---------------------------------------------
A0A0D9RWE0_BCL2L11      YLSAM---------------------------------------------
U6CTE3_BCL2L11-03       YLSAM---------------------------------------------
A0A2K6E212_BCL2L11      YLSAM---------------------------------------------
H2P5E2_BCL2L11-01       YLSAM---------------------------------------------
A0A250YBV9_BCL2L11      YLSAM---------------------------------------------
A0A286XJN2_BCL2L11      YLSAM---------------------------------------------
A0A2I2UX96_BCL2L11      YLSAM---------------------------------------------
A0A1S3FFM9_BCL2L11      YLSAM---------------------------------------------
A0A452SBG5_BCL2L11      YLSAM---------------------------------------------
A0A3Q1MV27_BCL2L11      YLSAM---------------------------------------------
A0A1U8BW10_BCL2L11      YLSAM---------------------------------------------
A0A287DFJ0_BCL2L11      YLSAM---------------------------------------------
L8IVA4_BCL2L11-01       YLSAM---------------------------------------------
A0A3Q1MV27_BCL2L11      YLSAM---------------------------------------------
A0A452FCR6_BCL2L11      YLSAM---------------------------------------------
A0A2K5CA89_BCL2L11      YLSAM---------------------------------------------
A0A2K5Z7V3_BCL2L11      YLSAM---------------------------------------------
A0A2K6KJP8_BCL2L11      YLSAM---------------------------------------------
A0A3P8RLE2_BCL2L11      FQTRSIFHLPRR-------------------------------SSSGYFS
A0A3B1JLM2_BAD-01       GGRVRLYSESQV-------------------------------YNINRWE
Q61337_BAD-05           RSRHSSYPA-----------------------------------------
A0A3B1JXK6_BCL2L11      PSSQVIIHALQR-------------------------------ISEA---
A0A3B4BVX1_BCL2L11      PSSQVITHALQR-------------------------------IAEA---
A0A2I3HWI8_BBC3-03      --------------------------------------------A-----
A0A3Q2GWE8_BBC3-02      HLESPVPSAPGA-------------------------------LE-----
A0A2K6STD6_BBC3-02      HLESPVPSAPGA-------------------------------LA-----
A0A2R8MW85_BBC3-02      HLESPVPSAPGA-------------------------------LA-----
A0A2K5QNS7_BBC3-02      HLESPVPSAPGA-------------------------------LA-----
A0A2K6FQZ1_BBC3-04      HLESPVPSAPGA-------------------------------LA-----
A0A2R9BZA9_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
A0A2I3RGH5_BBC3-03      HLESPVPSAPGA-------------------------------LA-----
A0A2K5P2T8_BBC3-03      HLESPVPSAPGA-------------------------------LA-----
A0A2K5V8J3_BBC3-03      HLESPVPSAPGA-------------------------------LA-----
A0A2K6ASP2_BBC3-03      HLESPVPSAPGA-------------------------------LA-----
A0A2I3N2Z9_BBC3-03      HLESPVPSAPGA-------------------------------LA-----
A0A2K6QZT2_BBC3-04      HLESPVPSAPGA-------------------------------LA-----
F7GL32_BBC3-02          QEEGGQEGEPQG-------------------------------ASPM---
F7GL32_BBC3-01          QEEGGQEGEPQG-------------------------------ASPM---
J9NTK9_BBC3-01          HLESPVPSAPGA-------------------------------LA-----
F1RM01_BBC3-04          HLESPVPSAPGA-------------------------------LA-----
G3T2N1_BBC3-01          HLESPV--------------------------------------------
A0A250YBU3_BBC3-01      HLESPVPSVPEA-------------------------------LA-----
M3Y0R3_BBC3-01          HLESPVPSAPGA-------------------------------LA-----
A0A1U7R5N5_BBC3-01      HLESPVPSAPEA-------------------------------LA-----
Q99ML1_BBC3-02          HLESPVPSAPEA-------------------------------LA-----
Q80ZG6_BBC3-01          HLESPVPSAPEA-------------------------------LA-----
H0XQ00_BBC3-01          HLESPVPSTPGA-------------------------------LA-----
A0A0D9S2H2_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
B4DQK3_BBC3-01          HLESPVPSAPGA-------------------------------LA-----
A0A250YBU3_BBC3-02      HLESPVPSVPEA-------------------------------LA-----
A0A3Q1LXZ6_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
A0A452E3G1_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
F1RM01_BBC3-03          HLESPVPSAPGA-------------------------------LA-----
A0A2I3RGH5_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
H2NZD3_BBC3-01          HLESPVPSAPGA-------------------------------LA-----
A0A2K6QZT2_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
A0A2K6FQZ1_BBC3-01      HLESPVPSAPGA-------------------------------LA-----
A0A337SAW2_BAD-01       ---EEPSPFRG---------------------------------------
A0A2R8MW85_BBC3-03      HLESPVPSAPGA-------------------------------LA-----
C1KGB6_BCL2L11-02       ---PPCQAFNHY-------------------------------LS-----
C1KGB6_BCL2L11-03       ---PPCQAFNHY-------------------------------LS-----
C1KGB6_BCL2L11-01       ---PPCQAFNHY-------------------------------LS-----
J9NWV6_BCL2L11-01       ---PPCQAFNHY-------------------------------LS-----
A0A3Q2GRS5_BCL2L11      ---PPCQAFNHY-------------------------------LS-----
A0A3Q2GRS5_BCL2L11      ---PPCQAFNHY-------------------------------LS-----
J9NTK9_BBC3-03          ---GLRAALGGA-------------------------------AH-----
J9NTK9_BBC3-02          ---PPPDALASA-------------------------------GD-----
A0A3Q2GWE8_BBC3-01      ---PPPDALASA-------------------------------GG-----
Q9BXH1_BBC3-03          ---PPPDTLASA-------------------------------GD-----
A0A493T7X1_BMF-01       MLPCGVTEEPRR-------------------------------LFYASAE
A0A452H3N6_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A287AIU8_BMF-02       MLPCGVTEEPQR-------------------------------LFYG---
G1PAU1_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A287AIU8_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A1U8CPE0_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A286XXB0_BMF-03       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A287CXH0_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A1S3EQA2_BMF-02       MLPCGVTEEPQR-------------------------------LFYGSAG
A2AV74_BMF-02           MLPCGVTEEPQR-------------------------------LFYGNAG
H9GL49_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A3Q2UCA0_BMF-02       MLPCGVTEEPRR-------------------------------LFYGNAG
A0A3Q2UCA0_BMF-01       MLPCGVTEEPRR-------------------------------LFYGNAG
K7FRX2_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
U3JS06_BMF-01           MLPCGVTEEPRR-------------------------------LFYGSAG
A0A493T7X1_BMF-02       MLPCGVTEEPRR-------------------------------LFYGNAG
A0A3Q2UCA0_BMF-03       MLPCGVTEEPRR-------------------------------LFYGNAG
A0A3Q2UCA0_BMF-04       MLPCGVTEEPRR-------------------------------LFYGNAG
G1NHG8_BMF-01           MLPCGVTEEPRR-------------------------------LFYGNAG
A0A337ST43_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAK
A0A2K5KGP2_BMF-01       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K6FFN3_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K5E1Q4_BMF-02       MLPCGVTEEPQR-------------------------------LFYASAE
A0A2K5RN49_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K6TW78_BMF-03       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K6RAW1_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2I2Z168_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2R9BS98_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2J8QDD5_BMF-01       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K5MJW4_BMF-01       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K5VLE9_BMF-01       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K6B5F6_BMF-03       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2K5Z4A9_BMF-02       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A096NTE9_BMF-03       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A2I3HD83_BMF-01       MLPCGVTEEPQR-------------------------------LFYAPAE
A0A1S3EQA2_BMF-01       MLPCGVTEEPQR-------------------------------LFYGSAG
Q8K589_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A337ST43_BMF-05       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A337ST43_BMF-04       MLPCGVTEEPQR-------------------------------LFYGNAG
A2AV74_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A286XXB0_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
G3WDQ2_BMF-01           MLPCGVTEEPHR-------------------------------LFYGNAG
G3T7Z4_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A287CXH0_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A1S3WU31_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A337ST43_BMF-03       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A337ST43_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A1U8CPE0_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
G1SR62_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
M3YAD5_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
U6CSY8_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A452SED0_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A384D070_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
W5QFV1_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
L8IXF5_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A452F2E0_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A452F2E0_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
Q05KI3_BMF-02           MLPCGVTEEPQR-------------------------------LFYGHAG
Q05KI3_BMF-01           MLPCGVTEEPQR-------------------------------LFYGHAG
A0A2K6FFN3_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
H0WYH6_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNVG
A0A096NTE9_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6L919_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K5E1Q4_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6TW78_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6TW78_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K5RN49_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2I2Z168_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2R9BS98_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2J8QDD5_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2J8T301_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
F7CM09_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K5MJW4_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K5KGP2_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K5VLE9_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
F7CM09_BMF-03           MLPCGVTEEPQR-------------------------------LFYGNAG
F7CM09_BMF-02           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6B5F6_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6B5F6_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6B5F6_BMF-04       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K5Z4A9_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6L919_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6L919_BMF-03       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2K6RAW1_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A0D9R4R5_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
J9PB65_BMF-04           MLPCGVTEEPQR-------------------------------LFYGNAG
J9PB65_BMF-03           MLPCGVTEEPQR-------------------------------LFYGNAG
J9PB65_BMF-02           MLPCGVTEEPQR-------------------------------LFYGNAG
J9PB65_BMF-01           MLPCGVTEEPQR-------------------------------LFYGNAG
A0A3Q2HR24_BMF-01       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A3Q2HR24_BMF-02       MLPCGVTEEPQR-------------------------------LFYGNAG
A0A2I2YVQ5_PMAIP1-      KLL---SSS-----------------------------------PLALPR
A0A2I3SX38_PMAIP1-      KLL---SSSLSS-------------------------------WPLALPR
A0A2K5JY17_PMAIP1-      KLL----SS-----------------------------------PLALPR
A0A2R9AKC9_PMAIP1-      KLLSSSSSS-----------------------------------PLALPR
A0A2K6KJF1_PMAIP1-      KLL---SSS-----------------------------------PLALPR
A0A2K6NC45_PMAIP1-      KLL---SSS-----------------------------------PLALPR
A0A096MPU8_PMAIP1-      KLV---SSS-----------------------------------PLALPR
A0A2K5ZWH1_PMAIP1-      KLV---SSS-----------------------------------PLALPR
A0A2K5VPX2_PMAIP1-      KLV---SSS-----------------------------------PLVLPR
A0A2K6BV43_PMAIP1-      KLV---SSS-----------------------------------PLVLPR
W5QCU2_BIK-01           FLYTFLQNH---------------------------------------GP
A0A3Q2LHE3_BIK-01       FLDAFLHER---------------------------------------SP
A0A452QUG1_BIK-01       VAPSLHHQH-----------------------------------PAGEGA
A0A452V3L2_BIK-01       FLSTFLQEH---------------------------------------GP
A0A3B4CPH6_BAD-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1TZR9_BIK-01           --------------------------------------------------
A0A2K5QXZ1_BIK-01       --------------------------------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           --------------------------------------------------
O70337_BIK-01           --------------------------------------------------
Q925D2_BIK-01           --------------------------------------------------
A0A1S3FUQ7_BIK-01       --------------------------------------------------
H0XAE7_BIK-01           --------------------------------------------------
A0A2K6FM79_BIK-01       --------------------------------------------------
H0W025_BIK-01           --------------------------------------------------
A0A2K5CLG5_BIK-01       --------------------------------------------------
A0A2K6TBD7_BIK-01       --------------------------------------------------
H2P4N6_BIK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
G3QCT2_BIK-01           --------------------------------------------------
A0A2R8ZXD2_BIK-01       --------------------------------------------------
H2QLU7_BIK-01           --------------------------------------------------
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A0D9QZY8_BIK-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K6DBJ4_BIK-01       --------------------------------------------------
A0A2K5J4Q7_BIK-01       --------------------------------------------------
A0A096NKG5_BIK-01       --------------------------------------------------
A0A2K5LDM6_BIK-01       --------------------------------------------------
A0A2K5XSA1_BIK-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      VITHAMRRL-----------------------------------SKPQDT
G1LNV7_BBC3-01          HLESPVPSA-----------------------------------PGALAG
A0A2K5F6X4_BBC3-02      HLESPVPSA-----------------------------------PGALAG
F1RM01_BBC3-02          HLESPVPSA-----------------------------------PGALAG
A0A3B4V919_BCL2L11      VMKHALQRM-----------------------------------AEAHGG
A0A3B4XZH1_BCL2L11      VMKHALQRM-----------------------------------AEAHGG
A0A3Q1ICY2_BCL2L11      VMNHALQRL-----------------------------------AEANGS
A0A3Q3K6I5_BCL2L11      VMNHALQCM-----------------------------------AEAHGG
A0A3Q3ESW6_BCL2L11      VMQHALQRM-----------------------------------TEAHGG
A0A3Q2SZH6_BCL2L11      VMNHALQRM-----------------------------------AAEHGG
A0A3B3VNE0_BCL2L11      VMNHALQRM-----------------------------------AVEHGG
A0A3B3YII5_BCL2L11      VMNHALQRM-----------------------------------AVEHGG
A0A3B3YII5_BCL2L11      VMNHALQRM-----------------------------------AVEHGG
A0A3P9N073_BCL2L11      VMNHALQRM-----------------------------------AVEHEI
A0A3Q3B113_BCL2L11      VMNHALQRM-----------------------------------AVEQGG
A0A3B5M375_BCL2L11      VMNHALQRM-----------------------------------AVEHGG
A0A3B5QAM1_BCL2L11      VMNHALQRM-----------------------------------AVEHGG
A0A3B5QAM1_BCL2L11      VMNHALQRM-----------------------------------AVEHGG
A0A3B4BVX1_BCL2L11      FSFESEPSS-----------------------------------PLLTSP
Q9GL49_PMAIP1-01        SSSLPLARF-----------------------------------CPTAPR
A0A3B1IH05_BAD-01       HEDG--ARD-----------------------------------G-----
H3ANP3_BAD-01           ---DNMEIL-----------------------------------GRPSSE
H3ANP3_BAD-02           ---DNMEIL-----------------------------------GRPSSE
H3ANP3_BAD-03           RKRNNMEIL-----------------------------------GRPSSE
A0A3B3QX41_BAD-01       ------DLD-----------------------------------FGEGGA
A0A2I3TBK7_BAD-01       -SSPEERGH-----------------------------------SNPDAA
A0A2I2Z8C7_BAD-03       -SSPEERRH-----------------------------------SNADAA
A8MXU7_BAD-03           -SSPEERGH-----------------------------------SNADAA
A0A2K5M0A7_BAD-02       -SSPEERGH-----------------------------------SDADAA
A0A2K5XJR2_BAD-02       -SSPEERGH-----------------------------------SDADAA
A0A2K5VCA9_BAD-02       -SSPEERGH-----------------------------------SDADAA
A0A2K6E7I4_BAD-02       -SSPEERGH-----------------------------------SDADAA
A0A2K5HKU7_BAD-02       YSPS-ESED-----------------------------------SENPSA
A0A2K6N196_BAD-02       YYPA-ESED-----------------------------------SENPSA
A0A2K6PUL3_BAD-02       YYPA-ESED-----------------------------------SENPSA
A0A2K5M0A7_BAD-03       YSPSWESED-----------------------------------SENPSA
A0A2K5VCA9_BAD-03       YSPSWESED-----------------------------------SENPSA
A0A096MLD5_BAD-02       YSPSWESED-----------------------------------SENPSA
A0A2K6E7I4_BAD-03       YSPSWESED-----------------------------------SENPSA
A8MXU7_BAD-04           YSPSWESED-----------------------------------SENPSA
A0A2I3TBK7_BAD-03       YSPSWESED-----------------------------------SENPSA
A0A2R8Z688_BAD-03       YSPSWESED-----------------------------------SENPSA
A0A2K5E6A6_BAD-03       YSTCASASS-----------------------------------SENPSA
A0A2K5PDB1_BAD-03       ---------------------------------------------ENPSA
A0A2K6TG62_BAD-03       ---------------------------------------------ENPSA
G3VRY3_BAD-01           ---REGSRE-----------------------------------ASPEAE
G3VRY3_BAD-02           FEGREGSRE-----------------------------------ASPEAE
G1P8C5_BAD-01           VEPR--SRH-----------------------------------SSYPTG
A0A452ER54_BAD-02       VETR--SRH-----------------------------------SSYPAG
W5P8G9_BAD-01           VETR--SRH-----------------------------------SSYPAG
G3TP47_BAD-01           VETR--SRH-----------------------------------SSYPAG
A0A1U7Q4V0_BAD-01       METR--SRH-----------------------------------SSYTAG
Q61337_BAD-01           METR--SRH-----------------------------------SSYPAG
A0A287CT05_BAD-02       TETR--SRH-----------------------------------SSYPAD
A0A287CT05_BAD-01       TETR--SRH-----------------------------------SSYPAD
O35147_BAD-01           METR--SRH-----------------------------------SSYPAG
A0A091DDU4_BAD-01       METR--SRH-----------------------------------SSYPTG
A0A287AEF3_BAD-01       VETR--SRH-----------------------------------SSYPEG
G1MI17_BAD-01           VEPR--SRH-----------------------------------SSYPAG
M3YNE7_BAD-01           VETR--SRH-----------------------------------SSYPAG
A0A452RJM6_BAD-01       VEPR--SRH-----------------------------------SSYPAG
A0A384DJL2_BAD-01       VEPR--SRH-----------------------------------SSYPAG
A0A452ER54_BAD-01       VETR--SRH-----------------------------------SSYPAG
F1MUT9_BAD-01           VETR--SRH-----------------------------------SSYRAG
Q3SYZ0_BAD-01           VETR--SRH-----------------------------------SSYRAG
F7DN67_BAD-01           VETR--SRH-----------------------------------SSYPEG
F1PK10_BAD-01           -ETR--SRH-----------------------------------SSFPAG
Q45KI9_BAD-01           -ETR--SRH-----------------------------------SSFPAG
H0WVR2_BAD-01           VETR--SRH-----------------------------------SSYPAG
A0A2K6GWV0_BAD-01       VETR--SRH-----------------------------------SSYPAG
H0V608_BAD-01           METR--SRH-----------------------------------RSYPAG
A0A1S3FL84_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A2K5PDB1_BAD-01       VETR--SRH-----------------------------------RSYPAG
A0A2K5E6A6_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A2K6TG62_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A0D9R491_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A2K5HKU7_BAD-01       VETR--SRH-----------------------------------SSHPAG
A0A2K5XJR2_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A2K6N196_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A2K6PUL3_BAD-01       VETR--SRH-----------------------------------SSYPAG
B4DZQ9_BAD-01           VEIR--SRH-----------------------------------SSYPAG
A0A096MLD5_BAD-01       VETR--SRH-----------------------------------SSYPAG
A0A2I2Z8C7_BAD-01       VEIR--SRH-----------------------------------SSYPAG
A0A2I2Z8C7_BAD-02       VEIR--SRH-----------------------------------SSYPAG
A0A2R8Z688_BAD-01       VEIR--SRH-----------------------------------SSYPAG
A0A2J8TYJ3_BAD-01       VEIR--SRH-----------------------------------SSYPAG
A0A3B4DUY7_BAD-01       ----------------------------------------------DNED
E7FBJ6_BAD-01           ------------------------------------------------DT
B5XEF1_BAD-01           ------------------------------------------------DT
A0A3Q3FKT9_BAD-01       ----------------------------------------------ELQA
A0A3P9A5G8_BAD-01       --------D-----------------------------------NTEFQV
A0A3P9A5G8_BAD-02       --------D-----------------------------------NTEFQV
B5X1T1_BAD-01           --------D-----------------------------------NTEFQD
A0A3Q2QC80_BAD-01       ----------------------------------------------ELQG
A0A3Q3FKT9_BAD-03       ----------------------------------------------ELQA
H3D8J8_BAD-01           ----------------------------------------------ELQG
A0A3B5L9R9_BAD-01       LTLPELRST-----------------------------------KVELQA
A0A3P9B2E4_BAD-01       ----------------------------------------------ELMA
I3K7B6_BAD-01           ----------------------------------------------DLMA
A0A3Q3C680_BAD-01       ----------------------------------------------ELMA
A0A3P8QRJ7_BAD-01       ----------------------------------------------ELMA
A0A3Q4GGN3_BAD-01       ----------------------------------------------ELMA
A0A3B4GXJ6_BAD-01       ----------------------------------------------ELMA
A0A3Q0QNQ2_BAD-01       ----------------------------------------------ELVV
A0A3P8WI83_BAD-02       ----------------------------------------------AFQS
A0A3P8WI83_BAD-01       ----------------------------------------------AFQS
A0A3Q2D5S0_BAD-01       ----------------------------------------------E--A
A0A3P9HNZ2_BAD-01       ----------------------------------------------DLAR
A0A3B3BQF7_BAD-01       ----------------------------------------------DLPR
A0A3Q1K1C7_BAD-02       ----------------------------------------------ELQA
A0A3Q1K1C7_BAD-01       ----------------------------------------------ELQA
A0A3Q1GWH9_BAD-01       ----------------------------------------------ELQA
A0A3Q1CPU7_BAD-01       ----------------------------------------------ELQA
A0A3P8TWH6_BAD-01       ----------------------------------------------ELQA
A0A2U9BAC9_BAD-01       ----------------------------------------------ELLT
A0A3B4VFC5_BAD-01       ----------------------------------------------EFQA
A0A3B4W9T1_BAD-01       ----------------------------------------------EFQA
Q4V925_BAD-03           ----------------------------------------------NLSM
Q4V925_BAD-02           ----------------------------------------------NLSM
A7MCM4_BAD-01           ----------------------------------------------NLSM
Q4V925_BAD-01           ----------------------------------------------NLSM
Q4V925_BAD-04           ----------------------------------------------NLSM
A0A3P8Y761_BAD-01       --------R-----------------------------------SGELQG
A0A3B5Q2N7_BAD-01       --------V-------------------------------------ELQA
A0A087X8P8_BAD-01       --------E-------------------------------------ELQA
A0A3B3UA11_BAD-01       --------E-------------------------------------ELQA
A0A3B3YFR1_BAD-01       --------E-------------------------------------ELQA
A0A3P9Q7C3_BAD-01       --------E-------------------------------------ELQA
A0A3B3HDU2_BAD-01       ------------------------------------------------DL
A0A3P9KSL7_BAD-01       ------------------------------------------------DL
A0A3P9KSL7_BAD-02       ------------------------------------------------DL
A0A3B5BAL2_BAD-01       --------E-------------------------------------ELQA
A0A3Q3AEL8_BAD-01       --------E-------------------------------------ELPA
A0A3Q3AEL8_BAD-02       --------E-------------------------------------ELPA
G3Q8B3_BAD-01           ------------------------------------------------EE
A0A3Q2Y0E4_BAD-01       --------E-------------------------------------EFQA
A0A3Q3R5S3_BAD-01       ------------------------------------------------DA
A0A3Q3RXS8_BAD-01       ------------------------------------------------QS
A0A3Q3RXS8_BAD-02       ------------------------------------------------QS
A0A3Q0QNQ2_BAD-02       ------------------------------------------------VV
A0A3Q3WTY4_BAD-01       ------------------------------------------------QV
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       -------------------------------------------------H
G1PDJ5_BCL2L11-01       -------------------------------------------------Q
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           -------------------------------------------------G
A3KND0_BMF-01           -------------------------------------------------P
A0A2K6KS56_BBC3-02      -------------------------------------------------V
Q2PG01_BAD-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
F7G1G0_HRK-01           -------------------------------------------------R
A0A1U7R468_HRK-01       -------------------------------------------------R
P62816_HRK-03           -------------------------------------------------R
P62817_HRK-01           -------------------------------------------------R
A0A2K5KZ69_HRK-01       -------------------------------------------------R
H2NIS8_HRK-01           -------------------------------------------------R
H2Q6Y8_HRK-01           -------------------------------------------------R
G3UH24_HRK-01           -------------------------------------------------R
A0A2K5BYA0_HRK-01       -------------------------------------------------R
U3E722_HRK-01           -------------------------------------------------R
A0A452DXE5_HRK-01       -------------------------------------------------R
A0A0D9SC73_HRK-01       -------------------------------------------------R
A0A3Q2IBL3_HRK-01       -------------------------------------------------R
A0A337SQ56_HRK-01       -------------------------------------------------R
G3QTJ6_HRK-01           -------------------------------------------------R
A0A2K6AYL7_HRK-01       -------------------------------------------------R
G1QHD8_HRK-01           -------------------------------------------------R
G1T7W1_HRK-01           -------------------------------------------------R
H0Y001_HRK-01           -------------------------------------------------R
A0A096N944_HRK-01       -------------------------------------------------R
A0A2K6GL98_HRK-01       -------------------------------------------------R
A0A2K5PIE7_HRK-01       -------------------------------------------------R
I3LVX0_BIK-01           -------------------------------------------------R
A0A286XF37_PMAIP1-      ------------------KS---SEP-----------------------D
A0A1U7QLK6_PMAIP1-      ------------------KSVT-RIP-----------------------S
Q9JM54_PMAIP1-01        ------------------SRM--RSP-----------------------S
Q5U777_PMAIP1-01        ------------------KSTMRRSP-----------------------S
A0A3Q2LHE3_BIK-02       -------------------------------------------------T
F7FUT7_BIK-02           -------------------------------------------------E
F7FUT7_BIK-01           -------------------------------------------------E
O61667_EGL1-01          -------------------------------------------------F
A0A3G3M2M0_BCL2L11      -----AQDDQNDEVWFAEPSHQHVQM-----------------------A
A0A3Q1ELG4_BCL2L11      -----AD--------------KTTQT-----------------------P
A0A3Q1CI15_BCL2L11      -----AD--------------KATQT-----------------------P
F1SMU1_PMAIP1-01        RVRGLSSRSFAAKFRLLFAEMPGRRS-----------------------R
Q9BXH1_BBC3-04          --------------------SGGRPL-----------------------P
A0A3B4UNJ0_BMF-01       HWELSPSTKMNML----RFSENR--------------------------P
B2KKY9_BCL2L11-01       SVPGSP-LMPNIS----EAQDGQNDEVWLSEHSHQHLQM----------A
B8JK68_BCL2L11-01       SVPGSP-LMPNIS----EAQDGQNDEVWLSEHSHQHLQM----------A
A0A3B4B6Y3_BMF-01       -------AHFELG----EDQEASESLQEGEMQNGREPLP----------R
A0A3P9ICE1_BMF-01       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
Q0GKC7_BMF-01           LLVLAA-SSRAQP----PDVVLRQNV------SPMER------------P
A0A3B3RH63_BMF-01       LRLHFP-ALSVPG----GHPPQEERQ-----------------------P
W5N4P7_BMF-01           FRLHFP-AHFEQG----GDEEEETGE-----------------------A
A0A3B1K1X5_BMF-01       LLLLAPSARSERV----GDAMFREEH--------RAVEP----------R
A0A3B4CNJ8_BMF-01       LLLLAPSVRPEHV----EGAMLQEDQ--------LAMEP----------R
A0A2U9CJH3_BMF-01       FRLHFP-AHFELF----GDQEVRGHE-SEEERSGMEQLPR---------Q
A0A3Q2YCX7_BMF-01       FRLHFP-AHFELV----GEQEERLQESDDGMEQQLQQQQ----------Q
A0A3Q2YCX7_BMF-02       FRLHFP-AHFELV----GEQEERLQESDDGMEQQLQQQQ----------Q
A0A3P8ZIE7_BMF-01       FRLHFP-AQFECV----GDPGPQQRP--QAVRGGMEH------------P
A0A3Q2PJX9_BMF-02       FRLHFP-AHFELV----GDFDARRQE----EQNRMEPLP----------L
A0A3Q3QZ16_BMF-01       FRLHFP-AHFELV----GDQEARRQE----DQNGMEHLP----------R
A0A3Q3QZ16_BMF-02       FRLHFP-AHFELV----GDQEARRQE----DQNGMEHLP----------R
A0A3Q2PJX9_BMF-01       FRLHFP-AHFELV----GDFDARRQE----EQNRMEPLP----------L
A0A3Q2PJX9_BMF-03       FRLHFP-AHFELV----GDFDARRQE----EQNRMEPLP----------L
A0A3B5QK08_BMF-01       FRLHFP-AHFELV----GDFDARQQE----EQNRMEQLP----------L
A0A3B5QK08_BMF-02       FRLHFP-AHFELV----GDFDARQQE----EQNRMEQLP----------L
A0A096LRV0_BMF-01       FRLHFP-AHFELV----GDFDARQQE----EQNRMEQLP----------L
A0A3B3WU80_BMF-01       FRLHFP-AHFELV----GDFDARQQE----EQNRMEQLP----------L
A0A3P9Q8E2_BMF-01       FRLHFP-AHFELV----RDFDARQQE----EQNRMEQLP----------L
A0A3Q2CXC4_BMF-02       FRLHFP-AHFELV----GDFDVRRQA----EHNRMEQLP----------L
A0A3Q2CXC4_BMF-01       FRLHFP-AHFELV----GDFDVRRQA----EHNRMEQLP----------L
A0A3Q3GUU5_BMF-01       FRLHFP-ANFELV----GDQEESGQE-SELQQIGMEQ-------------
A0A3B5B8F6_BMF-01       FRLHFP-ARFELI----GDHQARQQQGSEMEQNGMEQLP----------R
A0A3Q3VLX6_BMF-01       -----------VT----SSLAPDSRD-NCRERNGMERLP----------R
A0A3P8UA78_BMF-02       FRLHFP-AHFELI----GDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQ
A0A3P8UA78_BMF-01       FRLHFP-AHFELI----GDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQ
A0A3P8UA78_BMF-03       FRLHFP-AHFELI----GDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQ
A0A3B3CGR9_BMF-01       FRLHFP-ARFELA----GDLEARRHD-REAERGGMERLP----------R
A0A3P9K487_BMF-02       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3P9K487_BMF-01       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-03       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-02       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-01       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-04       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3P9ICE1_BMF-04       FRLHFP-ARFELA----GDLEVRRHD-REAERRGMERLP----------R
A0A3Q2ZA20_BMF-01       FRLHFP-ARFELI----RDLEARQQD-REEEPNRMERLP----------R
A0A3P8NFE2_BMF-02       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
I3K2D6_BMF-01           FRLHFP-ARFELV----GDHRARRQE-IAEQQNSMERLP----------R
A0A3P8NFE2_BMF-01       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
A0A3Q3C5V2_BMF-01       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
A0A3P9DPJ5_BMF-01       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
A0A3P9DPJ5_BMF-02       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
A0A3B4ETH0_BMF-01       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
A0A3Q4G1I4_BMF-01       FRLHFP-ARFELV----GDHRASRQG-STEQQNSMERLP----------R
A0A3Q1FVH7_BMF-02       FRLHFP-AHFELI--------ARQQG-SEMEQNGMEQLP----------R
A0A3Q1FVH7_BMF-01       FRLHFP-AHFELI--------ARQQG-SEMEQNGMEQLP----------R
A0A3Q3RVI2_BMF-01       FRLHFP-AHFELV----GDQEVRQQE-REEEQNRMEQLP----------R
A0A3Q1D1K3_BMF-01       FRLHFP-ARFELI----GNHQARQQG-SEMEQNGMEQLP----------R
A0A3P8RKY9_BMF-01       FRLHFP-ARFELI----GNHQARQQG-SEMEQNGMEQLP----------R
A0A3Q3RVI2_BMF-02       FRLHFP-AHFELV----GDQEVRQQE-REEEQNRMEQLP----------R
A0A3Q1IPR4_BMF-01       FRLHFP-AHFELV----GDLEVRQQD-SEEEQNGMEIPP----------R
A0A3B4U5H8_BMF-01       FRLHFP-AHFELV----GDQEARRQG-SGEERNGMEQLP----------R
A0A3B4WM88_BMF-01       FRLHFP-AHFELV----GDQEARRQG-SGEERNGMEQLP----------R
A0A3Q3SYA1_BCL2L11      --------------------AEAHGG-----------------------G
R4G9R5_BCL2L11-01       --------------------TSRWQS-----------------------R
A0A3B3QC78_BCL2L11      -----------------------TRT-----------------------L
F7CXT2_BCL2L11-01       --------------------ASMRQS-----------------------Q
F7FTC8_BCL2L11-01       --------------------ASIRQP-----------------------Q
A0A2R8M6L7_BCL2L11      --------------------ASMRQS-----------------------Q
G3SU55_BCL2L11-01       --------------------ASMRQS-----------------------Q
G3W979_BCL2L11-01       ------------------DTASMRQS-----------------------Q
U3IW89_BCL2L11-01       --------------------ASRWRS-----------------------H
A0A3Q2U844_BCL2L11      --------------------ASRWRS-----------------------H
C1C3S9_BAD-01           ------------------KSASAATE-----------------------M
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------LGHRPA-----------------------R
K7GA86_BCL2L11-01       ------------------DHASRWES-----------------------P
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------ASMRQS-----------------------Q
M3YDI3_BCL2L11-01       --------------------ASRRQS-----------------------Q
F7CXT2_BCL2L11-02       ------------------DHASMRQS-----------------------Q
G1SSY0_BCL2L11-01       --------------------GKQSLG-----------------------K
J9NWV6_BCL2L11-06       --------------------ASMRQS-----------------------Q
C1KGB8_BCL2L11-01       --------------------ASMRQS-----------------------Q
A0A3Q2GRS5_BCL2L11      --------------------ASMRQS-----------------------Q
U6CTE3_BCL2L11-04       --------------------ASRRQS-----------------------Q
A0A1U7T0R1_BCL2L11      --------------------ESMRQS-----------------------Q
J9NWV6_BCL2L11-02       -------------------------G-----------------------L
A0A2K6TRU4_BCL2L11      -------------------------A-----------------------D
A0A2K5NU92_BCL2L11      -------------------------G-----------------------I
A0A2I2YQ13_BCL2L11      -------------------------G-----------------------I
A0A2K5X1Y3_BCL2L11      -------------------------G-----------------------I
A0A2K6QIL2_BCL2L11      -------------------------G-----------------------I
A0A2K5HZI5_BCL2L11      -------------------------A-----------------------N
A0A2I3GVB2_BCL2L11      -------------------------A-----------------------N
A0A2R9C366_BCL2L11      -------------------------A-----------------------N
A0A2I3SN61_BCL2L11      -------------------------A-----------------------N
A0A2K5HZI5_BCL2L11      -------------------------G-----------------------V
A0A2I2YQ13_BCL2L11      --------------------VREIEE-----------------------V
A0A2K6QIL2_BCL2L11      --------------------VREIEE-----------------------V
A0A2K5Q1Y0_BCL2L11      --------------------VREIEE-----------------------V
A0A2K6GE31_BCL2L11      --------------------VREIEE-----------------------V
A0A1U7T0R1_BCL2L11      -------------------------G-----------------------L
A0A1U7T0R1_BCL2L11      --------------------VREIEE-----------------------V
O54918_BCL2L11-01       --------------------ASIRQS-----------------------Q
O88498_BCL2L11-01       --------------------ASIRQS-----------------------Q
A0A2K5Z7V3_BCL2L11      --------------------ASRR-------------------------Q
A0A096NYC3_BCL2L11      --------------------ASRR-------------------------Q
A0A2K5X1Y3_BCL2L11      --------------------ASRR-------------------------Q
A0A2K6E212_BCL2L11      --------------------ASRR-------------------------Q
A0A2K5NU92_BCL2L11      --------------------ASRR-------------------------Q
A0A096NYC3_BCL2L11      --------------------ASRR-------------------------Q
A0A2K6KJP8_BCL2L11      --------------------ASRR-------------------------Q
A0A2I3SN61_BCL2L11      --------------------ASMR-------------------------Q
A0A2R8M6L7_BCL2L11      --------------------ASMRQS-----------------------Q
A0A2K5CA89_BCL2L11      --------------------ASMRQS-----------------------Q
A0A2K5Q1Y0_BCL2L11      --------------------ASMRQS-----------------------Q
A0A1U7T0R1_BCL2L11      --------------------ESMRQS-----------------------Q
A0A1U7T0R1_BCL2L11      --------------------ESMRQS-----------------------Q
A0A3Q2GRS5_BCL2L11      --------------------ASMRQS-----------------------Q
J9NWV6_BCL2L11-04       --------------------ASMRQS-----------------------Q
U6CTE3_BCL2L11-02       --------------------ASRRQS-----------------------Q
A0A1U8BW10_BCL2L11      --------------------ASIRQS-----------------------Q
A0A1U7T0R1_BCL2L11      --------------------ESMRQS-----------------------Q
A0A2K6GE31_BCL2L11      --------------------ASMRQF-----------------------Q
A0A287DFJ0_BCL2L11      --------------------ASMRES-----------------------Q
A0A452FCR6_BCL2L11      --------------------ASMRQS-----------------------Q
W5PY58_BCL2L11-01       --------------------ASMRQS-----------------------Q
L8IVA4_BCL2L11-02       --------------------ASMRQS-----------------------Q
A0A286XJN2_BCL2L11      --------------------ASMRQS-----------------------Q
A0A286XJN2_BCL2L11      --------------------ASMRQS-----------------------Q
G1SSY0_BCL2L11-02       --------------------ASMRQS-----------------------Q
A0A250YBV9_BCL2L11      --------------------ASMRQS-----------------------Q
H0XW23_BCL2L11-01       --------------------ASMRQS-----------------------Q
A0A1S3FFM9_BCL2L11      --------------------ASMRQS-----------------------Q
U6CTE3_BCL2L11-01       --------------------ASRRQS-----------------------Q
G1LDR8_BCL2L11-01       --------------------ASMRQS-----------------------Q
J9NWV6_BCL2L11-03       --------------------ASMRQS-----------------------Q
A0A2I2UX96_BCL2L11      --------------------ASMRQP-----------------------Q
O54918_BCL2L11-03       --------------------DQLENL-----------------------N
A0A1U8BW10_BCL2L11      --------------------D-LCEN-----------------------L
J9NWV6_BCL2L11-05       -------------------------V-----------------------R
A0A3Q2GRS5_BCL2L11      -------------------------V-----------------------R
A0A452U4S4_BCL2L11      --------------------D-LWTV-----------------------E
A0A2R9C366_BCL2L11      --------------------DDSAGS-----------------------S
A0A2I3GVB2_BCL2L11      --------------------DEAAGS-----------------------S
A0A2K6TRU4_BCL2L11      --------------------DEATGS-----------------------S
A0A0D9RWE0_BCL2L11      --------------------ASRRQA-----------------------E
U6CTE3_BCL2L11-03       --------------------ASRRQS-----------------------Q
A0A2K6E212_BCL2L11      --------------------ASRRQA-----------------------E
H2P5E2_BCL2L11-01       --------------------ASMRQA-----------------------E
A0A250YBV9_BCL2L11      --------------------ASMRQS-----------------------Q
A0A286XJN2_BCL2L11      --------------------ASMRQS-----------------------Q
A0A2I2UX96_BCL2L11      --------------------ASMRQP-----------------------Q
A0A1S3FFM9_BCL2L11      --------------------ASMRQS-----------------------Q
A0A452SBG5_BCL2L11      --------------------ASMRQS-----------------------Q
A0A3Q1MV27_BCL2L11      --------------------ASMRQS-----------------------Q
A0A1U8BW10_BCL2L11      --------------------ASIRQS-----------------------Q
A0A287DFJ0_BCL2L11      --------------------ASMRES-----------------------Q
L8IVA4_BCL2L11-01       --------------------ASMRQS-----------------------Q
A0A3Q1MV27_BCL2L11      --------------------ASMRQS-----------------------Q
A0A452FCR6_BCL2L11      --------------------ASMRQS-----------------------Q
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------VVILED-----------------------I
A0A2K6KJP8_BCL2L11      --------------------VVILED-----------------------I
A0A3P8RLE2_BCL2L11      ADGADSVPSSPLS------PKRLTAD-----------------------K
A0A3B1JLM2_BAD-01       DNENQDGASAEDGGVGDGAPFRGRSQ-----------------------S
Q61337_BAD-05           ------GTEEDEGMEEELSPFRGRSR-----------------------S
A0A3B1JXK6_BCL2L11      ------RGDAQSFELCPGPNHCPPHR-----------------------A
A0A3B4BVX1_BCL2L11      ------RGNAQTFELWPLYNHHPPHG-----------------------A
A0A2I3HWI8_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
A0A3Q2GWE8_BBC3-02      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K6STD6_BBC3-02      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2R8MW85_BBC3-02      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K5QNS7_BBC3-02      --------GGPTQ-----AALGVRGE-----------------------E
A0A2K6FQZ1_BBC3-04      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2R9BZA9_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2I3RGH5_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K5P2T8_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K5V8J3_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K6ASP2_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2I3N2Z9_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K6QZT2_BBC3-04      --------GGPTQ-----AAPGVRGE-----------------------E
F7GL32_BBC3-02          ------SGGPPGV-----LGPEHGDQ-----------------------G
F7GL32_BBC3-01          ------SGGPPGV-----LGPEHGDQ-----------------------G
J9NTK9_BBC3-01          --------GGPTQ-----AAPGVRGE-----------------------E
F1RM01_BBC3-04          --------GGPTQ-----AAPGIRGE-----------------------E
G3T2N1_BBC3-01          ----------PTQ-----AAPGVRGE-----------------------D
A0A250YBU3_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
M3Y0R3_BBC3-01          --------GGPTQ-----AAPGVRGE-----------------------E
A0A1U7R5N5_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
Q99ML1_BBC3-02          --------GGPTQ-----AAPGVRVE-----------------------E
Q80ZG6_BBC3-01          --------GGPTQ-----AAPGVRVE-----------------------E
H0XQ00_BBC3-01          --------GGPTQ-----AAPEVRGE-----------------------E
A0A0D9S2H2_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
B4DQK3_BBC3-01          --------GGPTQ-----AAPGVRGE-----------------------E
A0A250YBU3_BBC3-02      --------GGPTQ-----AAPGVRGE-----------------------E
A0A3Q1LXZ6_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
A0A452E3G1_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
F1RM01_BBC3-03          --------GGPTQ-----AAPGIRGE-----------------------E
A0A2I3RGH5_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
H2NZD3_BBC3-01          --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K6QZT2_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
A0A2K6FQZ1_BBC3-01      --------GGPTQ-----AAPGVRGE-----------------------E
A0A337SAW2_BAD-01       -------------------RSRSAPP-----------------------N
A0A2R8MW85_BBC3-03      --------GGPTQ-----AAPGVRGE-----------------------E
C1KGB6_BCL2L11-02       --------AMASM-----RQSQAEPA-----------------------D
C1KGB6_BCL2L11-03       --------AMASM-----RQSQAEPA-----------------------D
C1KGB6_BCL2L11-01       --------AMASM-----RQSQAEPA-----------------------D
J9NWV6_BCL2L11-01       --------AMASM-----RQSQAVPA-----------------------D
A0A3Q2GRS5_BCL2L11      --------AMASM-----RQSQAVPA-----------------------D
A0A3Q2GRS5_BCL2L11      --------AMASM-----RQSQAVPA-----------------------D
J9NTK9_BBC3-03          --------ISRAI-----YSR-----------------------------
J9NTK9_BBC3-02          --------FFCTM-------------------------------------
A0A3Q2GWE8_BBC3-01      --------SFCTM-------------------------------------
Q9BXH1_BBC3-03          --------FLCTM-------------------------------------
A0A493T7X1_BMF-01       QKSSV-VAAFSLS-----TQLGLKRG-----------------------G
A0A452H3N6_BMF-01       YRLHVPPVGFALN-----PHLQEEPR-----------------------E
A0A287AIU8_BMF-02       ------------------LPLGEQPP-----------------------E
G1PAU1_BMF-01           YRLPL-PASFPAG-----SPLGEQPP-----------------------E
A0A287AIU8_BMF-01       YRLPL-PAGFPAG-----LPLGEQPP-----------------------E
A0A1U8CPE0_BMF-02       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A286XXB0_BMF-03       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A287CXH0_BMF-02       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A1S3EQA2_BMF-02       YRLPL-PAGFPA---------AQQPP-----------------------E
A2AV74_BMF-02           YRLPL-PASFPAG-----SPLGEQPP-----------------------E
H9GL49_BMF-01           YRLHVSPIGFSLN-----PHFQEEPQ-----------------------E
A0A3Q2UCA0_BMF-02       YRLHVPPVGFALD-----PNLQEEPQ-----------------------E
A0A3Q2UCA0_BMF-01       YRLHVPPVGFALD-----PNLQEEPQ-----------------------E
K7FRX2_BMF-01           YRLHEPPVGFALN-----PHLQEEPR-----------------------E
U3JS06_BMF-01           YRLHVPPAGFVLD-----PHLQEEPQ-----------------------E
A0A493T7X1_BMF-02       YRLHVPPVGFALD-----PHLQEEPQ-----------------------E
A0A3Q2UCA0_BMF-03       YRLHVPPVGFALD-----PNLQEEPQ-----------------------E
A0A3Q2UCA0_BMF-04       YRLHVPPVGFALD-----PNLQEEPQ-----------------------E
G1NHG8_BMF-01           YRLHVPPVGFALD-----PNLQEEPQ-----------------------E
A0A337ST43_BMF-02       PPSSV-VADSPL------------PT-----------------------Q
A0A2K5KGP2_BMF-01       PKSRV-VADPPL------------PA-----------------------Q
A0A2K6FFN3_BMF-02       PKSHV-VADPPL------------PT-----------------------Q
A0A2K5E1Q4_BMF-02       PKSRV-VAGPPL------------SA-----------------------Q
A0A2K5RN49_BMF-02       PKSRV-VAGPPL------------PA-----------------------Q
A0A2K6TW78_BMF-03       PKSCV-VAGPPL------------PA-----------------------Q
A0A2K6RAW1_BMF-02       PKSRV-VADPPL------------PA-----------------------Q
A0A2I2Z168_BMF-02       PKSCV-VADPPL------------PA-----------------------Q
A0A2R9BS98_BMF-02       PKSCV-VADPPL------------PA-----------------------Q
A0A2J8QDD5_BMF-01       PKSCV-VADPPL------------PA-----------------------Q
A0A2K5MJW4_BMF-01       PKSRV-VADPPL------------PA-----------------------Q
A0A2K5VLE9_BMF-01       PKSRV-VADPPL------------PA-----------------------Q
A0A2K6B5F6_BMF-03       PKSRV-VADPPL------------PA-----------------------Q
A0A2K5Z4A9_BMF-02       PKSRV-VADPPL------------PA-----------------------Q
A0A096NTE9_BMF-03       PKSRV-VADPPL------------PA-----------------------Q
A0A2I3HD83_BMF-01       PKSRV-VADPPL------------PA-----------------------Q
A0A1S3EQA2_BMF-01       YRLPL-PAGFPA---------AQQPP-----------------------E
Q8K589_BMF-01           YRLPL-PASFPAG-----SALGEQPP-----------------------E
A0A337ST43_BMF-05       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A337ST43_BMF-04       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A2AV74_BMF-01           YRLPL-PASFPAG-----SPLGEQPP-----------------------E
A0A286XXB0_BMF-02       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
G3WDQ2_BMF-01           YRLPL-PANFPSS-----LRLGAEPP-----------------------E
G3T7Z4_BMF-01           YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A287CXH0_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A1S3WU31_BMF-01       YRLPL-PNSFPAG-----SPFAEQRR-----------------------E
A0A337ST43_BMF-03       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A337ST43_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A1U8CPE0_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
G1SR62_BMF-01           YRLPL-PASFPAN-----FALGEQPP-----------------------E
M3YAD5_BMF-01           YRLPL-PASFPAG-----LPLGDQPP-----------------------E
U6CSY8_BMF-01           YRLPL-PASFPAG-----LPLGDQPP-----------------------E
A0A452SED0_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A384D070_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
W5QFV1_BMF-01           YRLPL-PASFPAG-----LPLGEQPP-----------------------E
L8IXF5_BMF-01           YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A452F2E0_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A452F2E0_BMF-02       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
Q05KI3_BMF-02           YRLPL-PASFPAG-----LPLGEQPP-----------------------E
Q05KI3_BMF-01           YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A2K6FFN3_BMF-01       YRLPL-PASFPAG-----LPLGEQPA-----------------------E
H0WYH6_BMF-01           YRLPL-PASFPAG-----LPIGEQPP-----------------------E
A0A096NTE9_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6L919_BMF-02       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K5E1Q4_BMF-01       YRLPL-PASFPAV-----LPLGEQPP-----------------------E
A0A2K6TW78_BMF-01       YRLPL-PASFPAV-----LPLGEQPP-----------------------E
A0A2K6TW78_BMF-02       YRLPL-PASFPAV-----LPLGEQPP-----------------------E
A0A2K5RN49_BMF-01       YRLPL-PASFPAV-----LPLGEQPP-----------------------E
A0A2I2Z168_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2R9BS98_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2J8QDD5_BMF-02       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2J8T301_BMF-01       YRLPL-PASFPAV-----LPTGEQPP-----------------------E
F7CM09_BMF-01           YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K5MJW4_BMF-02       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K5KGP2_BMF-02       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K5VLE9_BMF-02       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
F7CM09_BMF-03           YRLPL-PASFPAV-----LPIGEQPP-----------------------E
F7CM09_BMF-02           YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6B5F6_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6B5F6_BMF-02       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6B5F6_BMF-04       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K5Z4A9_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6L919_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6L919_BMF-03       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A2K6RAW1_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
A0A0D9R4R5_BMF-01       YRLPL-PASFPAV-----LPIGEQPP-----------------------E
J9PB65_BMF-04           YRLPL-PASFPAG-----LPLLEQPP-----------------------E
J9PB65_BMF-03           YRLPL-PASFPAG-----LPLLEQPP-----------------------E
J9PB65_BMF-02           YRLPL-PASFPAG-----LPLLEQPP-----------------------E
J9PB65_BMF-01           YRLPL-PASFPAG-----LPLLEQPP-----------------------E
A0A3Q2HR24_BMF-01       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A3Q2HR24_BMF-02       YRLPL-PASFPAG-----LPLGEQPP-----------------------E
A0A2I2YVQ5_PMAIP1-      GHEEQVQVAGSRVCYSTQEIWRQTEL-----------------------P
A0A2I3SX38_PMAIP1-      GHEEQVQVAGSRVCYSTQEIWRQTEL-----------------------P
A0A2K5JY17_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTEL-----------------------P
A0A2R9AKC9_PMAIP1-      GHEEQAQVAGSRVCYSTQEIWRQTEL-----------------------P
A0A2K6KJF1_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTEL-----------------------P
A0A2K6NC45_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTEL-----------------------P
A0A096MPU8_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTEL-----------------------P
A0A2K5ZWH1_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTEL-----------------------P
A0A2K5VPX2_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTEL-----------------------P
A0A2K6BV43_PMAIP1-      GHEEQVQVARSRVCYSTQEIWRQTKL-----------------------P
W5QCU2_BIK-01           GFLDDQGSGLPGV----TSILEFH-------------------------P
A0A3Q2LHE3_BIK-01       EALE-----VPGM----TELT----------------------------E
A0A452QUG1_BIK-01       VLTG-----AGGI----CQ------------------------------A
A0A452V3L2_BIK-01       EVLE-----VPGM----TDLVEYYDP-----------------------G
A0A3B4CPH6_BAD-01       ------HGDGAAD----GDSFRRRCR-----------------------S
M3XHJ5_BCL2L11-01       ------HPTQRPD----QPPFVK--Q-----------------------E
G1TZR9_BIK-01           ------RPVEEGD----LD-------------------------------
A0A2K5QXZ1_BIK-01       ------DP--EED----LDPVED---------------------------
O70337_BIK-04           --------------------------------------------------
O70337_BIK-02           ------E------------PVRD--V-----------------------D
O70337_BIK-01           ------E------------PVRD--V-----------------------D
Q925D2_BIK-01           ------EPVGVED----VSPVRD--L-----------------------D
A0A1S3FUQ7_BIK-01       ------EPMGEEV------------W-----------------------D
H0XAE7_BIK-01           ------E------------------P-----------------------N
A0A2K6FM79_BIK-01       ------DN------------EEN--P-----------------------D
H0W025_BIK-01           ------QPLWAED----LSPPGD--T-----------------------N
A0A2K5CLG5_BIK-01       ------DP--EED----LDPVED---------------------------
A0A2K6TBD7_BIK-01       ------DP--EED----PDSVED---------------------------
H2P4N6_BIK-01           ------DS--EED----LDPMED--F-----------------------S
G1S1X2_BIK-01           ------DP--EED----LDPMED--F-----------------------D
G3QCT2_BIK-01           ------DS--EED----LDPMED--F-----------------------D
A0A2R8ZXD2_BIK-01       ------ES--EED----LDPMED--F-----------------------D
H2QLU7_BIK-01           ------DS--EED----LDPMED--F-----------------------D
A0A2K6MCW0_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A2K6QK74_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A0D9QZY8_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A2K5VW94_BIK-01       ------DP--EED----LDPMED--F-----------------------N
A0A2K6DBJ4_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A2K5J4Q7_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A096NKG5_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A2K5LDM6_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A2K5XSA1_BIK-01       ------DP--EED----LDPMED--F-----------------------D
A0A3P8XIA2_BCL2L11      WRG--YEAWPTPH-----HPYRPRPP-----------------------P
G1LNV7_BBC3-01          GPTQ-------AA-----PG-----V-----------------------R
A0A2K5F6X4_BBC3-02      GPTQ-------AA-----PG-----V-----------------------R
F1RM01_BBC3-02          GPTQ-------AA-----PG-----I-----------------------R
A0A3B4V919_BCL2L11      GARM-------QQ-----QH------------------------------
A0A3B4XZH1_BCL2L11      GARM-------QQ-----QQHGEHRH-----------------------F
A0A3Q1ICY2_BCL2L11      DLRT-HQQHGSDL-----SSSSTQQQ-----------------------N
A0A3Q3K6I5_BCL2L11      RPGT-HRQDASSP-----SPSSARQQ-----------------------N
A0A3Q3ESW6_BCL2L11      GPGT-QQQYGHSP-----SLTSRRQR-----------------------T
A0A3Q2SZH6_BCL2L11      QPARILGLHGHSF-----SARQG--------------------------N
A0A3B3VNE0_BCL2L11      -----LGLHGHSP-----NHYSTI-------------------------N
A0A3B3YII5_BCL2L11      -----LGLHGHSP-----NHYSTI-------------------------N
A0A3B3YII5_BCL2L11      -----LGLHGHSP-----NHYSTI-------------------------N
A0A3P9N073_BCL2L11      PKLN-VKGKEEKG-----GRGGAFVI-----------------------I
A0A3Q3B113_BCL2L11      GPGT-HRLHGSSP-----NPSGTQAR-----------------------N
A0A3B5M375_BCL2L11      -----LGLQGEQT--------SVL-------------------------P
A0A3B5QAM1_BCL2L11      -----LGLHGQSP-----NHYSTI-------------------------N
A0A3B5QAM1_BCL2L11      -----LGLHGQSP-----NHYSTI-------------------------N
A0A3B4BVX1_BCL2L11      SLSV--CSTELWP----LYNHHPPHG-----------------------A
Q9GL49_PMAIP1-01        AACY--LQSQGAR----VRGLSSRSF-----------------------A
A0A3B1IH05_BAD-01       ------------------DSFRRRSR-----------------------S
H3ANP3_BAD-01           SQIS--DSESLDE----LGPFRTRSR-----------------------S
H3ANP3_BAD-02           SQIS--DSESLDE----LGPFRTRSR-----------------------S
H3ANP3_BAD-03           SQIS--DSESLDE----LGPFRTRSR-----------------------S
A0A3B3QX41_BAD-01       SEEG--GGVCPGD----GTPFRGRSR-----------------------S
A0A2I3TBK7_BAD-01       KLQL--DASLPVL----VGSELGQG-------------------------
A0A2I2Z8C7_BAD-03       KLQL--DASLPVL----VGSELGQG-------------------------
A8MXU7_BAD-03           KLQL--DASLPVL----VGSELGQG-------------------------
A0A2K5M0A7_BAD-02       KLQL--DASLPVL----VGSELGQG-------------------------
A0A2K5XJR2_BAD-02       KLQL--DASLPVL----VGSELGQG-------------------------
A0A2K5VCA9_BAD-02       KLQL--DASLPVL----VGSELGQG-------------------------
A0A2K6E7I4_BAD-02       KLQL--DASLPVL----VGSELGQG-------------------------
A0A2K5HKU7_BAD-02       RMLT--EASAGMS----APATDSEAQ-----------------------H
A0A2K6N196_BAD-02       RMLA--EASAGMS----APATDSEAQ-----------------------L
A0A2K6PUL3_BAD-02       RMLA--EASAGMS----APATDSEAQ-----------------------L
A0A2K5M0A7_BAD-03       RMLA--EASARMS----APATDSEAQ-----------------------H
A0A2K5VCA9_BAD-03       RMLA--EASARMS----APATDSEAQ-----------------------H
A0A096MLD5_BAD-02       RMLA--EASAPMS----APATDSEAQ-----------------------H
A0A2K6E7I4_BAD-03       RMLA--EASARMS----APATDSEAQ-----------------------H
A8MXU7_BAD-04           GMLA--EASAGMS----APAADSEAQ-----------------------H
A0A2I3TBK7_BAD-03       GMLA--EASAGMS----APAADSEAQ-----------------------H
A0A2R8Z688_BAD-03       GMLA--EASAGMS----APAADSEAQ-----------------------H
A0A2K5E6A6_BAD-03       RMLS--KASAGMS----APATDS---------------------------
A0A2K5PDB1_BAD-03       RMLS--KTSAGMS----SPATDSEAQ-----------------------H
A0A2K6TG62_BAD-03       KMLS--KASAGMS----APATDSEAQ-----------------------H
G3VRY3_BAD-01           AEAE--QSEGEEE----RGLFRGRSS-----------------------S
G3VRY3_BAD-02           AEAE--QSEGEEE----RGLFRGRSS-----------------------S
G1P8C5_BAD-01           TEED--DDTEEGE----PSPFRGRSR-----------------------S
A0A452ER54_BAD-02       PEDD--EGTEEED----LGPFRGRSR-----------------------S
W5P8G9_BAD-01           PEDD--EGTEEED----LGPFRGRSR-----------------------S
G3TP47_BAD-01           SDEA--EGLEEDP-----SPFRGRSL-----------------------S
A0A1U7Q4V0_BAD-01       NEED--EGMEEEL-----SPFRGRSR-----------------------S
Q61337_BAD-01           TEED--EGMEEEL-----SPFRGRSR-----------------------S
A0A287CT05_BAD-02       TDLD--EGMEEEP-----SPFRGRSR-----------------------S
A0A287CT05_BAD-01       TDLD--EGMEEEP-----SPFRGRSR-----------------------S
O35147_BAD-01           TEED--EGMEEEL-----SPFRGRSR-----------------------S
A0A091DDU4_BAD-01       TEEE--EGMEEEP-----SPFRGRSR-----------------------S
A0A287AEF3_BAD-01       TEED--EGTEDEE----LSPFRGRSL-----------------------S
G1MI17_BAD-01           TEED--EGLEEEE----LSPFRGRSS-----------------------S
M3YNE7_BAD-01           TEED--EGMEEEE----LSPFRGRSR-----------------------S
A0A452RJM6_BAD-01       TEED--EGLEEEE----LSPFRGRSS-----------------------S
A0A384DJL2_BAD-01       TEED--EGLEEEE----LSPFRGRSS-----------------------S
A0A452ER54_BAD-01       PEDD--EGTEEED----LGPFRGRSR-----------------------S
F1MUT9_BAD-01           PEDN--EETEEED----LGPFRGRSR-----------------------S
Q3SYZ0_BAD-01           PEDN--EETEEED----LGPFRGRSR-----------------------S
F7DN67_BAD-01           TEDE--GMEGEEP-----GPFRGRSR-----------------------S
F1PK10_BAD-01           TDED--EGMEEEE----LSPFRGRSS-----------------------S
Q45KI9_BAD-01           TDED--EGMEEEE----LSPFRGRSS-----------------------S
H0WVR2_BAD-01           TEED--EGI-EEP-----SPFRGRSR-----------------------S
A0A2K6GWV0_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
H0V608_BAD-01           TEEE--EGMEEEL-----SPFRGRSR-----------------------S
A0A1S3FL84_BAD-01       MEED--EGLEEEP-----SPFRGRSR-----------------------S
A0A2K5PDB1_BAD-01       TEED--EGMEEEP-----STFRGRSR-----------------------S
A0A2K5E6A6_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
A0A2K6TG62_BAD-01       TEGD--EGMEEEP-----SPFRGRSR-----------------------S
A0A0D9R491_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
A0A2K5HKU7_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
A0A2K5XJR2_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
A0A2K6N196_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
A0A2K6PUL3_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
B4DZQ9_BAD-01           TEDD--EGMGEEP-----SPFRGRSR-----------------------S
A0A096MLD5_BAD-01       TEED--EGMEEEP-----SPFRGRSR-----------------------S
A0A2I2Z8C7_BAD-01       TEDD--EGMGEEP-----SPFRGRSR-----------------------S
A0A2I2Z8C7_BAD-02       TEDD--EGMGEEP-----SPFRGRSR-----------------------S
A0A2R8Z688_BAD-01       TEDD--EGMGEEP-----SPFRGRSR-----------------------S
A0A2J8TYJ3_BAD-01       TEDD--EGMGEEP-----SPFRGRSR-----------------------S
A0A3B4DUY7_BAD-01       GLLA--EDGGAGD----GAPFRGRSQ-----------------------S
E7FBJ6_BAD-01           ETQD----GASVEENGDGLPFRGRSQ-----------------------S
B5XEF1_BAD-01           EFQD--VMTPTEEGGGDGASFRGRSQ-----------------------S
A0A3Q3FKT9_BAD-01       RGEE--EAGTPTE----GAPFRGRSK-----------------------S
A0A3P9A5G8_BAD-01       AMTPTEESGGD------AAPFRGRSQ-----------------------S
A0A3P9A5G8_BAD-02       AMTPTEESGGD------AAPFRGRSQ-----------------------S
B5X1T1_BAD-01           VMTPTEEGGGD------GAPFRSRSQ-----------------------S
A0A3Q2QC80_BAD-01       RAEE--EAGTPTE----GLPFRNRSN-----------------------S
A0A3Q3FKT9_BAD-03       RGEE--EAGTPTE----GAPFRGRSK-----------------------S
H3D8J8_BAD-01           NGDD--EAGTPTD----GAPFRGRSR-----------------------S
A0A3B5L9R9_BAD-01       RGEE--EVGTPTE----GFPFRGRSL-----------------------S
A0A3P9B2E4_BAD-01       RGED--EVCTPTE----GDPFRRRSK-----------------------S
I3K7B6_BAD-01           RGED--EVCTPTE----GDPFRRRSK-----------------------S
A0A3Q3C680_BAD-01       RGED--EVCTPTE----GDPFRRRSK-----------------------S
A0A3P8QRJ7_BAD-01       RGED--EVCTPTE----GDPFRRRSK-----------------------S
A0A3Q4GGN3_BAD-01       RGED--EVCTPTE----GDPFRRRSK-----------------------S
A0A3B4GXJ6_BAD-01       RGED--EVCTPTE----GDPFRRRSK-----------------------S
A0A3Q0QNQ2_BAD-01       RGED--EICTPTE----GDPFRRRSK-----------------------S
A0A3P8WI83_BAD-02       WGEE--EAGTPTE----GAPFRGRSR-----------------------S
A0A3P8WI83_BAD-01       WGEE--EAGTPTE----GAPFRGRSR-----------------------S
A0A3Q2D5S0_BAD-01       RGEE--EVGTPTE----GYPFRGRSN-----------------------S
A0A3P9HNZ2_BAD-01       --ED--EAGTPTD----GLAFRGRSK-----------------------S
A0A3B3BQF7_BAD-01       --ED--EAGTPTD----GLAFRGRSK-----------------------S
A0A3Q1K1C7_BAD-02       KADE--EAGTPTD----GAPFRARSK-----------------------S
A0A3Q1K1C7_BAD-01       KADE--EAGTPTD----GAPFRARSK-----------------------S
A0A3Q1GWH9_BAD-01       KGEE--EAGTPTE----GAPFRARSK-----------------------S
A0A3Q1CPU7_BAD-01       RGEE--EAGTPTD----GAPFRARSK-----------------------S
A0A3P8TWH6_BAD-01       RGEE--EAGTPTD----GAPFRARSK-----------------------S
A0A2U9BAC9_BAD-01       RWDE--EAGTPTD----GAPFRGRSK-----------------------S
A0A3B4VFC5_BAD-01       RGEE--EAGTPTE----GAPFRGRSK-----------------------S
A0A3B4W9T1_BAD-01       RGEE--EAGTPTE----GAPFRGRSK-----------------------S
Q4V925_BAD-03           NEEDLLETGVAEDPHMLGDPFRPRSR-----------------------S
Q4V925_BAD-02           NEEDLLETGVAEDPHMLGDPFRPRSR-----------------------S
A7MCM4_BAD-01           NEEDLLETGVAEDPHMLGDPFRPRSR-----------------------S
Q4V925_BAD-01           NEEDLLETGVAEDPHMLGDPFRPRSR-----------------------S
Q4V925_BAD-04           NEEDLLETGVAEDPHMLGDPFRPRSR-----------------------S
A0A3P8Y761_BAD-01       LGQG--LNCVATE----GLPFRVRSQ-----------------------S
A0A3B5Q2N7_BAD-01       RGEE--EVGTPTE----GFPFRGRSL-----------------------S
A0A087X8P8_BAD-01       RGEE--EVGTPTE----GFPFRGRSN-----------------------S
A0A3B3UA11_BAD-01       RGEE--EVGTPTE----GFPFRGRSN-----------------------S
A0A3B3YFR1_BAD-01       RGEE--EVGTPTE----GFPFRGRSN-----------------------S
A0A3P9Q7C3_BAD-01       RGEE--EVGTPTE----GFPFRVRSN-----------------------S
A0A3B3HDU2_BAD-01       ARED--EAGTPTD----GLAFRGRSK-----------------------S
A0A3P9KSL7_BAD-01       ARED--EAGTPTD----GLAFRGRSK-----------------------S
A0A3P9KSL7_BAD-02       ARED--EAGTPTD----GLAFRGRSK-----------------------S
A0A3B5BAL2_BAD-01       RGEE--EAGTPTD----GAPFRGRSK-----------------------S
A0A3Q3AEL8_BAD-01       RADD--EPGTPTE----GYPFRGRSK-----------------------S
A0A3Q3AEL8_BAD-02       RADD--EPGTPTE----GYPFRGRSK-----------------------S
G3Q8B3_BAD-01           LWLD--ETGTPTE----GAPFRVRSK-----------------------S
A0A3Q2Y0E4_BAD-01       RVDE--EVGTPTD----GAPFRGRSK-----------------------S
A0A3Q3R5S3_BAD-01       KSDE--EAGTPTD----GAPFRGRSK-----------------------S
A0A3Q3RXS8_BAD-01       RVDE--EAGTPTD----GAPFRGRSK-----------------------S
A0A3Q3RXS8_BAD-02       RVDE--EAGTPTD----GAPFRGRSK-----------------------S
A0A3Q0QNQ2_BAD-02       RGED--EICTPTE----GDPFRRRSK-----------------------S
A0A3Q3WTY4_BAD-01       KGED--EAGTPTD----GAPFRGRSK-----------------------S
A0A493SWX7_PMAIP1-      -------------------------------------------------P
A0A2I3HX97_PMAIP1-      -------------------------------------------------N
A0A452TE71_PMAIP1-      -------------------------------------------------P
A0A452J430_PMAIP1-      -------------------------------------------------G
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      -------------------------------------------------N
G1P8F9_PMAIP1-01        -------------------------------------------------N
Q9JM54_PMAIP1-03        -------------------------------------------------M
A0A3Q2I0H2_PMAIP1-      -------------------------------------------------S
G3T0P7_PMAIP1-01        -------------------------------------------------S
Q1PCT2_PMAIP1-01        -------------------------------------------------S
G1LIZ7_PMAIP1-01        -------------------------------------------------S
A0A452STA4_PMAIP1-      -------------------------------------------------S
A0A2K5NJZ2_PMAIP1-      -------------------------------------------------N
A0A0D9S003_PMAIP1-      -------------------------------------------------N
A0A2K5VPX2_PMAIP1-      -------------------------------------------------N
A0A2K6BV43_PMAIP1-      -------------------------------------------------N
A0A2K5ZWH1_PMAIP1-      -------------------------------------------------N
A0A096MPU8_PMAIP1-      -------------------------------------------------N
A0A2K5JY17_PMAIP1-      -------------------------------------------------N
A0A2K6KJF1_PMAIP1-      -------------------------------------------------N
A0A2K6NC45_PMAIP1-      -------------------------------------------------N
A0A2K6S6C4_PMAIP1-      -------------------------------------------------S
A0A2I2YVQ5_PMAIP1-      -------------------------------------------------N
A0A2R9AKC9_PMAIP1-      -------------------------------------------------N
A0A2I3SX38_PMAIP1-      -------------------------------------------------N
H2NWG2_PMAIP1-01        -------------------------------------------------N
A0A2K5CFK7_PMAIP1-      -------------------------------------------------S
F7GW45_PMAIP1-01        -------------------------------------------------S
A0A2K5QQC6_PMAIP1-      -------------------------------------------------S
A0A337SUX1_PMAIP1-      -------------------------------------------------S
A0A3Q1NFP6_PMAIP1-      -------------------------------------------------S
A0A452EST2_PMAIP1-      -------------------------------------------------S
W5P738_PMAIP1-01        -------------------------------------------------S
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
                                                                          

G1MV54_BCL2L11-01       SLAEEIQPEIWIAQE--------LR------------------------R
G1PDJ5_BCL2L11-01       ALPVDMRPEMWIAQE--------LR------------------------R
A9XRH0_BMF-01           -GQREARTEVQIARK--------LQ------------------------C
Q6P7C5_BAD-01           PSLTEDQPGPYLAPG--------LL------------------------G
A3KND0_BMF-01           CGVSETPQRLFYGKE--------AL------------------------S
A0A2K6KS56_BBC3-02      AGRR--RSGPGIGAQ--------LR------------------------R
Q2PG01_BAD-01           -----LWAAQRYGRE--------LR------------------------R
A0A2I3H4B2_BAD-01       -----LWAAQRYGRE--------LR------------------------R
F7G1G0_HRK-01           LEQRAAAAAQLTAAR--------LK------------------------A
A0A1U7R468_HRK-01       PGLR-WAAAQVTALR--------LQ------------------------A
P62816_HRK-03           PGLR-WAAAQVTALR--------LQ------------------------A
P62817_HRK-01           PGLR-WAAAQVTALR--------LQ------------------------A
A0A2K5KZ69_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
H2NIS8_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
H2Q6Y8_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
G3UH24_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
A0A2K5BYA0_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
U3E722_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
A0A452DXE5_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
A0A0D9SC73_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
A0A3Q2IBL3_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
A0A337SQ56_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
G3QTJ6_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
A0A2K6AYL7_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
G1QHD8_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
G1T7W1_HRK-01           LGLR-SAAAQLTAAR--------LK------------------------A
H0Y001_HRK-01           LGLR-SSAAQLTAAR--------LK------------------------A
A0A096N944_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
A0A2K6GL98_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
A0A2K5PIE7_HRK-01       LGLR-SSAAQLTAAR--------LK------------------------A
I3LVX0_BIK-01           ACRELLPVLLLLGLLLSRALYLRLQ-------------------------
A0A286XF37_PMAIP1-      PARARAELEVECAAQ--------LR------------------------R
A0A1U7QLK6_PMAIP1-      PTRVPTDVEDECVHQ--------LR------------------------R
Q9JM54_PMAIP1-01        PTRVPADLKDEC-AQ--------LR------------------------R
Q5U777_PMAIP1-01        PTRVPADLKDEC-DQ--------LR------------------------R
A0A3Q2LHE3_BIK-02       ESSPDSDNRDSVAMR--------LA------------------------F
F7FUT7_BIK-02           DPLECMENSDALALQ--------LA------------------------C
F7FUT7_BIK-01           DPLECMENSDALALQ--------LA------------------------C
O61667_EGL1-01          DDSEISSIGYEIGSK--------LA------------------------A
A0A3G3M2M0_BCL2L11      APVGAMGPEISVARE--------LR------------------------R
A0A3Q1ELG4_BCL2L11      SPSGQV-----IRHA--------LE------------------------R
A0A3Q1CI15_BCL2L11      SPSGQV-----IKHA--------LE------------------------R
F1SMU1_PMAIP1-01        RNTQTNPTRVALPPDPEVECAIQFR------------------------R
Q9BXH1_BBC3-04          PPDTLASAGDFLCTM-----------------------------------
A0A3B4UNJ0_BMF-01       EEQAGVSVEAQIGRK--------LR------------------------E
B2KKY9_BCL2L11-01       APVAALPPEMVVARE--------LR------------------------R
B8JK68_BCL2L11-01       APVAALPPEMVVARE--------LR------------------------R
A0A3B4B6Y3_BMF-01       HPVAVRSMEACIGHK--------LQ------------------------L
A0A3P9ICE1_BMF-01       QQPVARSTEACIAQK--------LQ------------------------L
Q0GKC7_BMF-01           EPRPAQSVETLIGQK--------LQ------------------------L
A0A3B3RH63_BMF-01       DDRPQPSAEVRIGQK--------LQ------------------------M
W5N4P7_BMF-01           EEQPVRSAEVRIGQK--------LQ------------------------R
A0A3B1K1X5_BMF-01       RRP-AHSVEARIGQK--------LQ------------------------M
A0A3B4CNJ8_BMF-01       RRP-PHSVEARIGQK--------LQ------------------------M
A0A2U9CJH3_BMF-01       QQPVAHSVEACIGQK--------LQ------------------------L
A0A3Q2YCX7_BMF-01       QQPVARSIEACVGQK--------LQ------------------------L
A0A3Q2YCX7_BMF-02       QQPVARSIEACVGQK--------LQ------------------------L
A0A3P8ZIE7_BMF-01       QQLPQQPVARCIGQK--------LQ------------------------L
A0A3Q2PJX9_BMF-02       HQPAALSLEACIGQK--------LQ------------------------L
A0A3Q3QZ16_BMF-01       QQRVARSVEACIGQK--------LQ------------------------L
A0A3Q3QZ16_BMF-02       QQRVARSVEACIGQK--------LQ------------------------L
A0A3Q2PJX9_BMF-01       HQPAALSLEACIGQK--------LQ------------------------L
A0A3Q2PJX9_BMF-03       HQPAALSLEACIGQK--------LQ------------------------L
A0A3B5QK08_BMF-01       HQPAALSLEASIGQK--------LQ------------------------L
A0A3B5QK08_BMF-02       HQPAALSLEASIGQK--------LQ------------------------L
A0A096LRV0_BMF-01       HQPAALSLEACIGQK--------LQ------------------------L
A0A3B3WU80_BMF-01       HQPAALSLEACIGQK--------LQ------------------------L
A0A3P9Q8E2_BMF-01       HQPAALSLEACIGQK--------LQ------------------------L
A0A3Q2CXC4_BMF-02       QQPAALSLEACIGQK--------LQ------------------------I
A0A3Q2CXC4_BMF-01       QQPAALSLEACIGQK--------LQ------------------------I
A0A3Q3GUU5_BMF-01       QQPVAHSVEASIGLK--------LQ------------------------L
A0A3B5B8F6_BMF-01       QQPVARSVEACIGQK--------LQ------------------------L
A0A3Q3VLX6_BMF-01       QQPVAHSVEACIGQK--------LQ------------------------L
A0A3P8UA78_BMF-02       QQPVQRSVEVRIGQK--------LQ------------------------L
A0A3P8UA78_BMF-01       QQPVQRSVEVRIGQK--------LQ------------------------L
A0A3P8UA78_BMF-03       QQPVQRSVEVRIGQK--------LQ------------------------L
A0A3B3CGR9_BMF-01       QQPAARSTEACIAQK--------LQ------------------------L
A0A3P9K487_BMF-02       QQPVARSTEACIAQK--------LQ------------------------L
A0A3P9K487_BMF-01       QQPVARSTEACIAQK--------LQ------------------------L
A0A3B3HAU1_BMF-03       QQPVARSTEACIAQK--------LQ------------------------L
A0A3B3HAU1_BMF-02       QQPVARSTEACIAQK--------LQ------------------------L
A0A3B3HAU1_BMF-01       QQPVARSTEACIAQK--------LQ------------------------L
A0A3B3HAU1_BMF-04       QQPVARSTEACIAQK--------LQ------------------------L
A0A3P9ICE1_BMF-04       QQPVARSTEACIAQK--------LQ------------------------L
A0A3Q2ZA20_BMF-01       QLPVARSLEVCIGQK--------LQ------------------------L
A0A3P8NFE2_BMF-02       QRPAARSVEACIGQK--------LQ------------------------L
I3K2D6_BMF-01           QRPAARSVEACIGQK--------LQ------------------------L
A0A3P8NFE2_BMF-01       QRPAARSVEACIGQK--------LQ------------------------L
A0A3Q3C5V2_BMF-01       QRPAARSVEACIGQK--------LQ------------------------L
A0A3P9DPJ5_BMF-01       QRPAARSVEACIGQK--------LQ------------------------L
A0A3P9DPJ5_BMF-02       QRPAARSVEACIGQK--------LQ------------------------L
A0A3B4ETH0_BMF-01       QRPAARSVEACIGQK--------LQ------------------------L
A0A3Q4G1I4_BMF-01       QRPAARSVEACIGQK--------LQ------------------------L
A0A3Q1FVH7_BMF-02       QQPMAHSVEACIGQK--------LQ------------------------L
A0A3Q1FVH7_BMF-01       QQPMAHSVEACIGQK--------LQ------------------------L
A0A3Q3RVI2_BMF-01       QQPLVHSVEACIGQK--------LQ------------------------L
A0A3Q1D1K3_BMF-01       QQPVARSMEACIGQK--------LQ------------------------L
A0A3P8RKY9_BMF-01       QQPVARSMEACIGQK--------LQ------------------------L
A0A3Q3RVI2_BMF-02       QQPLVHSVEACIGQK--------LQ------------------------L
A0A3Q1IPR4_BMF-01       QQPLMQSVEACIGQK--------LQ------------------------L
A0A3B4U5H8_BMF-01       QQPVARSVEACIGQK--------LQ------------------------L
A0A3B4WM88_BMF-01       QQPVARSVEACIGQK--------LQ------------------------L
A0A3Q3SYA1_BCL2L11      AG---------------------AH------------------------R
R4G9R5_BCL2L11-01       PIPEDMQPEIWIAQE--------LR------------------------R
A0A3B3QC78_BCL2L11      SMLPDMRPEMLVARE--------LR------------------------R
F7CXT2_BCL2L11-01       SIPADMRPEIWIAQE--------LR------------------------R
F7FTC8_BCL2L11-01       SVPEDMRPEIWIAQE--------LR------------------------R
A0A2R8M6L7_BCL2L11      AEPAGMRPEIWIAQE--------LR------------------------R
G3SU55_BCL2L11-01       ALPADLRPEIWIARE--------LR------------------------R
G3W979_BCL2L11-01       SIPADMRPEIWIAQE--------LR------------------------R
U3IW89_BCL2L11-01       SLAEEIQPEIWIAQE--------LR------------------------R
A0A3Q2U844_BCL2L11      SLAEEIQPEIWIAQE--------LR------------------------R
C1C3S9_BAD-01           TV---------------------SK------------------------S
A0A3P8XIA2_BCL2L11      --PGDMRPEILIGQE--------LQ------------------------R
A0A452IFQ4_BAD-01       DA---------------------LP------------------------R
K7GA86_BCL2L11-01       SIREDMQPEIWIAQE--------LR------------------------R
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      AEPAGMRPEIWIAQE--------LR------------------------R
M3YDI3_BCL2L11-01       AVPADMRPEMWIAQE--------LR------------------------R
F7CXT2_BCL2L11-02       SIPADMRPEIWIAQE--------LR------------------------R
G1SSY0_BCL2L11-01       TKPAYGCLHSCVCGVHVTCILLFLK------------------------G
J9NWV6_BCL2L11-06       AVPADMRPEIWIAQE--------LR------------------------R
C1KGB8_BCL2L11-01       AEPADMRPEIWIAQE--------LR------------------------R
A0A3Q2GRS5_BCL2L11      AVPADMRPEVWIAQE--------LR------------------------R
U6CTE3_BCL2L11-04       AVPADMRPEMWIAQE--------LR------------------------R
A0A1U7T0R1_BCL2L11      AEPPDMRPEIWIAQE--------LR------------------------R
J9NWV6_BCL2L11-02       FE------------------------------------------------
A0A2K6TRU4_BCL2L11      WD------------------------------------------------
A0A2K5NU92_BCL2L11      FE------------------------------------------------
A0A2I2YQ13_BCL2L11      FE------------------------------------------------
A0A2K5X1Y3_BCL2L11      FE------------------------------------------------
A0A2K6QIL2_BCL2L11      FE------------------------------------------------
A0A2K5HZI5_BCL2L11      WD------------------------------------------------
A0A2I3GVB2_BCL2L11      WD------------------------------------------------
A0A2R9C366_BCL2L11      WD------------------------------------------------
A0A2I3SN61_BCL2L11      WD------------------------------------------------
A0A2K5HZI5_BCL2L11      FE------------------------------------------------
A0A2I2YQ13_BCL2L11      VV------------------------------------------------
A0A2K6QIL2_BCL2L11      VV------------------------------------------------
A0A2K5Q1Y0_BCL2L11      VV------------------------------------------------
A0A2K6GE31_BCL2L11      VV------------------------------------------------
A0A1U7T0R1_BCL2L11      FE------------------------------------------------
A0A1U7T0R1_BCL2L11      VV------------------------------------------------
O54918_BCL2L11-01       EEPEDLRPEIRIAQE--------LR------------------------R
O88498_BCL2L11-01       EEPEDLRPEIRIAQE--------LR------------------------R
A0A2K5Z7V3_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A096NYC3_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A2K5X1Y3_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A2K6E212_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A2K5NU92_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A096NYC3_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A2K6KJP8_BCL2L11      AEPADMRPEIRIAQE--------LR------------------------R
A0A2I3SN61_BCL2L11      AEPADMRPEIWIAQE--------LR------------------------R
A0A2R8M6L7_BCL2L11      AEPAGMRPEIWIAQE--------LR------------------------R
A0A2K5CA89_BCL2L11      AEPAGMRPEIWIAQE--------LR------------------------R
A0A2K5Q1Y0_BCL2L11      AEPAGMRPEIWIAQE--------LR------------------------R
A0A1U7T0R1_BCL2L11      AEPPDMRPEIWIAQE--------LR------------------------R
A0A1U7T0R1_BCL2L11      AEPPDMRPEIWIAQE--------LR------------------------R
A0A3Q2GRS5_BCL2L11      AVPADMRPEVWIAQE--------LR------------------------R
J9NWV6_BCL2L11-04       AVPADMRPEIWIAQE--------LR------------------------R
U6CTE3_BCL2L11-02       AVPADMRPEMWIAQE--------LR------------------------R
A0A1U8BW10_BCL2L11      EEPADIRPEIWIAQE--------LR------------------------R
A0A1U7T0R1_BCL2L11      AEPPDMRPEIWIAQE--------LR------------------------R
A0A2K6GE31_BCL2L11      AEPADMRPEIWIAQE--------LR------------------------R
A0A287DFJ0_BCL2L11      AEPADMRPEIWIAQE--------LR------------------------R
A0A452FCR6_BCL2L11      AVPADTRPEIWIAQE--------LR------------------------R
W5PY58_BCL2L11-01       AVPADTRPEIWIAQE--------LR------------------------R
L8IVA4_BCL2L11-02       AVPADTRPEIWIAQE--------LR------------------------R
A0A286XJN2_BCL2L11      AGPPHLRPEIWIAQE--------LR------------------------R
A0A286XJN2_BCL2L11      AGPPHLRPEIWIAQE--------LR------------------------R
G1SSY0_BCL2L11-02       AEPADTRPETWIAQE--------LR------------------------R
A0A250YBV9_BCL2L11      VEPMDMRPEIWIAQE--------LR------------------------R
H0XW23_BCL2L11-01       AEPADLRPEMWIAQE--------LR------------------------R
A0A1S3FFM9_BCL2L11      EEPADLRPEIWIAQE--------LR------------------------R
U6CTE3_BCL2L11-01       AVPADMRPEMWIAQE--------LR------------------------R
G1LDR8_BCL2L11-01       AVPADMRPEIWIAQE--------LR------------------------R
J9NWV6_BCL2L11-03       AVPADMRPEIWIAQE--------LR------------------------R
A0A2I2UX96_BCL2L11      AVPADMRPEIWIAQE--------LR------------------------R
O54918_BCL2L11-03       Q-------VAQNIHG--------DA------------------------W
A0A1U8BW10_BCL2L11      K-------HEWQIHG--------DQ------------------------S
J9NWV6_BCL2L11-05       A-------IEEGVV------------------------------------
A0A3Q2GRS5_BCL2L11      A-------IEEVVV------------------------------------
A0A452U4S4_BCL2L11      R-------HLETAL------------------------------------
A0A2R9C366_BCL2L11      LRIALHREVQWPLKW--------LA------------------------K
A0A2I3GVB2_BCL2L11      L------EVQWPFEW--------LA------------------------K
A0A2K6TRU4_BCL2L11      L--ALRREVQCPLEW--------LA------------------------K
A0A0D9RWE0_BCL2L11      --PADMRPEIRIAQE--------LR------------------------R
U6CTE3_BCL2L11-03       AVPADMRPEMWIAQE--------LR------------------------R
A0A2K6E212_BCL2L11      --PADMRPEIRIAQE--------LR------------------------R
H2P5E2_BCL2L11-01       --PADMRPEIWIAQE--------LR------------------------R
A0A250YBV9_BCL2L11      VEPMDMRPEIWIAQE--------LR------------------------R
A0A286XJN2_BCL2L11      AGPPHLRPEIWIAQE--------LR------------------------R
A0A2I2UX96_BCL2L11      AVPADMRPEIWIAQE--------LR------------------------R
A0A1S3FFM9_BCL2L11      EEPADLRPEIWIAQE--------LR------------------------R
A0A452SBG5_BCL2L11      DVPADMRPEIWIAQE--------LR------------------------R
A0A3Q1MV27_BCL2L11      AVPADTRPEIWIAQE--------LR------------------------R
A0A1U8BW10_BCL2L11      EEPADIRPEIWIAQE--------LR------------------------R
A0A287DFJ0_BCL2L11      AEPADMRPEIWIAQE--------LR------------------------R
L8IVA4_BCL2L11-01       AVPADTRPEIWIAQE--------LR------------------------R
A0A3Q1MV27_BCL2L11      AVPADTRPEIWIAQE--------LR------------------------R
A0A452FCR6_BCL2L11      AVPADTRPEIWIAQE--------LR------------------------R
A0A2K5CA89_BCL2L11      GDISLWFRFIFTFFD--------LY------------------------G
A0A2K5Z7V3_BCL2L11      GDSSL-FGFIFTGLD--------LY------------------------G
A0A2K6KJP8_BCL2L11      GDTSLWFGFIFTGLD--------LY------------------------V
A0A3P8RLE2_BCL2L11      ATQTPSPSGQVIKHA--------LE------------------------R
A0A3B1JLM2_BAD-01       APAALWKAKKY-GRQ--------LR------------------------R
Q61337_BAD-05           APPNLWAAQRY-GRE--------LR------------------------R
A0A3B1JXK6_BCL2L11      AAAGDMQAHWYIAQE--------LR------------------------R
A0A3B4BVX1_BCL2L11      APAGDMRPESYVAQE--------LR------------------------R
A0A2I3HWI8_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
A0A3Q2GWE8_BBC3-02      EQW-----AREIGAQ--------LR------------------------R
A0A2K6STD6_BBC3-02      EQW-----AREIGAQ--------LR------------------------R
A0A2R8MW85_BBC3-02      EQW-----AREIGAQ--------LR------------------------R
A0A2K5QNS7_BBC3-02      EQW-----AREIGAQ--------LQ------------------------R
A0A2K6FQZ1_BBC3-04      EQW-----AREIGAQ--------LR------------------------R
A0A2R9BZA9_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
A0A2I3RGH5_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
A0A2K5P2T8_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
A0A2K5V8J3_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
A0A2K6ASP2_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
A0A2I3N2Z9_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
A0A2K6QZT2_BBC3-04      EQW-----AREIGAQ--------LR------------------------R
F7GL32_BBC3-02          EQQ-----DREIGAQ--------LR------------------------R
F7GL32_BBC3-01          EQQ-----DREIGAQ--------LR------------------------R
J9NTK9_BBC3-01          EQW-----AREIGAQ--------LR------------------------R
F1RM01_BBC3-04          EQW-----AREIGAQ--------LR------------------------R
G3T2N1_BBC3-01          EQW-----AREIGAQ--------FR------------------------R
A0A250YBU3_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
M3Y0R3_BBC3-01          EQW-----AREIGAQ--------LR------------------------R
A0A1U7R5N5_BBC3-01      EEW-----AREIGAQ--------LR------------------------R
Q99ML1_BBC3-02          EEW-----AREIGAQ--------LR------------------------R
Q80ZG6_BBC3-01          EEW-----AREIGAQ--------LR------------------------R
H0XQ00_BBC3-01          EQW-----AREIGAQ--------LR------------------------R
A0A0D9S2H2_BBC3-01      EQW-----AQEIGAQ--------LR------------------------R
B4DQK3_BBC3-01          EQW-----AREIGAQ--------LR------------------------R
A0A250YBU3_BBC3-02      EQW-----AREIGAQ--------LR------------------------R
A0A3Q1LXZ6_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
A0A452E3G1_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
F1RM01_BBC3-03          EQW-----AREIGAQ--------LR------------------------R
A0A2I3RGH5_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
H2NZD3_BBC3-01          EQW-----AREIGAQ--------LR------------------------R
A0A2K6QZT2_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
A0A2K6FQZ1_BBC3-01      EQW-----AREIGAQ--------LR------------------------R
A0A337SAW2_BAD-01       LWA-----ALRYGRE--------LR------------------------R
A0A2R8MW85_BBC3-03      EQW-----AREIGAQ--------LR------------------------R
C1KGB6_BCL2L11-02       MRP-----EIWIAQE--------LR------------------------R
C1KGB6_BCL2L11-03       MRP-----EIWIAQE--------LR------------------------R
C1KGB6_BCL2L11-01       MRP-----EIWIAQE--------LR------------------------R
J9NWV6_BCL2L11-01       MRP-----EIWIAQE--------LR------------------------R
A0A3Q2GRS5_BCL2L11      MRP-----EVWIAQE--------LR------------------------R
A0A3Q2GRS5_BCL2L11      MRP-----EVWIAQE--------LR------------------------R
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A493T7X1_BMF-01       EQE-PHWAEVSFTHL--------FQATSSLQGALNKHWFGGETCTPPAGC
A0A452H3N6_BMF-01       GQRE-ALAEVQIARK--------LQ------------------------C
A0A287AIU8_BMF-02       GQWQ-HRAEVQIARK--------LQ------------------------C
G1PAU1_BMF-01           GQWQHHRAEIQIARK--------LQ------------------------S
A0A287AIU8_BMF-01       GQWQ-HRAEVQIARK--------LQ------------------------C
A0A1U8CPE0_BMF-02       GQWQ-HRAEVQIARK--------LQ------------------------C
A0A286XXB0_BMF-03       GQWQ-HRAEVQIARK--------LQ------------------------C
A0A287CXH0_BMF-02       GQWQ-HRAEVQIARK--------LQ------------------------C
A0A1S3EQA2_BMF-02       G----HRVEVQIARK--------LQ------------------------C
A2AV74_BMF-02           GQFLQHRAEVQIARK--------LQ------------------------C
H9GL49_BMF-01           SPQ-ELRTEVQIARK--------LQ------------------------C
A0A3Q2UCA0_BMF-02       GQR-EARTEVQIARK--------LQ------------------------C
A0A3Q2UCA0_BMF-01       GQR-EARTEVQIARK--------LQ------------------------C
K7FRX2_BMF-01           GHQ-EARAEVQIARK--------LQ------------------------C
U3JS06_BMF-01           GQR-EARAEVQIARK--------LQ------------------------C
A0A493T7X1_BMF-02       GQQ-EARAEVQIARK--------LQ------------------------C
A0A3Q2UCA0_BMF-03       GQR-EARTEVQIARK--------LQ------------------------C
A0A3Q2UCA0_BMF-04       GQR-EARTEVQIARK--------LQ------------------------C
G1NHG8_BMF-01           GQR-EARTEVQIARK--------LQ------------------------C
A0A337ST43_BMF-02       PGF-ECRREQEWGRS--------QV------------------------R
A0A2K5KGP2_BMF-01       PCF-EWRREQERGGP--------QV------------------------R
A0A2K6FFN3_BMF-02       PCF-ERRREQERGRS--------Q--------------------------
A0A2K5E1Q4_BMF-02       PGF-EWRREQEWGRP--------E--------------------------
A0A2K5RN49_BMF-02       PGF-EWRREQEWGRP--------E--------------------------
A0A2K6TW78_BMF-03       PGF-EWRRKQEWGRS--------E--------------------------
A0A2K6RAW1_BMF-02       PCF-EWRRE-----------------------------------------
A0A2I2Z168_BMF-02       PCF-EWRREQERGRP-----------------------------------
A0A2R9BS98_BMF-02       PCF-EWRREQERGRP-----------------------------------
A0A2J8QDD5_BMF-01       PCF-EWRREQERGRP-----------------------------------
A0A2K5MJW4_BMF-01       PCF-EWRREQERGGP-----------------------------------
A0A2K5VLE9_BMF-01       PCF-EWRREQERGGP-----------------------------------
A0A2K6B5F6_BMF-03       PCF-EWRREQERGGP-----------------------------------
A0A2K5Z4A9_BMF-02       PCF-EWRREQERGGP-----------------------------------
A0A096NTE9_BMF-03       PCF-EWRREQERGGP-----------------------------------
A0A2I3HD83_BMF-01       PCF-EWRREQEWGRP-----------------------------------
A0A1S3EQA2_BMF-01       G----HRVEVQIARK--------LQ------------------------C
Q8K589_BMF-01           GQFLQHRAEVQIARK--------LQ------------------------C
A0A337ST43_BMF-05       GHW-QHRAEVQIARK--------LQ------------------------C
A0A337ST43_BMF-04       GHW-QHRAEVQIARK--------LQ------------------------C
A2AV74_BMF-01           GQFLQHRAEVQIARK--------LQ------------------------C
A0A286XXB0_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
G3WDQ2_BMF-01           EQW-EHRAEVQIARK--------LQ------------------------C
G3T7Z4_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
A0A287CXH0_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A1S3WU31_BMF-01       GQW-QQRVEVQIARK--------LQ------------------------C
A0A337ST43_BMF-03       GHW-QHRAEVQIARK--------LQ------------------------C
A0A337ST43_BMF-01       GHW-QHRAEVQIARK--------LQ------------------------C
A0A1U8CPE0_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
G1SR62_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
M3YAD5_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
U6CSY8_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
A0A452SED0_BMF-01       GPW-QHRAEVQIARK--------LQ------------------------C
A0A384D070_BMF-01       GPW-QHRAEVQIARK--------LQ------------------------C
W5QFV1_BMF-01           GQW-QHRAEIQIARK--------LQ------------------------C
L8IXF5_BMF-01           GQW-QHRAEIQIARK--------LQ------------------------C
A0A452F2E0_BMF-01       GQW-QHRAEIQIARK--------LQ------------------------C
A0A452F2E0_BMF-02       GQW-QHRAEIQIARK--------LQ------------------------C
Q05KI3_BMF-02           GQW-QHRAEIQIARK--------LQ------------------------C
Q05KI3_BMF-01           GQW-QHRAEIQIARK--------LQ------------------------C
A0A2K6FFN3_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
H0WYH6_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
A0A096NTE9_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6L919_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K5E1Q4_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6TW78_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6TW78_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K5RN49_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2I2Z168_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2R9BS98_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2J8QDD5_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2J8T301_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
F7CM09_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K5MJW4_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K5KGP2_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K5VLE9_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
F7CM09_BMF-03           GQW-QHRAEVQIARK--------LQ------------------------C
F7CM09_BMF-02           GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6B5F6_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6B5F6_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6B5F6_BMF-04       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K5Z4A9_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6L919_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6L919_BMF-03       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2K6RAW1_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A0D9R4R5_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
J9PB65_BMF-04           GQW-QHRAEVQIARK--------LQ------------------------C
J9PB65_BMF-03           GQW-QHRAEVQIARK--------LQ------------------------C
J9PB65_BMF-02           GQW-QHRAEVQIARK--------LQ------------------------C
J9PB65_BMF-01           GQW-QHRAEVQIARK--------LQ------------------------C
A0A3Q2HR24_BMF-01       GQW-QHRAEVQIARK--------LQ------------------------C
A0A3Q2HR24_BMF-02       GQW-QHRAEVQIARK--------LQ------------------------C
A0A2I2YVQ5_PMAIP1-      AETSESDIQTLLLRN--------LT------------------------A
A0A2I3SX38_PMAIP1-      AETSESDIQTLLLRN--------LT------------------------A
A0A2K5JY17_PMAIP1-      AETSESDSQTLLLRN--------LT------------------------A
A0A2R9AKC9_PMAIP1-      AETSESDIQTLLLRN--------LT------------------------A
A0A2K6KJF1_PMAIP1-      AETFESDSQTLLLRN--------LT------------------------A
A0A2K6NC45_PMAIP1-      AETFESDSQTLLLRN--------LT------------------------A
A0A096MPU8_PMAIP1-      AETSESDSQTLLLRN--------LT------------------------A
A0A2K5ZWH1_PMAIP1-      AETSESDSQTLLLRN--------LT------------------------A
A0A2K5VPX2_PMAIP1-      AETSESDSQTLLLRN--------LT------------------------A
A0A2K6BV43_PMAIP1-      AETSESDSQTLLLRN--------LT------------------------A
W5QCU2_BIK-01           ISPYSDSPHYL-AMQ--------LA------------------------S
A0A3Q2LHE3_BIK-01       SSPDSDNRDSV-AMR--------LA------------------------F
A0A452QUG1_BIK-01       TGPLCNNPDDV-AMR--------LA------------------------F
A0A452V3L2_BIK-01       PSPNSNNPDDV-AMR--------LA------------------------F
A0A3B4CPH6_BAD-01       APPALWAAKKY-GRQ--------LR------------------------K
M3XHJ5_BCL2L11-01       GCYCIISPLSK-VIA--------LV------------------------R
G1TZR9_BIK-01           LMECLEGSNQV-ALR--------LA------------------------Y
A0A2K5QXZ1_BIK-01       PLECMENSDAL-ALQ--------LA------------------------C
O70337_BIK-04           ----MFTRNQV-ALR--------LA------------------------C
O70337_BIK-02           LMECVEGRNQV-ALR--------LA------------------------C
O70337_BIK-01           LMECVEGRNQV-ALR--------LA------------------------C
Q925D2_BIK-01           FMRCLESRNQV-ALR--------LA------------------------C
A0A1S3FUQ7_BIK-01       PMDCLEGSNQV-ALW--------LV------------------------C
H0XAE7_BIK-01           PMECLEDSDQV-ALR--------LA------------------------C
A0A2K6FM79_BIK-01       PSGCLEDSDEV-ALR--------LA------------------------C
H0W025_BIK-01           LMECVEGSSLV-ALR--------LA------------------------C
A0A2K5CLG5_BIK-01       PLECMENSDAL-VLQ--------LA------------------------C
A0A2K6TBD7_BIK-01       PLECMENSDAL-ALQ--------LA------------------------C
H2P4N6_BIK-01           PLECMEGSDAL-ALR--------LA------------------------C
G1S1X2_BIK-01           PLQCMEGSDAL-APR--------LA------------------------C
G3QCT2_BIK-01           SLECMEGSDAL-ALR--------LA------------------------C
A0A2R8ZXD2_BIK-01       SLECMEGSDAL-ALR--------LA------------------------C
H2QLU7_BIK-01           SLECMEGSDAL-ALR--------LA------------------------C
A0A2K6MCW0_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A2K6QK74_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A0D9QZY8_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A2K5VW94_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A2K6DBJ4_BIK-01       PLECIEDSDML-ALR--------LA------------------------C
A0A2K5J4Q7_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A096NKG5_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A2K5LDM6_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A2K5XSA1_BIK-01       PLECMEDSDML-ALR--------LA------------------------C
A0A3P8XIA2_BCL2L11      IAGDMRPEILI-GQE--------LQ------------------------R
G1LNV7_BBC3-01          GEEEQWARE-I-GAQ--------LR------------------------R
A0A2K5F6X4_BBC3-02      GEEEQWARE-I-GAQ--------LR------------------------R
F1RM01_BBC3-02          GEEEQWARE-I-GAQ--------LR------------------------R
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      ASGDMQAEA-V-GQE--------LR------------------------R
A0A3Q1ICY2_BCL2L11      AAGDMQAVE-V-GRE--------LR------------------------R
A0A3Q3K6I5_BCL2L11      AIRDMQAEA-V-GRE--------LR------------------------R
A0A3Q3ESW6_BCL2L11      AAGDMQAEA-I-GRD--------LQ------------------------R
A0A3Q2SZH6_BCL2L11      AARDMQPER-F-GRQ--------LR------------------------A
A0A3B3VNE0_BCL2L11      AARDMQSET-F-GRQ--------LR------------------------A
A0A3B3YII5_BCL2L11      AARDMQSEN-F-GRQ--------LR------------------------A
A0A3B3YII5_BCL2L11      AARDMQSEN-F-GRQ--------LR------------------------A
A0A3P9N073_BCL2L11      PKRETNQPI-L-SC------------------------------------
A0A3Q3B113_BCL2L11      AAGDMEAES-F-GRH--------LR------------------------T
A0A3B5M375_BCL2L11      PPPSETSTT-W-EQ------------------------------------
A0A3B5QAM1_BCL2L11      AARDMQSET-Y-GRQ--------LR------------------------A
A0A3B5QAM1_BCL2L11      AARDMQSET-Y-GRQ--------LR------------------------A
A0A3B4BVX1_BCL2L11      APAGDMRPESYVAQE--------LR------------------------R
Q9GL49_PMAIP1-01        AKFRLLFAEMP-GRR--------SR------------------------R
A0A3B1IH05_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------K
H3ANP3_BAD-01           APPNFWAARKY-GQE--------LR------------------------R
H3ANP3_BAD-02           APPNFWAARKY-GQE--------LR------------------------R
H3ANP3_BAD-03           APPNFWAARKY-GQE--------LR------------------------R
A0A3B3QX41_BAD-01       APPALWAAQRY-GRQ--------LR------------------------R
A0A2I3TBK7_BAD-01       --------------K--------LR------------------------P
A0A2I2Z8C7_BAD-03       --------------K--------LR------------------------P
A8MXU7_BAD-03           --------------K--------LR------------------------P
A0A2K5M0A7_BAD-02       --------------K--------LR------------------------P
A0A2K5XJR2_BAD-02       --------------K--------LR------------------------P
A0A2K5VCA9_BAD-02       --------------K--------LR------------------------T
A0A2K6E7I4_BAD-02       --------------K--------LR------------------------T
A0A2K5HKU7_BAD-02       AE----------NVK--------LE------------------------A
A0A2K6N196_BAD-02       AE----------NVK--------LE------------------------A
A0A2K6PUL3_BAD-02       AE----------NVK--------LE------------------------A
A0A2K5M0A7_BAD-03       AE----------NVK--------LK------------------------A
A0A2K5VCA9_BAD-03       AE----------NVK--------LK------------------------A
A0A096MLD5_BAD-02       AE----------NVK--------LK------------------------A
A0A2K6E7I4_BAD-03       AE----------NVK--------LK------------------------A
A8MXU7_BAD-04           AE----------NVK--------LE------------------------A
A0A2I3TBK7_BAD-03       AE----------NVK--------LE------------------------A
A0A2R8Z688_BAD-03       AE----------NVK--------LE------------------------A
A0A2K5E6A6_BAD-03       -E----------NVK--------LE-------------------------
A0A2K5PDB1_BAD-03       TE----------NVK--------LE------------------------A
A0A2K6TG62_BAD-03       TE----------NVK--------LE------------------------A
G3VRY3_BAD-01           APPILWAARHY-GSE--------LR------------------------R
G3VRY3_BAD-02           APPILWAARHY-GSE--------LR------------------------R
G1P8C5_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A452ER54_BAD-02       APPNLWAAQRY-GRE--------LR------------------------R
W5P8G9_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
G3TP47_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A1U7Q4V0_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
Q61337_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A287CT05_BAD-02       APPNLWAAQRY-GRE--------LR------------------------R
A0A287CT05_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
O35147_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A091DDU4_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A287AEF3_BAD-01       APPILWAAQRY-GRE--------LR------------------------R
G1MI17_BAD-01           APPNLCAALRY-GRE--------LR------------------------R
M3YNE7_BAD-01           APPNLCAALRY-GRE--------LR------------------------R
A0A452RJM6_BAD-01       APPNLCAALRY-GRE--------LR------------------------R
A0A384DJL2_BAD-01       APPNLCAALRY-GRE--------LR------------------------R
A0A452ER54_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
F1MUT9_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
Q3SYZ0_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
F7DN67_BAD-01           APPNLWAARRY-GRE--------LR------------------------R
F1PK10_BAD-01           APPNLCAARRY-GRE--------LR------------------------R
Q45KI9_BAD-01           APPNLCAARRY-GRE--------LR------------------------R
H0WVR2_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A2K6GWV0_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
H0V608_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A1S3FL84_BAD-01       APPNLWAARRY-GRE--------LR------------------------R
A0A2K5PDB1_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2K5E6A6_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2K6TG62_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A0D9R491_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2K5HKU7_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2K5XJR2_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2K6N196_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2K6PUL3_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
B4DZQ9_BAD-01           APPNLWAAQRY-GRE--------LR------------------------R
A0A096MLD5_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2I2Z8C7_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2I2Z8C7_BAD-02       APPNLWAAQRY-GRE--------LR------------------------R
A0A2R8Z688_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A2J8TYJ3_BAD-01       APPNLWAAQRY-GRE--------LR------------------------R
A0A3B4DUY7_BAD-01       APAALWKAKKY-GRQ--------LR------------------------R
E7FBJ6_BAD-01           APAALWKAKKY-GRQ--------LR------------------------R
B5XEF1_BAD-01           APPALWAAKKY-GCQ--------LR------------------------R
A0A3Q3FKT9_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3P9A5G8_BAD-01       APPALWAAKKY-GCQ--------LR------------------------R
A0A3P9A5G8_BAD-02       APPALWAAKKY-GCQ--------LR------------------------R
B5X1T1_BAD-01           APPTLWAAKKY-GRQ--------LR------------------------R
A0A3Q2QC80_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q3FKT9_BAD-03       APPALWAAKKY-GRQ--------LR------------------------R
H3D8J8_BAD-01           APPALWAAKKY-GRQ--------LR------------------------R
A0A3B5L9R9_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------R
A0A3P9B2E4_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
I3K7B6_BAD-01           APPALWAAKKY-GQK--------LR------------------------R
A0A3Q3C680_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3P8QRJ7_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q4GGN3_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3B4GXJ6_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q0QNQ2_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3P8WI83_BAD-02       APPALWAAKKY-GRQ--------LR------------------------R
A0A3P8WI83_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q2D5S0_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3P9HNZ2_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3B3BQF7_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q1K1C7_BAD-02       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q1K1C7_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q1GWH9_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q1CPU7_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3P8TWH6_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A2U9BAC9_BAD-01       APPALWAAMKY-GQK--------LR------------------------R
A0A3B4VFC5_BAD-01       APPALWAAKKY-GQK--------LR------------------------R
A0A3B4W9T1_BAD-01       APPALWAAKKY-GQK--------LR------------------------R
Q4V925_BAD-03           APPALWAAKKY-GQQ--------LR------------------------R
Q4V925_BAD-02           APPALWAAKKY-GQQ--------LR------------------------R
A7MCM4_BAD-01           APPALWAAKKY-GQQ--------LR------------------------R
Q4V925_BAD-01           APPALWAAKKY-GQQ--------LR------------------------R
Q4V925_BAD-04           APPALWAAKKY-GQQ--------LR------------------------R
A0A3P8Y761_BAD-01       APPALWAAKRY-GRQ--------LR------------------------R
A0A3B5Q2N7_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------R
A0A087X8P8_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------R
A0A3B3UA11_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------R
A0A3B3YFR1_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------R
A0A3P9Q7C3_BAD-01       APPSLWAAKKY-GRQ--------LR------------------------R
A0A3B3HDU2_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3P9KSL7_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3P9KSL7_BAD-02       APPALWAAKKY-GQQ--------LR------------------------R
A0A3B5BAL2_BAD-01       APPALWAAKKY-GQK--------LR------------------------R
A0A3Q3AEL8_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q3AEL8_BAD-02       APPALWAAKKY-GRQ--------LR------------------------R
G3Q8B3_BAD-01           APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q2Y0E4_BAD-01       APPVLWAAKKY-GRQ--------LR------------------------R
A0A3Q3R5S3_BAD-01       APPALWAAKKY-GRQ--------LR------------------------R
A0A3Q3RXS8_BAD-01       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q3RXS8_BAD-02       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q0QNQ2_BAD-02       APPALWAAKKY-GQQ--------LR------------------------R
A0A3Q3WTY4_BAD-01       APPSLWAAKKY-GQR--------LR------------------------R
A0A493SWX7_PMAIP1-      AQPSAERQAV-------AECALELR------------------------R
A0A2I3HX97_PMAIP1-      AQPSPAPAPAELE----VECATQLR------------------------R
A0A452TE71_PMAIP1-      ASPSPSAAPPP-E----VECAIQLR------------------------R
A0A452J430_PMAIP1-      AQQNPALPAQEAV----TQCSLQLR------------------------K
A0A1D5PAR2_PMAIP1-      -KPAPPAAPAERD--AVAECALELR------------------------R
A0A2K6EM90_PMAIP1-      AQPSPTRTRAEIE----EECALQLR------------------------R
G1P8F9_PMAIP1-01        AQPSPTRAPAEAE----IECALQLR------------------------R
Q9JM54_PMAIP1-03        RSPSPTRVPADLK----DECA-QLR------------------------R
A0A3Q2I0H2_PMAIP1-      GQPSPTRAPAELE----AECAIQIR------------------------R
G3T0P7_PMAIP1-01        AQPGPAGTPAGTQQRDVVECAIQLR------------------------R
Q1PCT2_PMAIP1-01        AQPGPTRAPEELE----VECAIQLR------------------------K
G1LIZ7_PMAIP1-01        AQASPARTRGQPE----VECAIQLR------------------------R
A0A452STA4_PMAIP1-      AQASPARTPAEPE----VECAIQLR------------------------R
A0A2K5NJZ2_PMAIP1-      AQPSPMRAQAELE----VECATQLR------------------------R
A0A0D9S003_PMAIP1-      AQPSPTRAQAELE----VECATQLR------------------------R
A0A2K5VPX2_PMAIP1-      AQPSPTRAQAELE----VECATQLR------------------------R
A0A2K6BV43_PMAIP1-      AQPSPTRAQAELE----VECATQLR------------------------R
A0A2K5ZWH1_PMAIP1-      AQPSPTRAQAELE----VECATQLR------------------------R
A0A096MPU8_PMAIP1-      AQPSPTRAQAELE----VECATQLR------------------------R
A0A2K5JY17_PMAIP1-      AQPSPARAQAELE----VECATQLR------------------------R
A0A2K6KJF1_PMAIP1-      AQPSPARAQAELE----VECATQLR------------------------R
A0A2K6NC45_PMAIP1-      AQPSPARAQAELE----VECATQLR------------------------R
A0A2K6S6C4_PMAIP1-      AQPSPARAPADLE----VECAIQLR------------------------R
A0A2I2YVQ5_PMAIP1-      AQPSPARAPAELE----VECATQLR------------------------R
A0A2R9AKC9_PMAIP1-      AQPSPARAPAELE----VECATQLR------------------------R
A0A2I3SX38_PMAIP1-      AQPSPARAPAELE----VECATQLR------------------------R
H2NWG2_PMAIP1-01        AQPSPARAPAELE----VECATQLR------------------------R
A0A2K5CFK7_PMAIP1-      AQPSPSRAPADLE----VECATQLR------------------------R
F7GW45_PMAIP1-01        AQPSPARAPADLE----VECATQLR------------------------R
A0A2K5QQC6_PMAIP1-      AQPSPAPAPADLE----VECATQLR------------------------R
A0A337SUX1_PMAIP1-      AQPSPARAPAEPE----VECAMQLR------------------------R
A0A3Q1NFP6_PMAIP1-      AQPSPTRVPADPE----VECAIQLR------------------------R
A0A452EST2_PMAIP1-      AQPSPTRVPADPE----VECAIQLR------------------------R
W5P738_PMAIP1-01        AQPSPTRVPADPE----VECAIQLR------------------------R
A0A0P0HZF9_PMAIP1-      --------MAKKEKTAVVECAQQLR------------------------T
Q0GKC8_PMAIP1-01        --------MAKKEQTAVVECAQQLR------------------------N
Q6JTU4_BCL2L11-01       -----MRQAEPADMRPEIWIAQELR------------------------R
A0A3B5RFA9_PMAIP1-      -------LPAAAEL-----CARELR------------------------Q
                                                                          

G1MV54_BCL2L11-01       IGDEFNASY-CPRRGFLDNH---AGNPQVVILRLLHYIIRLIWRMQ----
G1PDJ5_BCL2L11-01       IGDEFNNSYRNPRRDFLNVYREAEGHPQMVVLRLLRYILRLVWRRM----
A9XRH0_BMF-01           IADQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR-----
Q6P7C5_BAD-01           SIVQQQPGQAA-NNSHHGGRFLTSIIFLSHVP------------------
A3KND0_BMF-01           EIYRMFNASIP-HESHRFHRLFQV--------------------------
A0A2K6KS56_BBC3-02      MARRLNAQYRRR-------------------------------------R
Q2PG01_BAD-01           MSDEFVDSFKGL-------------------------------------P
A0A2I3H4B2_BAD-01       MSDEFVDSFKGL-------------------------------------P
F7G1G0_HRK-01           LGDELQERTMWR-------------------------------------R
A0A1U7R468_HRK-01       LGDELHRRAM-R-------------------------------------R
P62816_HRK-03           LGDELHRRAM-R-------------------------------------R
P62817_HRK-01           LGDELHRRAM-R-------------------------------------R
A0A2K5KZ69_HRK-01       LGDELHQRTMWR-------------------------------------R
H2NIS8_HRK-01           LGDELHQRTMWR-------------------------------------R
H2Q6Y8_HRK-01           LGDELHQRTMWR-------------------------------------R
G3UH24_HRK-01           LGDELHQRTMWR-------------------------------------R
A0A2K5BYA0_HRK-01       LGDELHQRTMWR-------------------------------------R
U3E722_HRK-01           LGDELHQRTMWR-------------------------------------R
A0A452DXE5_HRK-01       LGDELHQRTMWR-------------------------------------R
A0A0D9SC73_HRK-01       LGDELHQRTMWR-------------------------------------R
A0A3Q2IBL3_HRK-01       LGDELHQRTMWR-------------------------------------R
A0A337SQ56_HRK-01       LGDELHQRTMWR-------------------------------------R
G3QTJ6_HRK-01           LGDELHQRTMWR-------------------------------------R
A0A2K6AYL7_HRK-01       LGDELHQRTMWR-------------------------------------R
G1QHD8_HRK-01           LGDELHQRTMWR-------------------------------------R
G1T7W1_HRK-01           LGDELHQRTMWR-------------------------------------R
H0Y001_HRK-01           LGDELHQRTMWR-------------------------------------R
A0A096N944_HRK-01       LGDELHQRTMWR-------------------------------------R
A0A2K6GL98_HRK-01       LGDELHQRTMWR-------------------------------------R
A0A2K5PIE7_HRK-01       LGDELHQRTMWR-------------------------------------R
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      IGDKLNFQQKLMYLISKLISLVT---------------------------
A0A1U7QLK6_PMAIP1-      IGDKQNLRQKLLNFISKLFSLVT---------------------------
Q9JM54_PMAIP1-01        IGDKVNLRQKLLNLISKLFNLVT---------------------------
Q5U777_PMAIP1-01        IGDKVNLRQKLLNFISKLFNLIT---------------------------
A0A3Q2LHE3_BIK-02       IGDEMEVRWMLP--------------------------------------
F7FUT7_BIK-02           IADQMDVSLRAR--------------------------------------
F7FUT7_BIK-01           IADQMDVSLRAR--------------------------------------
O61667_EGL1-01          MCDDFDAQMMSYSAHASDRSLFHRLLDFFAF-------------------
A0A3G3M2M0_BCL2L11      IGDEFNRLYCQG-----------------------------AGAGGNNRA
A0A3Q1ELG4_BCL2L11      MAGEAHR---GG-----------------------------PETQRQQHG
A0A3Q1CI15_BCL2L11      MTDEAHG---GG-----------------------------PGT--QQHG
F1SMU1_PMAIP1-01        IGDKLNFRQKLLNLIAKLFRLGT---------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       IGDKFQQDHF--------------------------------------MR
B2KKY9_BCL2L11-01       IGDEFNRLYCEA-----------------------------GAGVNQLRA
B8JK68_BCL2L11-01       IGDEFNRLYCEA-----------------------------GAGVNQLHA
A0A3B4B6Y3_BMF-01       IGDQFHRDHLQR-----------------------------V------RE
A0A3P9ICE1_BMF-01       IGDQFHRERLQL-----------------------------Y------HR
Q0GKC7_BMF-01           IGDQFYQEHI--------------------------------------MH
A0A3B3RH63_BMF-01       IGDQFHQDQLQL-----------------------------Y------HR
W5N4P7_BMF-01           IGDQFHRDYLHM-----------------------------Y------RR
A0A3B1K1X5_BMF-01       IGDQFYQEHMLQ------------------------------------HR
A0A3B4CNJ8_BMF-01       IGDQFYQEHMLQ------------------------------------HR
A0A2U9CJH3_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q2YCX7_BMF-01       IGDQFHREHLQL-----------------------------V------SR
A0A3Q2YCX7_BMF-02       IGDQFHREHLQL-----------------------------V------SR
A0A3P8ZIE7_BMF-01       IGDQFHEEHLQL-----------------------------Y------HR
A0A3Q2PJX9_BMF-02       IGDQFHREHLQQ-----------------------------R------GS
A0A3Q3QZ16_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q3QZ16_BMF-02       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q2PJX9_BMF-01       IGDQFHREHLQQ-----------------------------Y------HQ
A0A3Q2PJX9_BMF-03       IGDQFHREHLQQ-----------------------------Y------HQ
A0A3B5QK08_BMF-01       IGDQFHREHLQQ-----------------------------Y------QQ
A0A3B5QK08_BMF-02       IGDQFHREHLQQ-----------------------------Y------QQ
A0A096LRV0_BMF-01       IGDQFHREHLQQ-----------------------------Y------QQ
A0A3B3WU80_BMF-01       IGDQFHREHLQQ-----------------------------Y------QQ
A0A3P9Q8E2_BMF-01       IGDQFHREHLQQ-----------------------------Y------QQ
A0A3Q2CXC4_BMF-02       IGDQFHREHLQQ-----------------------------IPGQPFPHL
A0A3Q2CXC4_BMF-01       IGDQFHREHLQQ-----------------------------Y------HQ
A0A3Q3GUU5_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3B5B8F6_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q3VLX6_BMF-01       IGDQFHREHMQL-----------------------------Y------HR
A0A3P8UA78_BMF-02       IGDQFHRDHLQL-----------------------------Y------HR
A0A3P8UA78_BMF-01       IGDQFHRDHLQL-----------------------------Y------HR
A0A3P8UA78_BMF-03       IGDQFHRDHLQL-----------------------------Y------HR
A0A3B3CGR9_BMF-01       IGDQFHRERLQL-----------------------------Y------HQ
A0A3P9K487_BMF-02       IGDQFHRERLQL-----------------------------Y------HR
A0A3P9K487_BMF-01       IGDQFHRERLQL-----------------------------Y------HR
A0A3B3HAU1_BMF-03       IGDQFHRERLQL-----------------------------Y------HR
A0A3B3HAU1_BMF-02       IGDQFHRERLQL-----------------------------Y------HR
A0A3B3HAU1_BMF-01       IGDQFHRERLQL-----------------------------Y------HR
A0A3B3HAU1_BMF-04       IGDQFHRERLQL-----------------------------Y------HR
A0A3P9ICE1_BMF-04       IGDQFHRERLQL-----------------------------Y------HR
A0A3Q2ZA20_BMF-01       IGDQFHREHLQQ-----------------------------Y------HR
A0A3P8NFE2_BMF-02       IGDQFHWERLQL-----------------------------V------KA
I3K2D6_BMF-01           IGDQFHWERLQL-----------------------------Y------HR
A0A3P8NFE2_BMF-01       IGDQFHWERLQL-----------------------------Y------HR
A0A3Q3C5V2_BMF-01       IGDQFHWERLQL-----------------------------Y------HR
A0A3P9DPJ5_BMF-01       IGDQFHWERLQL-----------------------------Y------HR
A0A3P9DPJ5_BMF-02       IGDQFHWERLQL-----------------------------Y------HR
A0A3B4ETH0_BMF-01       IGDQFHWERLQL-----------------------------Y------HR
A0A3Q4G1I4_BMF-01       IGDQFHWERLQL-----------------------------Y------QR
A0A3Q1FVH7_BMF-02       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q1FVH7_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q3RVI2_BMF-01       IGDQFHREHLQL--------------------------------------
A0A3Q1D1K3_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3P8RKY9_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3Q3RVI2_BMF-02       IGDQFHREHLQL-----------------------------Y------HL
A0A3Q1IPR4_BMF-01       IGDQFHREHLQL-----------------------------Y------HR
A0A3B4U5H8_BMF-01       IGDQFHREHLQL-----------------------------Y------HQ
A0A3B4WM88_BMF-01       IGDQFHREHLQL-----------------------------Y------HQ
A0A3Q3SYA1_BCL2L11      QHGEHKHLRSRLFTAHAEYTQVKQP-------------------------
R4G9R5_BCL2L11-01       IGDEFNASHCPRRGFLDYQAV-------NHQIIILRLLHYIVRFIWRMQ-
A0A3B3QC78_BCL2L11      IGDKFNDIYINGVSILLCPHCPLRPTAMGQGATLTPYPGDNKNKESPLRS
F7CXT2_BCL2L11-01       IGDEFNASYYPRRAVWHCFKSFG--------IGVGSQL------------
F7FTC8_BCL2L11-01       IGDEFNASYCPRRGLLDNNNPAGNN----HQMGFVHLLRYIIRRVWRLQ-
A0A2R8M6L7_BCL2L11      IGDEFNAYY-PRRVFL-NNYQAAED---HPHMVILRLLRYIVRLVWRMH-
G3SU55_BCL2L11-01       IGDEFNAYY-PRRAFL-NNYQAAED---HPQMVILRLLRYIVRLVWR---
G3W979_BCL2L11-01       IGDEFNASY-PRRGFLDNNYQAADD---HHQMVILRLLHYIIRLVWRMQ-
U3IW89_BCL2L11-01       IGDEFNASYCPRR------------------VIFLFLLSISLHLVPRLPP
A0A3Q2U844_BCL2L11      IGDEFNASYCPRRGFL----DNRAG---NPQVVILRLLHYIIRLIWRMQ-
C1C3S9_BAD-01           FGETFFNFFRRKNKDRSQSENDKH--------------------------
A0A3P8XIA2_BCL2L11      IGDEFNNLFIHGV----------SGCSKMPVLHHLIYKPYQGPHCIKLS-
A0A452IFQ4_BAD-01       SSK-----------------------------------------------
K7GA86_BCL2L11-01       IGDEFNASYCPRRGFLDNQA--------INHQIVLRLLHYIIRLIWRMQ-
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRV--FLNNYQAAED---HPHMVILRLLRYIVRLVWRMH-
M3YDI3_BCL2L11-01       IGDEFNAYYPRRV--FLNNYPAAEA---HPQMIILRLLRYIIRLVWRLQ-
F7CXT2_BCL2L11-02       IGDEFNASYYPRRGFLDNNYQGAGD---HHQMVILRLLRYIIRLVWRMQ-
G1SSY0_BCL2L11-01       RGFPSAGCFPRCPPRPGLDWARPKPGAWNLALSLPPGWQGPS--------
J9NWV6_BCL2L11-06       IGDEFNAYYPRRV--MMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQG
C1KGB8_BCL2L11-01       IGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI-------------------
A0A3Q2GRS5_BCL2L11      IGDEFNASYPRRLAQ----CLAFYT-------------------------
U6CTE3_BCL2L11-04       IGDEFNAYYPRRLARIPASCLC----------------------------
A0A1U7T0R1_BCL2L11      IGDEFNAYYPRRLAK----NLASSS-------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       IGDEFNETYTRRV--FANDYREAED---HPQMVILQLLRFIFRLVWRRH-
O88498_BCL2L11-01       IGDEFNETYTRRA--FANDYREAED---HPQMVILQLLRFIFRLVWRRH-
A0A2K5Z7V3_BCL2L11      IGDEFNAYYARRV--FLNNYQAAED---HPQMVILRLLRYIVRLVWRMH-
A0A096NYC3_BCL2L11      IGDEFNAYYARRV--FLNNYQAAED---HPQMVILRLLRYIVRLVWRMH-
A0A2K5X1Y3_BCL2L11      IGDEFNAYYARRM--SLPPD------------------------------
A0A2K6E212_BCL2L11      IGDEFNAYYARRM--SLPPD------------------------------
A0A2K5NU92_BCL2L11      IGDEFNAYYARRL--EK---------------------------------
A0A096NYC3_BCL2L11      IGDEFNAYYARRL--EK---------------------------------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRL--EK---------------------------------
A0A2I3SN61_BCL2L11      IGDEFNAYYARRL--EK---------------------------------
A0A2R8M6L7_BCL2L11      IGDEFNAYYPRRL--EK---------------------------------
A0A2K5CA89_BCL2L11      IGDEFNAYYPRRI--SLPSD------------------------------
A0A2K5Q1Y0_BCL2L11      IGDEFNAYYPRRI--SLPSD------------------------------
A0A1U7T0R1_BCL2L11      IGDEFNAYYPRRM--PFPPD------------------------------
A0A1U7T0R1_BCL2L11      IGDEFNAYYPRRL--EK---------------------------------
A0A3Q2GRS5_BCL2L11      IGDEFNASYPRRL--EQ---------------------------------
J9NWV6_BCL2L11-04       IGDEFNAYYPRRL--EQ---------------------------------
U6CTE3_BCL2L11-02       IGDEFNAYYPRRL--EQ---------------------------------
A0A1U8BW10_BCL2L11      IGDEFNESYRRRV----NNYQEDEDHPHHPQMVILQLLRFIVRLVWRRH-
A0A1U7T0R1_BCL2L11      IGDEFNAYYPRRA--YLNNNQAAED---HPQMVLLRLLRYIVRLVWRMY-
A0A2K6GE31_BCL2L11      IGDEFNAYYPRRV--FLNNYQADED---HPQMLILRLLRYIVRLVWRRH-
A0A287DFJ0_BCL2L11      IGDEFNLYYPRRV--FFNNYQP-ED---RPQMVILRLLRCIIRLVWRMH-
A0A452FCR6_BCL2L11      IGDEFNAYYPRRV--FV-RHQAIEG---HPQMVLLRVLRYLVRLVWRMQ-
W5PY58_BCL2L11-01       IGDEFNAYYPRRV--FV-RHQAIEG---HPQMVLLRVLRYLVRLVWRMQ-
L8IVA4_BCL2L11-02       IGDEFNAYYPRRV--FV-RHQAVEG---HPQMVLLRVLRYIVRLVWRMQ-
A0A286XJN2_BCL2L11      IGDEFNASYPRRV--FLNHYQPAED---QPQMVILRLLRYIIRLVWRMH-
A0A286XJN2_BCL2L11      IGDEFNASYPRRV--FLNHYQPAED---QPQMVILRLLRYIIRLVWRMH-
G1SSY0_BCL2L11-02       IGDEFNAYYPRRV--FLNNYPAAEE---QPQMVILRLLRYIVRLVWRMH-
A0A250YBV9_BCL2L11      IGDEFNAYYPRRV--FLNNYQGVED---HPQMVILRLLRYIIRLVWRMH-
H0XW23_BCL2L11-01       IGDEFNAYYPTRV--FLHNYQAAED---HPQMVILRLLRYIVRLVWRLH-
A0A1S3FFM9_BCL2L11      IGDEFDAYYPRRV--FLNNYQAAED---QPQMVILRLLRYIIRLVWRMH-
U6CTE3_BCL2L11-01       IGDEFNAYYPRRV--FLNNYPAAEA---HPQMIILRLLRYIIRLVWRLQ-
G1LDR8_BCL2L11-01       IGDEFNAYYPRRV--FLNNYQAAEA---HPQMIILRLLRYIVRLVWRLQ-
J9NWV6_BCL2L11-03       IGDEFNAYYPRRV--FLNNYQAAEA---HPQMIILRLLRYIVRLVWRLQ-
A0A2I2UX96_BCL2L11      IGDEFNAYYPRRV--FLNNYQAAEA---QPQMIILRLLRYIVRLVWRLQ-
O54918_BCL2L11-03       YN------------------------------------------------
A0A1U8BW10_BCL2L11      KS------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      SS------------------------------------------------
A0A2I3GVB2_BCL2L11      SS------------------------------------------------
A0A2K6TRU4_BCL2L11      SS------------------------------------------------
A0A0D9RWE0_BCL2L11      IGDEFNAYYARRL----------------------------------EK-
U6CTE3_BCL2L11-03       IGDEFNAYYPRRL----------------------------------EQ-
A0A2K6E212_BCL2L11      IGDEFNAYYARRV--FLNNYQAAED---HPQMVILRLLRYIVRLVWRMH-
H2P5E2_BCL2L11-01       IGDEFNAYYARRV--FLNNYQAAED---HPRMVILRLLRYIVRLVWRMH-
A0A250YBV9_BCL2L11      IGDEFNAYYPRRV--FLNNYQGVED---HPQMVILRLLRYIIRLVWRMH-
A0A286XJN2_BCL2L11      IGDEFNASYPRRV--FLNHYQPAED---QPQMVILRLLRYIIRLVWRMH-
A0A2I2UX96_BCL2L11      IGDEFNAYYPRRV--FLNNYQAAEA---QPQMIILRLLRYIVRLVWRLQ-
A0A1S3FFM9_BCL2L11      IGDEFDAYYPRRV--FLNNYQAAED---QPQMVILRLLRYIIRLVWRMH-
A0A452SBG5_BCL2L11      IGDEFNAYYPRRV--FLNNYQAAEA---HPQMIILRLLRYIIRLVWRLQ-
A0A3Q1MV27_BCL2L11      IGDEFNAYYPRRV--FVRH-QAVEG---HPQMVLLRVLRYIVRLVWRMQ-
A0A1U8BW10_BCL2L11      IGDEFNESYRRRVNNYQED-EDHPH---HPQMVILQLLRFIVRLVWRRH-
A0A287DFJ0_BCL2L11      IGDEFNLYYPRRV--FFNN-YQPED---RPQMVILRLLRCIIRLVWRMH-
L8IVA4_BCL2L11-01       IGDEFNAYYPRRV--FVRH-QAVEG---HPQMVLLRVLRYIVRLVWRMQ-
A0A3Q1MV27_BCL2L11      IGDEFNAYYPRRV--FVRH-QAVEG---HPQMVLLRVLRYIVRLVWRMQ-
A0A452FCR6_BCL2L11      IGDEFNAYYPRRV--FVRH-QAIEG---HPQMVLLRVLRYLVRLVWRMQ-
A0A2K5CA89_BCL2L11      -------------------HHHSQG---TEQLHHKYFS------------
A0A2K5Z7V3_BCL2L11      -------------------HHHSQD---TEQLNHKDFS------------
A0A2K6KJP8_BCL2L11      V--------------WIYIYHHSQD---TEQLNHRDFS------------
A0A3P8RLE2_BCL2L11      MTDEAHGGGPGT-----------------------QQHGELRLTYTREIS
A0A3B1JLM2_BAD-01       MSDEFDTWLDKG-----------------------------DLRRTTGPG
Q61337_BAD-05           MSDEFEGSFKVS-------------------------------ASVRCDG
A0A3B1JXK6_BCL2L11      IGDEFNDLYFRGAGR-NGGGAQLPAQNEPAFILWMGLLIERLRQFLHRRR
A0A3B4BVX1_BCL2L11      IGDEFNELYFHGVSQLHGCVAGMQALSNPVAFSILGLF---------RGH
A0A2I3HWI8_BBC3-03      MADDLNAQYERR------------------------------RQEEQQRH
A0A3Q2GWE8_BBC3-02      MADDLNALYERR------------------------------RQEEQQRH
A0A2K6STD6_BBC3-02      MADDLNAQYERR------------------------------RQEEQPQH
A0A2R8MW85_BBC3-02      MADDLNALYERR------------------------------RQEEQPQH
A0A2K5QNS7_BBC3-02      MADDLNAQYERR------------------------------RQEEQPQH
A0A2K6FQZ1_BBC3-04      MADDLNAQYERR------------------------------RQEEQQRH
A0A2R9BZA9_BBC3-01      MADDLNAQYERR------------------------------RQEEQQRH
A0A2I3RGH5_BBC3-03      MADDLNAQYERR------------------------------RQEEQQRH
A0A2K5P2T8_BBC3-03      MADDLNAQYERR------------------------------RQEEQQRH
A0A2K5V8J3_BBC3-03      MADDLNAQYERR------------------------------RQEEQQRH
A0A2K6ASP2_BBC3-03      MADDLNAQYERR------------------------------RQEEQQRH
A0A2I3N2Z9_BBC3-03      MADDLNAQYERR------------------------------RQEEQQRH
A0A2K6QZT2_BBC3-04      MADDLNAQYERR------------------------------RQEEQQRH
F7GL32_BBC3-02          MADDLNALYEQR-----------------------------RREEEQRRH
F7GL32_BBC3-01          MADDLNALYEQR-----------------------------RREEEQRRH
J9NTK9_BBC3-01          MADDLNALYERR-----------------------------VSVGGGVDG
F1RM01_BBC3-04          MADDLNALYERR-----------------------------VSAGGGVDG
G3T2N1_BBC3-01          KADDLYALYERS-----------------------------VRQEEQHRH
A0A250YBU3_BBC3-01      MADDLNAQYERR------------------------------RQEEQQQH
M3Y0R3_BBC3-01          MADDLNALYERR------------------------------RQEEQQRH
A0A1U7R5N5_BBC3-01      MADDLNAQYERR------------------------------RQEEQHRH
Q99ML1_BBC3-02          MADDLNAQYERR------------------------------RQEEQHRH
Q80ZG6_BBC3-01          MADDLNAQYERR------------------------------RQEEQHRH
H0XQ00_BBC3-01          MADDLNAQYERR------------------------------RQEEQQRH
A0A0D9S2H2_BBC3-01      MADDLNAQYERR------------------------------RQEEQQRH
B4DQK3_BBC3-01          MADDLNAQYERR------------------------------RQEEQQRH
A0A250YBU3_BBC3-02      MADDLNAQYERR------------------------------RQEEQQQH
A0A3Q1LXZ6_BBC3-01      MADDLNALYERR------------------------------RQEERQRH
A0A452E3G1_BBC3-01      MADDLNALYERR------------------------------RQEERQRH
F1RM01_BBC3-03          MADDLNALYERR------------------------------RQEEQQRH
A0A2I3RGH5_BBC3-01      MADDLNAQYERR------------------------------RQEEQQRH
H2NZD3_BBC3-01          MADDLNAQYERR------------------------------RQEEQQRH
A0A2K6QZT2_BBC3-01      MADDLNAQYERR------------------------------RQEEQQRH
A0A2K6FQZ1_BBC3-01      MADDLNAQYERR------------------------------RQEEQQRH
A0A337SAW2_BAD-01       MSDEFQGSFKGL-----------------------------PRPKSAGTA
A0A2R8MW85_BBC3-03      MADDLNALYER------------------------------RRQEEQPQH
C1KGB6_BCL2L11-02       IGDEFNAYYPR------------------------------RVMLFSLPP
C1KGB6_BCL2L11-03       IGDEFNAYYPR------------------------------RLEQ-----
C1KGB6_BCL2L11-01       IGDEFNAYYPR------------------------------RVFLNNYQA
J9NWV6_BCL2L11-01       IGDEFNAYYPR------------------------------RVFLNNYQA
A0A3Q2GRS5_BCL2L11      IGDEFNASYPR------------------------------RVVLNHHQA
A0A3Q2GRS5_BCL2L11      IGDEFNASYPR------------------------------RVVLNHHQA
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A493T7X1_BMF-01       EDSEILLLVFKF-------------------------------------G
A0A452H3N6_BMF-01       IADQFHRLHIQR-----------------------------HQQNR---N
A0A287AIU8_BMF-02       IADQFHRLHMQQ-----------------------------HQQNQ---N
G1PAU1_BMF-01           IADQFHRLQMQQ-----------------------------HQQNR---N
A0A287AIU8_BMF-01       IADQFHRLHMQQ-----------------------------HQQNQ---N
A0A1U8CPE0_BMF-02       IADQFHRLHIQQ-----------------------------HQQNR---D
A0A286XXB0_BMF-03       IADQFHRLHIQQ-----------------------------HQQNR---N
A0A287CXH0_BMF-02       IADQFHRLHMQQ-----------------------------HQQNR---N
A0A1S3EQA2_BMF-02       IADQFHRLHTQR-----------------------------HQQHR---D
A2AV74_BMF-02           IADQFHRLHTQQ-----------------------------HQQNR---D
H9GL49_BMF-01           IADQFHRLHLQR-----------------------------HQQNR---N
A0A3Q2UCA0_BMF-02       IADQFHRLHIQR-----------------------------VGCFH---R
A0A3Q2UCA0_BMF-01       IADQFHRLHIQR-----------------------------VGCFH---R
K7FRX2_BMF-01           IADQFHRLHIQR-----------------------------HQQNR---N
U3JS06_BMF-01           IADQFHRLHIQR-----------------------------HQQNR---N
A0A493T7X1_BMF-02       IADQFHRLHIQR-----------------------------HQQNR---N
A0A3Q2UCA0_BMF-03       IADQFHRLHIQR-----------------------------HQQNR---N
A0A3Q2UCA0_BMF-04       IADQFHRLHIQR-----------------------------HQQNR---N
G1NHG8_BMF-01           IADQFHRLHIQR-----------------------------HQQNR---N
A0A337ST43_BMF-02       LGCPPRMGHHRK-----------------------------DISED----
A0A2K5KGP2_BMF-01       LGCPLHMGHQEH-----------------------------RQEGHRAGL
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       IADQFHRLHTQR-----------------------------HQQHR---D
Q8K589_BMF-01           IADQFHRLHMQQ-----------------------------HQQNR---D
A0A337ST43_BMF-05       IADQFHRLHMQQVGMGAWGGGRVCWGWGARTCLSNSVSARLYQDMV---P
A0A337ST43_BMF-04       IADQFHRLHMQQ-----------------------------HQQNR---R
A2AV74_BMF-01           IADQFHRLHTQQ-----------------------------HQQNR---D
A0A286XXB0_BMF-02       IADQFHRLHIQQ-----------------------------HQQNR---N
G3WDQ2_BMF-01           IADQFHRLHMQR-----------------------------HQQNQ---N
G3T7Z4_BMF-01           IADHFHRLHMQR-----------------------------HQQNR---N
A0A287CXH0_BMF-01       IADQFHRLHMQQ-----------------------------HQQNR---N
A0A1S3WU31_BMF-01       IADQFHHLHMQQ-----------------------------HQQNR---N
A0A337ST43_BMF-03       IADQFHRLHMQQ-----------------------------VGMGAWGGG
A0A337ST43_BMF-01       IADQFHRLHMQQ-----------------------------HQQNR---R
A0A1U8CPE0_BMF-01       IADQFHRLHIQQ-----------------------------HQQNR---D
G1SR62_BMF-01           IADQFHRLHLQQ-----------------------------HQQNR---N
M3YAD5_BMF-01           IADQFHRLHMQQ-----------------------------HQQNQ---N
U6CSY8_BMF-01           IADQFHRLHMQQ-----------------------------HQQNQ---N
A0A452SED0_BMF-01       IADQFHRLHMQQ-----------------------------HQQNQ---N
A0A384D070_BMF-01       IADQFHRLHMQQ-----------------------------HQQNQ---N
W5QFV1_BMF-01           IADQFHRLHMQQ-----------------------------HQQNR---N
L8IXF5_BMF-01           IADQFHRLHMQQ-----------------------------YQQNR---N
A0A452F2E0_BMF-01       IADQFHRLHMQQ-----------------------------HQQNR---N
A0A452F2E0_BMF-02       IADQFHRLHMQQ-----------------------------HQQNR---N
Q05KI3_BMF-02           IADQFHRLHMQQ-----------------------------YQQNR---N
Q05KI3_BMF-01           IADQFHRLHMQQ-----------------------------YQQNR---N
A0A2K6FFN3_BMF-01       IADQFHRLHVQQ-----------------------------HQQNQ---N
H0WYH6_BMF-01           IADQFHRLHVQQ-----------------------------HQQNQ---N
A0A096NTE9_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6L919_BMF-02       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K5E1Q4_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6TW78_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6TW78_BMF-02       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K5RN49_BMF-01       IADQFHQLHVQQ-----------------------------HQQNR---N
A0A2I2Z168_BMF-01       IADQFHRLHVQQ-----------------------------HQQNQ---N
A0A2R9BS98_BMF-01       IADQFHRLHVQQ-----------------------------HQQNQ---N
A0A2J8QDD5_BMF-02       IADQFHRLHVQQ-----------------------------HQQNQ---N
A0A2J8T301_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
F7CM09_BMF-01           IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K5MJW4_BMF-02       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K5KGP2_BMF-02       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K5VLE9_BMF-02       IADQFHRLHVQQ-----------------------------HQQNR---N
F7CM09_BMF-03           IADQFHRLHVQQ-----------------------------HQQNR---N
F7CM09_BMF-02           IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6B5F6_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6B5F6_BMF-02       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6B5F6_BMF-04       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K5Z4A9_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6L919_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6L919_BMF-03       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A2K6RAW1_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
A0A0D9R4R5_BMF-01       IADQFHRLHVQQ-----------------------------HQQNR---N
J9PB65_BMF-04           IADQFHRLHMQQ-----------------------------HQQNQ---N
J9PB65_BMF-03           IADQFHRLHMQQ-----------------------------HQQNQ---N
J9PB65_BMF-02           IADQFHRLHMQQ-----------------------------HQQNQ---N
J9PB65_BMF-01           IADQFHRLHMQQ-----------------------------HQQNQ---N
A0A3Q2HR24_BMF-01       IADQFHRLHMQQ-----------------------------HQQNR---N
A0A3Q2HR24_BMF-02       IADQFHRLHMQQ-----------------------------HQQNR---N
A0A2I2YVQ5_PMAIP1-      SKTCMRGLLQKS-----------------------------FLRRCTFHQ
A0A2I3SX38_PMAIP1-      SKTCMRGLLQKS-----------------------------FLRRCTFHQ
A0A2K5JY17_PMAIP1-      TKTCMRGLQKRI-----------------------------FLRRCTFHQ
A0A2R9AKC9_PMAIP1-      SKTCMRGLLQKS-----------------------------FLRRCTFHQ
A0A2K6KJF1_PMAIP1-      SKTCIRGLQTRI-----------------------------FLRRCTFHQ
A0A2K6NC45_PMAIP1-      SKTCIRGLQTRI-----------------------------FLRRCTFHQ
A0A096MPU8_PMAIP1-      SKTCIGGLQKRL-----------------------------FLRRCTLHQ
A0A2K5ZWH1_PMAIP1-      SKTCIRGLQKRL-----------------------------FLRRCILHK
A0A2K5VPX2_PMAIP1-      SKTCIRGLQKRL-----------------------------FLRRCTLHQ
A0A2K6BV43_PMAIP1-      SKTCIRGLQKRL-----------------------------FLRRCTLHQ
W5QCU2_BIK-01           IADEMELRLLLP-----------------------------QFVEPFWMP
A0A3Q2LHE3_BIK-01       IGDEMEVRWMLP-----------------------------HIAELPGVA
A0A452QUG1_BIK-01       IGDEMEVRWMLP-----------------------------RVGELPGMA
A0A452V3L2_BIK-01       IGDEMEVRWMLP-----------------------------RVGELPGMA
A0A3B4CPH6_BAD-01       MSDEFDTLLDKG-----------------------------MKRVRSAGA
M3XHJ5_BCL2L11-01       WRDRSLLST----------------------------------LMGGLLL
G1TZR9_BIK-01           IGDEMDLHP----------------------------------RRYTSAR
A0A2K5QXZ1_BIK-01       IADQMDVSL----------------------------------RARKLAQ
O70337_BIK-04           IGDEMDLCL----------------------------------RSPRLVQ
O70337_BIK-02           IGDEMDLCL----------------------------------RSPRLVQ
O70337_BIK-01           IGDEMDLCL----------------------------------RSPRLVQ
Q925D2_BIK-01           IGDEMDRCL----------------------------------RSPRLVQ
A0A1S3FUQ7_BIK-01       IGDEMDQRL----------------------------------RSPRLAQ
H0XAE7_BIK-01           IGDEMDLHL----------------------------------RSPRLAQ
A0A2K6FM79_BIK-01       IGDEMDLCL----------------------------------RSPRLAW
H0W025_BIK-01           IGDEMDLRL----------------------------------RSPRLAQ
A0A2K5CLG5_BIK-01       IADQMDVSL----------------------------------RARRLAQ
A0A2K6TBD7_BIK-01       IADQMDVSL----------------------------------RARRLAQ
H2P4N6_BIK-01           IGDEMDVSL----------------------------------RAPRRAQ
G1S1X2_BIK-01           IGDEMDVSL----------------------------------RAPRLAQ
G3QCT2_BIK-01           IGDEMDVSL----------------------------------RAPRLAQ
A0A2R8ZXD2_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
H2QLU7_BIK-01           IGDEMDVSL----------------------------------RAPRLAQ
A0A2K6MCW0_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A2K6QK74_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A0D9QZY8_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A2K5VW94_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A2K6DBJ4_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A2K5J4Q7_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A096NKG5_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A2K5LDM6_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A2K5XSA1_BIK-01       IGDEMDVSL----------------------------------RAPRLAQ
A0A3P8XIA2_BCL2L11      IGDEFNNLFIHG-----------------------------RLGARNGQ-
G1LNV7_BBC3-01          MADDLNALYERR-----------------------------RQEERQRHR
A0A2K5F6X4_BBC3-02      MADDLNAQYERR-----------------------------RQEEQPQHR
F1RM01_BBC3-02          MADDLNALYERR-----------------------------RQEEQQRHR
A0A3B4V919_BCL2L11      --GELKPALLKH-----------------------------TKMTSQCCQ
A0A3B4XZH1_BCL2L11      IGDDFNRLLLLR-----------------------------VSHHRWCVC
A0A3Q1ICY2_BCL2L11      IGDDFNNHLL-------------------------------EVAGRHRWV
A0A3Q3K6I5_BCL2L11      IGDDYNNHLL-------------------------------ELADRRRRV
A0A3Q3ESW6_BCL2L11      IGDDYNRLLLW------------------------------RMAGRHGRP
A0A3Q2SZH6_BCL2L11      IGDEYNNHLM-------------------------------RMAGRQQRD
A0A3B3VNE0_BCL2L11      IGDDYNNHLMVR-----------------------------RMARRHQRN
A0A3B3YII5_BCL2L11      IGDDYNNHLM-------------------------------RMARRHQRN
A0A3B3YII5_BCL2L11      IGDDYNNHLM-------------------------------RMARRHQRN
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      IGDEYNRLLLLR-----------------------------RMAGRPRRN
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      IGDEYNNLLMGR-----------------------------RMARGHQRN
A0A3B5QAM1_BCL2L11      IGDEYNNLLMGR-----------------------------RMARGHQRN
A0A3B4BVX1_BCL2L11      IGDEFNELYFHG------------------------------VSQLHGCV
Q9GL49_PMAIP1-01        NTQTNPTRV--A------------------------------LPPDPEVE
A0A3B1IH05_BAD-01       MSDEFDKGLEQG------------------------------MKRVRSAG
H3ANP3_BAD-01           MSDEFDMSF-LG------------------------------LPRPKSAG
H3ANP3_BAD-02           MSDEFDMSF-LG------------------------------LPRPKSAG
H3ANP3_BAD-03           MSDEFDMSF-LG------------------------------LPRPKSAG
A0A3B3QX41_BAD-01       MSDEFDTLLDKG------------------------------MKRVRSAG
A0A2I3TBK7_BAD-01       LPVTFAPHP-ET------------------------------PPVPTALG
A0A2I2Z8C7_BAD-03       LPVTFAAHP-ET------------------------------PPVPTALG
A8MXU7_BAD-03           LPVTFAPHP-ET------------------------------PPVPTALG
A0A2K5M0A7_BAD-02       LPVTFAPRP-ET------------------------------PPALTVLV
A0A2K5XJR2_BAD-02       LPVTFAPRP-ET------------------------------PPALTVLV
A0A2K5VCA9_BAD-02       LPVTFAPRP-ET------------------------------PPALTVLV
A0A2K6E7I4_BAD-02       LPVTFAPRP-ET------------------------------PPALTVLV
A0A2K5HKU7_BAD-02       LGL-WRPGV-AT------------------------------APTPRGRR
A0A2K6N196_BAD-02       LGL-WRPGV-AT------------------------------APTPRGRR
A0A2K6PUL3_BAD-02       LGL-WRPGV-AT------------------------------APTPRGRR
A0A2K5M0A7_BAD-03       LGL-WRPGV-AT------------------------------APTPRGRR
A0A2K5VCA9_BAD-03       LGL-WRPGV-AT------------------------------APTPRGRR
A0A096MLD5_BAD-02       LGL-WRRGV-AT------------------------------APTPRGRR
A0A2K6E7I4_BAD-03       LGL-WRPAV-AT------------------------------APTPRGRR
A8MXU7_BAD-04           LGL-WRSGV-AT------------------------------APTPRGRR
A0A2I3TBK7_BAD-03       LGL-WRSGV-AT------------------------------APTPRGRR
A0A2R8Z688_BAD-03       LGL-WRSGV-AT------------------------------APTPRGRR
A0A2K5E6A6_BAD-03       VPC-W---V-AT------------------------------APTPQGRR
A0A2K5PDB1_BAD-03       LGL-WRPGV-AT------------------------------DRTPQGRR
A0A2K6TG62_BAD-03       LEP-WRHGV-AT------------------------------ARTPQGRR
G3VRY3_BAD-01           MSDEFHCTF-KG------------------------------LPRPKSAG
G3VRY3_BAD-02           MSDEFHCTF-KG------------------------------LPRPKSAG
G1P8C5_BAD-01           MSDEFQGSFKKG------------------------------LPRPKSAG
A0A452ER54_BAD-02       MSDEFHVSF-KG------------------------------LPRPKSAG
W5P8G9_BAD-01           MSDEFHVSF-KG------------------------------LPRPKSAG
G3TP47_BAD-01           MSDEFQGYF-KG------------------------------LPRPKSAG
A0A1U7Q4V0_BAD-01       MSDEFEGSF-KG------------------------------LPRPKSAG
Q61337_BAD-01           MSDEFEGSF-KG------------------------------LPRPKSAG
A0A287CT05_BAD-02       MSDEFEGSF-K---------------------------------------
A0A287CT05_BAD-01       MSDEFEGSF-KG------------------------------LPRPRSAG
O35147_BAD-01           MSDEFEGSF-KG------------------------------LPRPKSAG
A0A091DDU4_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A287AEF3_BAD-01       MSDEFQGSFKKG------------------------------LPRPKSAG
G1MI17_BAD-01           MSDEFQGSF-KG------------------------------LPRPKSAG
M3YNE7_BAD-01           MSDEFQGSF-KG------------------------------LPRPKSAG
A0A452RJM6_BAD-01       MSDEFQGSF-KG------------------------------LPRPKSAG
A0A384DJL2_BAD-01       MSDEFQGSF-KG------------------------------LPRPKSAG
A0A452ER54_BAD-01       MSDEFHVSF-KG------------------------------LPRPKSAG
F1MUT9_BAD-01           MSDEFHVSF-KG------------------------------LPRPKSAG
Q3SYZ0_BAD-01           MSDEFHVSF-KG------------------------------LPRPKSAG
F7DN67_BAD-01           MSDEFQVSF-QA------------------------------LPRPKSAG
F1PK10_BAD-01           MSDEFQGSF-KG------------------------------LPRPKSAG
Q45KI9_BAD-01           MSDEFQGSF-KG------------------------------LPRPKSAG
H0WVR2_BAD-01           MSDEFEDSFKKG------------------------------LPRPKSAG
A0A2K6GWV0_BAD-01       MSDEFEDSFKKG------------------------------LPRPKSAG
H0V608_BAD-01           MSDEFVDSF-KG------------------------------LPRPKSAG
A0A1S3FL84_BAD-01       MSDEFDGSF-KG------------------------------LPRPKSAG
A0A2K5PDB1_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A2K5E6A6_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A2K6TG62_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A0D9R491_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A2K5HKU7_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A2K5XJR2_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A2K6N196_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
A0A2K6PUL3_BAD-01       MSDEFVDSF-KG------------------------------LPRPKSAG
B4DZQ9_BAD-01           MSDEFVDSFKKG------------------------------LPRPKSAG
A0A096MLD5_BAD-01       MSDEFVDSFKKG------------------------------LPRPKSAG
A0A2I2Z8C7_BAD-01       MSDEFVDSFKKG------------------------------LPRPKSAG
A0A2I2Z8C7_BAD-02       MSDEFVDSFKKG------------------------------LPRPKSAG
A0A2R8Z688_BAD-01       MSDEFVDSFKKG------------------------------LPRPKSAG
A0A2J8TYJ3_BAD-01       MSDEFVDSFKKG------------------------------LPRPKSAG
A0A3B4DUY7_BAD-01       MSDEFDTWLDKG-----------------------------DTRRASSPG
E7FBJ6_BAD-01           MSDEFDTWLDKG-----------------------------VSK----TP
B5XEF1_BAD-01           MSDEFDTWLDKG-----------------------------VPKRGIIPR
A0A3Q3FKT9_BAD-01       MSDEFDILLDKG-----------------------------VRIKGGGGG
A0A3P9A5G8_BAD-01       MSDEFDTWLDKG-----------------------------EPKRGIIPG
A0A3P9A5G8_BAD-02       MSDEFDTWLDKG-----------------------------EPKRGIIPG
B5X1T1_BAD-01           MSDEFDTWLDKG-----------------------------EPKRGISPG
A0A3Q2QC80_BAD-01       MSDEFGSLLDKG-----------------------------ELRKVSSAG
A0A3Q3FKT9_BAD-03       MSDEFDILLDKG-----------------------------EMKKVRSPG
H3D8J8_BAD-01           MSDEFDSLLDKG-----------------------------GMRKTSSAG
A0A3B5L9R9_BAD-01       MSDEFVNLLDKG-----------------------------EMRNVSSDG
A0A3P9B2E4_BAD-01       MSDEFDSLLDKG--------------------------------------
I3K7B6_BAD-01           MSDEFDSLLDKG-----------------------------EMK------
A0A3Q3C680_BAD-01       MSDEFDSLLDKG-----------------------------EMK------
A0A3P8QRJ7_BAD-01       MSDEFDSLLDKG-----------------------------EMK------
A0A3Q4GGN3_BAD-01       MSDEFDSLLDKG-----------------------------EMK------
A0A3B4GXJ6_BAD-01       MSDEFDSLLDKG-----------------------------EMK------
A0A3Q0QNQ2_BAD-01       MSDEFDSLLDKG------------------------------MKKAKNAG
A0A3P8WI83_BAD-02       MSDEFDSLLDKG------------------------------MRKVKSAG
A0A3P8WI83_BAD-01       MSDEFDSLLDKG------------------------------MRKVKSAG
A0A3Q2D5S0_BAD-01       MSDEFVTLLDKG-----------------------------ELRKVSSTG
A0A3P9HNZ2_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVRSTG
A0A3B3BQF7_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVRSAG
A0A3Q1K1C7_BAD-02       MSDEFDSLLDKG-----------------------------EMRKVRSAG
A0A3Q1K1C7_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVRSAG
A0A3Q1GWH9_BAD-01       MSDEFDSLLDKG-----------------------------EMKRVRSAG
A0A3Q1CPU7_BAD-01       MSDEFDSLLDKG-----------------------------EMKRVRSAG
A0A3P8TWH6_BAD-01       MSDEFDSLLDKG-----------------------------EMKRVRSAG
A0A2U9BAC9_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVKSAG
A0A3B4VFC5_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVKSAG
A0A3B4W9T1_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVKSAG
Q4V925_BAD-03           MSDEF----DKG------------------------------MKRVKSAG
Q4V925_BAD-02           MSDEF----DKG------------------------------MKRVKSAG
A7MCM4_BAD-01           MSDEF----DKG-----------------------------QMKRVKSAG
Q4V925_BAD-01           MSDEF----DKG-----------------------------QMKRVKSAG
Q4V925_BAD-04           MSDEF----DKG-----------------------------QMKRVKSAG
A0A3P8Y761_BAD-01       MSDEFDTWLDKG-----------------------------QMKRVKSAG
A0A3B5Q2N7_BAD-01       MSDEFVNLLDKG-----------------------------EMRNVSSDG
A0A087X8P8_BAD-01       MSDEFVNLLDKG-----------------------------EMRKVSSTG
A0A3B3UA11_BAD-01       MSDEFVNLLDKG-----------------------------EMRKVSSTG
A0A3B3YFR1_BAD-01       MSDEFVNLLDKG-----------------------------EMRKVSSTG
A0A3P9Q7C3_BAD-01       MSDEFVNLLDKG-----------------------------EMRKVSSAG
A0A3B3HDU2_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVRSTG
A0A3P9KSL7_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVRSTG
A0A3P9KSL7_BAD-02       MSDEFDSLLDKG-----------------------------EMRKVRSTG
A0A3B5BAL2_BAD-01       MSDEFDSLLDKG-----------------------------EMKRVRSAG
A0A3Q3AEL8_BAD-01       MSDEFDSLLDKG-----------------------------EMRKVKSAG
A0A3Q3AEL8_BAD-02       MSDEFDSLLDKG-----------------------------EMRKVKSAG
G3Q8B3_BAD-01           MSDEFDSLLDKG-----------------------------EMRRVKSAG
A0A3Q2Y0E4_BAD-01       MSDEFDSLMDKG-----------------------------ELKFKSAGG
A0A3Q3R5S3_BAD-01       MSDEFDSLLDKG-----------------------------EMKRVRSAG
A0A3Q3RXS8_BAD-01       MSDEFDSLLDKG-----------------------------EMR-VRNAG
A0A3Q3RXS8_BAD-02       MSDEFDSLLDKG-----------------------------EMR-VRNAG
A0A3Q0QNQ2_BAD-02       MSDEFDSLLDKG-----------------------------MKK-AKNAG
A0A3Q3WTY4_BAD-01       MSDEF----DRQ-----------------------------EWK-TRSAG
A0A493SWX7_PMAIP1-      IGDKA--DFRQRILNLITKLFCPKT-------------------------
A0A2I3HX97_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A452TE71_PMAIP1-      FGDKL--NFRQKLLNLISKLFRSGT-------------------------
A0A452J430_PMAIP1-      IGDIC--NLQQKILNVITKLFCPGT-------------------------
A0A1D5PAR2_PMAIP1-      IGDKA--DLQQKVLNLITKLFCPKT-------------------------
A0A2K6EM90_PMAIP1-      LGDKL--HFQQKLLNLIAKLFRSGT-------------------------
G1P8F9_PMAIP1-01        IGDKL--SFLQKLLNLMYKLFGSGT-------------------------
Q9JM54_PMAIP1-03        IGDKV--NLRQKLLNLISKLFNLVT-------------------------
A0A3Q2I0H2_PMAIP1-      IGDKL--NFRQKLLNLIAKLFRSGT-------------------------
G3T0P7_PMAIP1-01        IGDKI--NFRQKLLNVICKLFCSGT-------------------------
Q1PCT2_PMAIP1-01        FGDKL--NFRQKLLNLLSKLFRSGT-------------------------
G1LIZ7_PMAIP1-01        FGDKL--NFRQKLLNLISKLFRSGT-------------------------
A0A452STA4_PMAIP1-      FGDKL--NFRQKLLNLISKLFRSGT-------------------------
A0A2K5NJZ2_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A0D9S003_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5VPX2_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6BV43_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5ZWH1_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A096MPU8_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K5JY17_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6KJF1_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6NC45_PMAIP1-      FGDKL--NFRQKLLNLIAKLFCSGT-------------------------
A0A2K6S6C4_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A2I2YVQ5_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A2R9AKC9_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A2I3SX38_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
H2NWG2_PMAIP1-01        FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A2K5CFK7_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
F7GW45_PMAIP1-01        FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A2K5QQC6_PMAIP1-      FGDKL--NFRQKLLNLISKLFCSGT-------------------------
A0A337SUX1_PMAIP1-      FGDKL--NFRQKLMNLISKLFRSGT-------------------------
A0A3Q1NFP6_PMAIP1-      IGDKL--NFRQKLVNLISKLLRSGT-------------------------
A0A452EST2_PMAIP1-      IGDKL--NFRQKLVNLIAKLLRSGT-------------------------
W5P738_PMAIP1-01        IGDKL--NFRQKLVNLIAKLLRSGT-------------------------
A0A0P0HZF9_PMAIP1-      IGDLF--DWKYKLLEIIIALQKAQTDGKR---------------------
Q0GKC8_PMAIP1-01        IGDLL--NWKYKLLELIVTLQKIQMEGKR---------------------
Q6JTU4_BCL2L11-01       IGDEFNAYYARRLEK-----------------------------------
A0A3B5RFA9_PMAIP1-      VGDKL--YWRYKLLEMLLKNYETLNKIK----------------------
                                                                          

G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A9XRH0_BMF-01           --------------------------------------------------
Q6P7C5_BAD-01           --------------------------------------------------
A3KND0_BMF-01           --------------------------------------------------
A0A2K6KS56_BBC3-02      QEEQQRHRPS----------------PWRVLYNLIMGLLPLP---RGHRA
Q2PG01_BAD-01           RPKSA-----------GTATQMRQSSSW------TRVFQSWWDRNLGRGS
A0A2I3H4B2_BAD-01       RPKSA-----------GTATQMRQSSSW------TRVFQSWWDRNLGRGS
F7G1G0_HRK-01           RARSRRAAAEAAGSGGGGLPAY---WAWLCAAAHVAALAAWL---LRRRN
A0A1U7R468_HRK-01       RARP-RDPLP------ALLPALRARWPWLCAAAQVAALAAWL---LGRRS
P62816_HRK-03           RARP-RDPLP------ALLPALRARWPWLCAAAQVAALAAWL---LGRRS
P62817_HRK-01           RARP-RDPLP------ALLPALRARWPWLCAAAQVAALAAWL---LGRRS
A0A2K5KZ69_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LSRRN
H2NIS8_HRK-01           RARSRRAPAP------SALPTY---WPWLCAAAQVAALAAWL---LGRRN
H2Q6Y8_HRK-01           RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
G3UH24_HRK-01           RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LRRRN
A0A2K5BYA0_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
U3E722_HRK-01           RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
A0A452DXE5_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
A0A0D9SC73_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
A0A3Q2IBL3_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
A0A337SQ56_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
G3QTJ6_HRK-01           RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
A0A2K6AYL7_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
G1QHD8_HRK-01           RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
G1T7W1_HRK-01           RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
H0Y001_HRK-01           RARSRRAPAP------GALTTY---WPWLCAAAQVAALAAWL---LGRRN
A0A096N944_HRK-01       RARSRRAPAP------GALPTY---WPWLCAAAQVAALAAWL---LGRRN
A0A2K6GL98_HRK-01       RARSRRAPAP------GALTTY---WPWLCAAAQVAALAAWL---LGRRN
A0A2K5PIE7_HRK-01       RARSRRAPAP------SALPTY---WPWLCAAAQVAALAAWL---LGRRN
I3LVX0_BIK-01           --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
A0A1U7QLK6_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A3Q2LHE3_BIK-02       ---------------------------HIAELPGVAVYS--LAFTYNQTG
F7FUT7_BIK-02           ---------------------------RLAQLYEVAMYSPGLAFVLDRTD
F7FUT7_BIK-01           ---------------------------RLAQLYEVAMYSPGLAFVLDRTD
O61667_EGL1-01          --------------------------------------------------
A0A3G3M2M0_BCL2L11      QL---HAPNEHAIIMWMN----------------------DLIGRVVQFF
A0A3Q1ELG4_BCL2L11      ELNDCRSCGQRKTSLTFS-----AVVFALAIVC---PCLLSFLFTVCFRF
A0A3Q1CI15_BCL2L11      EL---RLTYTREISCTFNLCNSFCTLFSVTVFCHLQSLFASTLQNVLIRF
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A3B4UNJ0_BMF-01       HQRQNL------PAWM-----------------RLTMALFGFLFPRQALV
B2KKY9_BCL2L11-01       PNEHAI------VLWM-----------------NVIIGRLVHFFLR----
B8JK68_BCL2L11-01       PNEHAI------VLWM-----------------NDIIGRLVHFFLR----
A0A3B4B6Y3_BMF-01       H-------------------------------------------------
A0A3P9ICE1_BMF-01       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
Q0GKC7_BMF-01           HQRPQD------PLWR-----------------RVATAVLTLLF------
A0A3B3RH63_BMF-01       NQRNQQ------PVWW-----------------RLVMALCGLLFER----
W5N4P7_BMF-01           NQRNHQ------PMWW-----------------RLALALFTFLFERQGNR
A0A3B1K1X5_BMF-01       NQRNQQ------PLWL-----------------RLASALYTLLFEREPAA
A0A3B4CNJ8_BMF-01       NQRNQQ------PFWL-----------------RLASALYTLLFEREPVA
A0A2U9CJH3_BMF-01       NQRNQG------PLWW-----------------RLAAALLSLLFDRGFLA
A0A3Q2YCX7_BMF-01       NQHKHK--------------------------------------------
A0A3Q2YCX7_BMF-02       NQHKHK--------------------------------------------
A0A3P8ZIE7_BMF-01       NQRNLR------PLWW-----------------RLASALLTLLWEQEAVA
A0A3Q2PJX9_BMF-02       FRSSLAAGEVGKPMYYTNVYSQCPTCWLANCLSRLAAELLILCEFPTLL-
A0A3Q3QZ16_BMF-01       NQRNQG------PLWW-----------------RLATTLLSLLFDRGFIA
A0A3Q3QZ16_BMF-02       NQRNQG------PLWW-----------------RLATTLLSLLFDRGFIA
A0A3Q2PJX9_BMF-01       NQRNQG------PLWW-----------------RMTAALLSLLLDRGFVA
A0A3Q2PJX9_BMF-03       NQRNQG------PLWW-----------------RMTAALLSLLLDRGFVA
A0A3B5QK08_BMF-01       NQRNQG------PLWW-----------------RMTAALLSLLFDRGFIA
A0A3B5QK08_BMF-02       NQRNQG------PLWW-----------------RMTAALLSLLFDRGFIA
A0A096LRV0_BMF-01       NQRNQG------PLWW-----------------RMTAALLSLLFHRGFIA
A0A3B3WU80_BMF-01       NQRNQG------PLWW-----------------RMTAALLSLLFHRGFIA
A0A3P9Q8E2_BMF-01       NQRNQG------PLWW-----------------RMTAALLSLLFDRGFIA
A0A3Q2CXC4_BMF-02       VHQHQALTLPPLPVYF-----------------SLLSPVVPL------CC
A0A3Q2CXC4_BMF-01       NQRNQG------PLWW-----------------RMTAALLSLLFDRGLIG
A0A3Q3GUU5_BMF-01       NQRNQG------PLWW-----------------RLGAALLSLLFDRGFIA
A0A3B5B8F6_BMF-01       NQRNQG------PLWW-----------------RLAAALLSLLFDRGFIA
A0A3Q3VLX6_BMF-01       NQRNQG------PLWW-----------------RLGSALLSLLFDRGFFA
A0A3P8UA78_BMF-02       NQRNHG------PLWW-----------------RLTTTLLSLLFNRGFFA
A0A3P8UA78_BMF-01       NQRNHG------PLWW-----------------RLTTTLLSLLFNRGFFA
A0A3P8UA78_BMF-03       NQRNHG------PLWW-----------------RLTTTLLSLLFNRGFFA
A0A3B3CGR9_BMF-01       NQRNQG------PLWW-----------------RLTTALVSLLLDRGFIA
A0A3P9K487_BMF-02       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3P9K487_BMF-01       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3B3HAU1_BMF-03       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3B3HAU1_BMF-02       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3B3HAU1_BMF-01       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3B3HAU1_BMF-04       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3P9ICE1_BMF-04       NQRNQG------PVWW-----------------RLATALVSLLFDRGFIA
A0A3Q2ZA20_BMF-01       NQRNQG------PLWW-----------------RLTAALLSLLFDRGFIA
A0A3P8NFE2_BMF-02       SRIQTC---------W---------------LETAEAYATPCKVHHSVIT
I3K2D6_BMF-01           NQRNQG------PMWW-----------------RLAAALLSLLFDRGFIA
A0A3P8NFE2_BMF-01       NQRNQG------PMWW-----------------RLAAAILSLLFDRGFIA
A0A3Q3C5V2_BMF-01       NQRNQG------PMWW-----------------RLAAAILSLLFDRGFIA
A0A3P9DPJ5_BMF-01       NQRNQG------PMWW-----------------RLAAAILSLLFDRGFIA
A0A3P9DPJ5_BMF-02       NQRNQG------PMWW-----------------RLAAAILSLLFDRGFIA
A0A3B4ETH0_BMF-01       NQRNQG------PMWW-----------------RLAAAILSLLFDRGFIA
A0A3Q4G1I4_BMF-01       NQRNQG------PMWW-----------------RLAAAILSLLFDRGFIA
A0A3Q1FVH7_BMF-02       NQRNQG------PLWW-----------------RLVAAILSLLFDGGFIA
A0A3Q1FVH7_BMF-01       NQRNQG------PLWW-----------------RLVAAILSLLFDGGFIA
A0A3Q3RVI2_BMF-01       ------------QVGW---------------APETSGSLPVLLACLTLIT
A0A3Q1D1K3_BMF-01       NQRNQG------PLWW-----------------RLAAAVLSLLFDRGFIA
A0A3P8RKY9_BMF-01       NQRNQG------PLWW-----------------RLAAAVLSLLFDRGFIA
A0A3Q3RVI2_BMF-02       NQRNQG------LLWW-----------------RLATALLSLLFDRGFIA
A0A3Q1IPR4_BMF-01       NQRNQG------PLWW-----------------RLAAAMLSLLFDRGLIA
A0A3B4U5H8_BMF-01       NQRNQG------PLWW-----------------RLAVALLSLLFDRGLIA
A0A3B4WM88_BMF-01       NQRNHG------PLWW-----------------RLAAALLSLLFDRGLIA
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      RSSWLHVRMGEVEQQEIV--------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       PFPRPGSVAGGVCLVGAVQLGIKVTFFTLFSF------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
C1C3S9_BAD-01           --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A452IFQ4_BAD-01       --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       ITYM----------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      CTFNLCNSFCTLFSVTVFCHLQSLFASTLQNVLIRFINPNYFSTFWKRC-
A0A3B1JLM2_BAD-01       R----------------------------------HTNRGWFSFLWGTKE
Q61337_BAD-05           T-------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A2I3HWI8_BBC3-03      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A3Q2GWE8_BBC3-02      R------------------------PSPWRVLYNLIMGLLPLPRGRAAPE
A0A2K6STD6_BBC3-02      R------------------------PSPWRVLYNLIMGLLPFPRGHRAPE
A0A2R8MW85_BBC3-02      R------------------------PSPWRVLYNLIMGLLPFPRGHRAPE
A0A2K5QNS7_BBC3-02      R------------------------PSPWRVLYNLIMGLLPFPRGHRAPE
A0A2K6FQZ1_BBC3-04      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2R9BZA9_BBC3-01      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2I3RGH5_BBC3-03      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2K5P2T8_BBC3-03      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2K5V8J3_BBC3-03      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2K6ASP2_BBC3-03      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2I3N2Z9_BBC3-03      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2K6QZT2_BBC3-04      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
F7GL32_BBC3-02          L-------------------------SPWRLLYNLISGLLAPQRRNRMPD
F7GL32_BBC3-01          L-------------------------SPWRLLYNLISGLLAPQRRNRMPD
J9NTK9_BBC3-01          RWDFPPGRGLRAAPPDVRQLLPGAAGSRWGQAGGMGDGPTDLPKGPRRGW
F1RM01_BBC3-04          RWDFPRGGGWGRPS----QMCGSCCPARRGRAGDRQVGGAACPRSHRKAR
G3T2N1_BBC3-01          R------------------------PSPWRVLYNLIMGLLPLPRDHGAPE
A0A250YBU3_BBC3-01      R------------------------PSPWRVLYNVIMGLLPLPRGPGAPE
M3Y0R3_BBC3-01          R------------------------PSPWRVLYNLIMGLLPLPRGRGAPE
A0A1U7R5N5_BBC3-01      R------------------------PSPWRVMYNLFMGLLPLPRDPGAPE
Q99ML1_BBC3-02          R------------------------PSPWRVMYNLFMGLLPLPRDPGAPE
Q80ZG6_BBC3-01          R------------------------PSPWRVMYNLFMGLLPLPRDPGAPE
H0XQ00_BBC3-01          R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A0D9S2H2_BBC3-01      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
B4DQK3_BBC3-01          R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A250YBU3_BBC3-02      R------------------------PSPWRVLYNVIMGLLPLPRGPGAPE
A0A3Q1LXZ6_BBC3-01      R------------------------PSPWRVLYNLIMGLLPFPGGRGAPE
A0A452E3G1_BBC3-01      R------------------------PSPWRVLYNLILGLLPFPGGRGAPE
F1RM01_BBC3-03          R------------------------PSPWRVLYNLIMGLLPLPRGRGAPE
A0A2I3RGH5_BBC3-01      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
H2NZD3_BBC3-01          R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2K6QZT2_BBC3-01      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A2K6FQZ1_BBC3-01      R------------------------PSPWRVLYNLIMGLLPLPRGHRAPE
A0A337SAW2_BAD-01       T------------------------QMRQSPSWTRFIQSWWDRNLGRGGS
A0A2R8MW85_BBC3-03      R------------------------PSPWRVLYNLIMGLLPFPRGHRAPE
C1KGB6_BCL2L11-02       F------------------------SPHTLPPPYI---------------
C1KGB6_BCL2L11-03       --------------------------------------------------
C1KGB6_BCL2L11-01       A------------------------EAHPQMVILRLLRYIARLVWRMQ--
J9NWV6_BCL2L11-01       A------------------------EAHPQMIILRLLRYIVRLVWRLQ--
A0A3Q2GRS5_BCL2L11      A------------------------EAHPQMIILRLLRYIIRLVRRLQ--
A0A3Q2GRS5_BCL2L11      A------------------------EAHPQMIILRLLRYIIRLVRRLQ--
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A493T7X1_BMF-01       V-------------------------LWTPLCCSLPCEAGSSCPTLSKES
A0A452H3N6_BMF-01       Q-------------------------VWWQILLFI------HNLALNVEV
A0A287AIU8_BMF-02       R-------------------------VWWQILLFL------HNLALHGDE
G1PAU1_BMF-01           R-------------------------MWWQFLLFL------HNLALNGDE
A0A287AIU8_BMF-01       R-------------------------VWWQILLFL------HNLALHGDE
A0A1U8CPE0_BMF-02       R-------------------------AWWQVFLFL------QNLALNREE
A0A286XXB0_BMF-03       R-------------------------AWWQVLLFM------HNLGLNGEE
A0A287CXH0_BMF-02       R-------------------------VWWQILLFL------HNLALNGDE
A0A1S3EQA2_BMF-02       R-------------------------AWGQVLLFL------HNLALNR-E
A2AV74_BMF-02           R-------------------------AWWQVFLFL------QNLALNRQE
H9GL49_BMF-01           Q-------------------------VWWQIFFFL------HNVALNMEA
A0A3Q2UCA0_BMF-02       G-------------------------RWGLSYLRVVLQKTGSRLRLSRLL
A0A3Q2UCA0_BMF-01       G-------------------------RWGLSYLRVVLQKTGSRLRLSRLL
K7FRX2_BMF-01           Q-------------------------VWWQILLFL------HNLALNVEA
U3JS06_BMF-01           Q-------------------------VWWQLFLFL------HNLALNTEV
A0A493T7X1_BMF-02       Q-------------------------VWWQLFLFL------HNLALNVEA
A0A3Q2UCA0_BMF-03       Q-------------------------VWWQLFLFL------HNLALNVEA
A0A3Q2UCA0_BMF-04       Q-------------------------VWWQLFLFL------HNLALNVEA
G1NHG8_BMF-01           Q-------------------------VWWQLFLFL------HNLALNVEA
A0A337ST43_BMF-02       --------------------------------------------------
A0A2K5KGP2_BMF-01       T-------------------------LCLVKLFFC------CYFAF----
A0A2K6FFN3_BMF-02       --------------------------------------------------
A0A2K5E1Q4_BMF-02       --------------------------------------------------
A0A2K5RN49_BMF-02       --------------------------------------------------
A0A2K6TW78_BMF-03       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2I2Z168_BMF-02       --------------------------------------------------
A0A2R9BS98_BMF-02       --------------------------------------------------
A0A2J8QDD5_BMF-01       --------------------------------------------------
A0A2K5MJW4_BMF-01       --------------------------------------------------
A0A2K5VLE9_BMF-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       --------------------------------------------------
A0A2K5Z4A9_BMF-02       --------------------------------------------------
A0A096NTE9_BMF-03       --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A1S3EQA2_BMF-01       R-------------------------AWGQVLLFL------HNLALN-RE
Q8K589_BMF-01           R-------------------------AWRQVFLFL------QNLALNRRE
A0A337ST43_BMF-05       E-------------------------FWPRLL------------------
A0A337ST43_BMF-04       R-------------------------VWWQILLFL------HNLALNAEE
A2AV74_BMF-01           R-------------------------AWWQVFLFL------QNLALNRQE
A0A286XXB0_BMF-02       R-------------------------AWWQVLLFM------HNLGLNGEE
G3WDQ2_BMF-01           H-------------------------VWWQILLFL------HNLALNREE
G3T7Z4_BMF-01           P-------------------------AWRQILQFL------HHLAVNGEE
A0A287CXH0_BMF-01       R-------------------------VWWQILLFL------HNLALNGDE
A0A1S3WU31_BMF-01       P-------------------------VWWPFLLFL------HNLALNEGE
A0A337ST43_BMF-03       R-------------------------VCW---------------------
A0A337ST43_BMF-01       R-------------------------VWWQILLFL------HNLALNAEE
A0A1U8CPE0_BMF-01       R-------------------------AWWQVFLFL------QNLALNREE
G1SR62_BMF-01           R-------------------------VWWQILLFL------HNLALNGDE
M3YAD5_BMF-01           R-------------------------VWWQILLFL------HNLALNADE
U6CSY8_BMF-01           R-------------------------VWWQILLFL------HNLALNADG
A0A452SED0_BMF-01       R-------------------------VWWQILLFL------HNLALNADE
A0A384D070_BMF-01       R-------------------------VWWQILLFL------HNLALNADE
W5QFV1_BMF-01           R-------------------------MWWQILLFL------HNVALNGDE
L8IXF5_BMF-01           R-------------------------MWWQILLFL------HNVALNGDE
A0A452F2E0_BMF-01       R-------------------------MWWQILLFL------HNVALNGDE
A0A452F2E0_BMF-02       R-------------------------MWWQILLFL------HNVALNGDE
Q05KI3_BMF-02           R-------------------------MWWQILLFL------HNVALNGDE
Q05KI3_BMF-01           R-------------------------MWWQILLFL------HNVALNGDE
A0A2K6FFN3_BMF-01       R-------------------------MWWQILLFL------HNLALNGEE
H0WYH6_BMF-01           R-------------------------VWWQVLFFL------HNLALNGEE
A0A096NTE9_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K6L919_BMF-02       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K5E1Q4_BMF-01       R-------------------------VWWQVLLFL------HNLALNGEE
A0A2K6TW78_BMF-01       R-------------------------VWWQVLLFL------HNLALNGEE
A0A2K6TW78_BMF-02       R-------------------------VWWQVLLFL------HNLALNGEE
A0A2K5RN49_BMF-01       R-------------------------VWWQVLLFL------HNLALNGEE
A0A2I2Z168_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A2R9BS98_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A2J8QDD5_BMF-02       R-------------------------VWWQILLFL------HNLALNGEE
A0A2J8T301_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
F7CM09_BMF-01           R-------------------------VWWQILLFL------HNLALNGEQ
A0A2K5MJW4_BMF-02       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K5KGP2_BMF-02       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K5VLE9_BMF-02       R-------------------------VWWQILLFL------HNLALNGEE
F7CM09_BMF-03           R-------------------------VWWQILLFL------HNLALNGEQ
F7CM09_BMF-02           R-------------------------VWWQILLFL------HNLALNGEQ
A0A2K6B5F6_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K6B5F6_BMF-02       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K6B5F6_BMF-04       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K5Z4A9_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K6L919_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K6L919_BMF-03       R-------------------------VWWQILLFL------HNLALNGEE
A0A2K6RAW1_BMF-01       R-------------------------VWWQILLFL------HNLALNGEE
A0A0D9R4R5_BMF-01       R-------------------------MWWQILLFL------HNLALNGEE
J9PB65_BMF-04           R-------------------------VWWQILLFL------HNLALNADE
J9PB65_BMF-03           R-------------------------VWWQILLFL------HNLALNADE
J9PB65_BMF-02           R-------------------------VWWQILLFL------HNLALNADE
J9PB65_BMF-01           R-------------------------VWWQILLFL------HNLALNADE
A0A3Q2HR24_BMF-01       R-------------------------VWWQTLLFL------HNLALNGDE
A0A3Q2HR24_BMF-02       R-------------------------VWWQTLLFL------HNLALNGDE
A0A2I2YVQ5_PMAIP1-      FEERL--------------------------------HCNWEECEGAFMG
A0A2I3SX38_PMAIP1-      FEERL--------------------------------HCNW---------
A0A2K5JY17_PMAIP1-      FEARL--------------------------------HCN----------
A0A2R9AKC9_PMAIP1-      FEERL--------------------------------HCNW---------
A0A2K6KJF1_PMAIP1-      FEERL--------------------------------HCNW---------
A0A2K6NC45_PMAIP1-      FEERL--------------------------------HCNW---------
A0A096MPU8_PMAIP1-      FEERL--------------------------------HCNW---------
A0A2K5ZWH1_PMAIP1-      FEERL--------------------------------HCNW---------
A0A2K5VPX2_PMAIP1-      FEERL--------------------------------HCNW---------
A0A2K6BV43_PMAIP1-      FEERL--------------------------------HCNW---------
W5QCU2_BIK-01           MYSLCFPYSHVGLRDVLRSFMVAFTNL--------RENRRLWSFLTLRDR
A0A3Q2LHE3_BIK-01       VYSLAFTYNQTGLRGVFRSFMDGLTNL--------RENIRFWSFLTRRDR
A0A452QUG1_BIK-01       MYSLAFTYNQTGLRGVLRSLMDGLTNL--------RENIRIWSFLTFRNR
A0A452V3L2_BIK-01       MYSLAFTYNQTGLRGVLRSLMDGLTNL--------RENIRIWSFLTFRNR
A0A3B4CPH6_BAD-01       ARQMH------------------------------ASPSWFTFLWSHKES
M3XHJ5_BCL2L11-01       PPSPC------------------------------PFVTRSPFFIFMRRS
G1TZR9_BIK-01           LL-VP------------------------------SYSLAFTYSQTGFTG
A0A2K5QXZ1_BIK-01       LYEVA------------------------------MYSPGLAVTLDQT-D
O70337_BIK-04           LPGIA------------------------------IHRLAVTY---SRTG
O70337_BIK-02           LPGIA------------------------------IHRLAVTY---SRTG
O70337_BIK-01           LPGIA------------------------------IHRLAVTY---SRTG
Q925D2_BIK-01           LPGIA------------------------------MHRLAATY---SQTG
A0A1S3FUQ7_BIK-01       LPGMA------------------------------IHSLALTY---SQMG
H0XAE7_BIK-01           LSRMT------------------------------MHSLG--LSYNQTDG
A0A2K6FM79_BIK-01       LPGMT------------------------------MHSLGLALSCDQPVR
H0W025_BIK-01           LPGRA------------------------------VHSLAITY---SQMG
A0A2K5CLG5_BIK-01       LYEVA------------------------------MYSPGLAFILDRT-D
A0A2K6TBD7_BIK-01       LYEVA------------------------------TYSPGLAFILDRT-D
H2P4N6_BIK-01           LPEVA------------------------------MHSLGLAFIYDQTED
G1S1X2_BIK-01           LSEVA------------------------------MHSLGLAFIYDQTED
G3QCT2_BIK-01           LSEVA------------------------------MHSLGLAFIYDQTED
A0A2R8ZXD2_BIK-01       LSDVA------------------------------MHSLGLAFIYDQTED
H2QLU7_BIK-01           LSDVA------------------------------MHSLGLAFIYDQTED
A0A2K6MCW0_BIK-01       LSEVA------------------------------MHSLGLAFIYDQTDD
A0A2K6QK74_BIK-01       LSEVA------------------------------MHSLGLAFIYDQTDD
A0A0D9QZY8_BIK-01       LSEVA------------------------------MHSLGLAFIYDQTDD
A0A2K5VW94_BIK-01       LSEVA------------------------------MHSLGLAFIYDQMDD
A0A2K6DBJ4_BIK-01       LSEVA------------------------------MHSLGLAFIYDQMDD
A0A2K5J4Q7_BIK-01       LSEVA------------------------------MHSLGLAFIYDQTDD
A0A096NKG5_BIK-01       LSEVA------------------------------MHSLGLAFIYDQTDD
A0A2K5LDM6_BIK-01       LSEVA------------------------------MHSLGLAFICDQTDD
A0A2K5XSA1_BIK-01       LSEVA------------------------------MHSLGLAFIYDQTDD
A0A3P8XIA2_BCL2L11      -VAQANLPQMHQEPAFL-------------------LWMGLLIGRLLQII
G1LNV7_BBC3-01          PSPW----------------------------------RVLYNLIMGLLP
A0A2K5F6X4_BBC3-02      PSPW----------------------------------RVLYNLIMGLLP
F1RM01_BBC3-02