Dataset for protein Bmf of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrgglslqseaghiwggcrpqwyfitrsfvisvrpifsgvqgprvfvtldpgaepwhh
                        c a  s  pa  aaa h p sa  p e  psg hepq eakgerkggvlqvr sgr
                                                       f                        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               ::*:                                            .
--------------mep--cvee-------lEDDVFqpedgepg-qpgs-lsadlfaqs--ldcplsrlqlfplthccgp
dseartlswshpge---pq-mdddyssldge   esd-----t----l---------qs-------------pnkwrt
gqhpec hcvfa   drsryl         d     hakefglaa  restatgi tpnl ys l ghfh   faqs hs
    d    tp       s                 vt  v svg  qrmvppnp v            r    s f   
         i        h                       f s   gv  st                    l     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    :                                           
glRptsqEdkaTQTlgPaspsqgvMLPCGVtEEPqrLFYgnAgyrlpl-p-asfplvlplgeqppe--------------
tfqeikcqhrg e ps-slapnng  l rlaqd rp   ap-efkshfpvsvhpeaggd-earrqqsseeeqngmerlpq
pvkhpey e q   atrgqvlhds     iskq hq   -s -p--rv - -r-a----i---qag rtaqrrrlqqrq 
aa karf          -psqgsn      ga   h   r-  -lv--    gs-qipnfqveehd ddmmhssrapq  
si qv            pvqt         v         h  l  ca    d v ashqdts-r-  ggdeqq  he  
 s d             d  r                         l     - s drshrq s-a      g       
                 v                            s     n   neerll lt               
                 t                                      s atap gg               
                                                           pmd                  
                                                           a                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------gqw-qhraEvqiarklq------------------------ciadqfhrlhlqq----------------
qqqqqqrqqrqcpvarsv-acrgqp--                        l-g-----erm-l                
         lprfaew-r qew-g-qv                        -l-cp yw--vl-                
         qhprq-l t ir- -se                         r      qdq- r                
         pehqlva l -sv h                           m      mg i                  
          ---ppq m  -                              i         t                  
          rg m - -                                           f                  
           e     i                                                              
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------h------qqnq---n------rvww-----------------qlllfl------hnlalnreenrng
             y      hr-rrnqg      pl--               l riaaa-vlqktgls-lfdggfiag-
             -      --h-qsh-      --yg                 -----i      --v---------r
             v      gsfhhqld      qmcr                 pvtttv      vtfrvhadavtea
             r      slga kgr      ga l                 lmfssm      qr g evqlfkdh
                    ree    q       r                   etyfr       sp   setvl h 
                    mc     l       f                    svm        yg     sqp v 
                           k                            fg         f      rp  a 
                           a                                       c      lg    
                                                                                

       410       420       430       440       450         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
agpr-------------------------------------------------------
g-agrrtwvrsvvkplqslqlrfwrlsrnlpcsgrqqttlpq  w              
-r--qsqsnggdrrlcags islsp lp   a l   d      g              
vagwtllgqfar  k       c                                    
twqspcpa   p                                               
lfrdc      f                                               
w ee                                                       
r y                                                        
k                                                          
                                                           
© 1998-2020Legal notice