Dataset for protein Bmf of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtrtspgqkkrprwewlwegpgrrgglslqseaghiwggcrpqwyfitrsfvisvrpifsgvqgprvfvtldpgaepwhh
                        c a  s  pa  aaa h p sa  p e  psg hepq eakgerkggvlqvr sgr
                                                       f                        
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               ::*:                                            .
--------------mep--cvee-------lEDDVFqpedgepg-qpgs-lsadlfaqs--ldcplsrlqlfplthccgp
dseartlswshpge---pq-mdddyssldge   esd-----t----l---------qs-------------pnkwrt
gqhpec hcvfa   drsryl         d     hakefglaa  restatgi tpnl ys l ghfh   fays hs
    d    tp       s                 vt  v svg  qrmvppnp v            r    sqf   
         i        h                       f s   gv  stf                   l     
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    :                                           
glRptsqEDkaTQTlgPaspsqgvMLPCGVtEEPqrLFYgnAgyrlplp-asfplvlplgeqppe---------------
tfqeikcqhrg e ps-slapnng  l rlaqd rp   ap-efkshfvpvhpeaggd-earrqqsseeeqngmeqlpqq
pvkhpey e q   atrgqvlhds     iskq hq   rsv-p--rv-s-r-a----i---qag rtaqrrrlqrrq  
aa karf          -psqgsn      ga   h    -  ll --   gs- ipnfqve-hd ddmmpqsrapq   
si qv            tvqt         v         h  -  la   d v ashqdtser-  ggdhgq  he   
 s d             p  r                         cs   - s drehrq ltp  a  e         
                 d                            s    n   nearll g-a               
                 v                                     s  pad  g                
                                                          am   e                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------gq--qhraEvqiarklqciadqfhrlhlqq-----------------------------h------qqnq
qqqqqrqqrqqpwvarsv-acrgqp--l-g-----erm-l                             y      hr-r
        lhpcfaew-t qew-g-qv-l-cp yw--vl-                             -      --h-
        qrr-rq-l r ir- -se r      qdq-hr                             v      gefh
        p ehqlva l -sv h   m      mg i                               r      rsg 
          -g ppq m  -      i         t                                      sle 
           r m - -                                                          mh  
                 i                                                          kc  
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---n------r-------------------vww-----------------qlllfl------hnlalnr-enrngagpr-
rnqg      p                   l--                 riaaa-vlqktgls-lfdgegfia-g-gag
sqh-      -                   -yl                 -----i      --v----d----r-r--q
hknd      q                   mcg                 pvtttv      vtfr haqalvehvkqgt
  lq      t                   a r                 lmfsrm      qrpg evlvpfdatfrwp
  gr      g                   r                   etyf        sp c strq lt r asd
   l                          f                    svm        yg    e t kh l yec
   k                                               fg         f       s    w wv 
   a                                                          c       l         

       410       420       430       440       450     
....:....|....:....|....:....|....:....|....:....|....:
                                                       
-------------------------------------------------------
rrwsvgsvrplqslqlsfwrlvrnlpcsgtnqdtslqp wl              
qtqnravdklka spirlsp sp   a lr         g               
lplvgvpt  c  g   c   le                                
c g   fr                                               
                                                       
                                                       
                                                       
                                                       
© 1998-2020Legal notice