Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

226 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A0F8AD62_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A1S3P5K4_BMF-01      --------------------------------------------------
A0A1S3SNN2_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A1S3P5K4_BMF-02      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A673TA87_BMF-01      CFQGKVRTFVTVPGSRPARDLGLHSPLAGRGRDAREAGPHQLFAGCPERA
A0A287AIU8_BMF-02      --------------------------------------------------
A0A7N5JI49_BMF-02      --------------------MPRAGVFWKQYRAVHSGLLPRQPASCRRRP
A0A7N5JI49_BMF-01      -------------------MFPR-----------EAGLFPSFPIE-----
G1PAU1_BMF-01          --------------------------------------------------
Q91ZE9_BMF-02          --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A4X1UQ42_BMF-01      --------------------------------------------------
A0A4X1UQ42_BMF-02      --------------------------------------------------
A0A7N5JI49_BMF-03      --------------------------------------------------
A0A671DWL6_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A6I8NF73_BMF-01      ---MKWPWPGRRYGCARSLSAGRMELSQYEEE------------------
A0A493T7X1_BMF-01      -----------------------MDRPSYL--------------------
A0A670JUU6_BMF-02      -----------------------MDSPDYL--------------------
A0A670JUU6_BMF-04      ---MNSYIEVTLTSVGMDLFPGEMDSPDYL--------------------
A0A674GIP8_BMF-03      -----------------------MDRPSYL--------------------
A0A7M4FPU2_BMF-01      -----------------------MDPSSYL--------------------
K7FRX2_BMF-01          -----------------------MDPPSYL--------------------
A0A3Q2UCA0_BMF-01      -----------------------MDRPSYL--------------------
A0A3Q2UCA0_BMF-02      -----------------------MDRPSYL--------------------
A0A669PL85_BMF-02      -----------------------MDRPSYL--------------------
A0A663MPI8_BMF-01      -----MLLSCLSCFLKCPFIAGAMDRPSYL--------------------
A0A674GIP8_BMF-02      -----------------------MDRPSYL--------------------
U3JS06_BMF-01          -----------------------MDRPSYL--------------------
A0A674GIP8_BMF-01      -----------------------MDRPSYL--------------------
A0A803YBD7_BMF-01      -----------------------MDRPSYL--------------------
A0A663DZQ4_BMF-01      -----------------------MDRPSYL--------------------
A0A672V891_BMF-01      -----------------------MDRPSYL--------------------
A0A493T7X1_BMF-02      -----------------------MDRPSYL--------------------
A0A3Q2UCA0_BMF-03      -----------------------MDRPSYL--------------------
A0A3Q2UCA0_BMF-04      -----------------------MDRPSYL--------------------
A0A669PL85_BMF-01      -----------------------MDRPSYL--------------------
A0A670XMZ5_BMF-01      -----------------------MDPPVYL--------------------
A0A803SZ00_BMF-02      -----------------------MDPPGYL--------------------
A0A803SZ00_BMF-01      -----------------------MDPPGYL--------------------
A0A803SZ00_BMF-03      -----------------------MDPPGYL--------------------
A0A670JUU6_BMF-01      ---MNSYIEVTLTSVGMDLFPGEMDSPDYL--------------------
A0A670JUU6_BMF-05      -----------------------MDSPDYL--------------------
A0A670JUU6_BMF-03      -----------------------MDSPDYL--------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
F7HZL0_BMF-01          -----------MPRAGVFWKQYRTVRSGLLPPRPASAVAAALCLRLPPPA
A0A337ST43_BMF-04      ---MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFI
A0A337ST43_BMF-05      ---MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFI
F7HZL0_BMF-03          --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          -----------MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHR
A0A287CXH0_BMF-01      -----------MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLP-
G3T7Z4_BMF-01          -----------MPRAGVFWKQYRTVLSLVHQRPPALAAAA--VRSPRLPP
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
A0A5F4CJ04_BMF-03      --------------------------------------------------
A0A5F4CJ04_BMF-02      --------------------------------------------------
A0A5F4CJ04_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-02      ---------------------------------------------MPGAG
Q96LC9_BMF-06          --------------------------------------------------
F7HZL0_BMF-02          --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
A0A7N9CRT3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A7N9CRT3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
A0A7N9CRT3_BMF-03      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A4W2EII1_BMF-01      --------------------------------------------------
A0A4W2EII1_BMF-01      --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
A0A4W2INA4_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A4W2INA4_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
                                                                         

Q96LC9_BMF-09          -----------------------------------------------MEP
Q96LC9_BMF-08          -----------------------------------------------MEP
A3KND0_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      ------------------------------------MCLSGISGHSSYSA
A0A671M0H4_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A0F8AD62_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A1S3P5K4_BMF-01      --------------------------------------------------
A0A1S3SNN2_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A1S3P5K4_BMF-02      --------------------------------------------------
A0A6F9B4C5_BMF-01      -------------------------------------MFRIHIDLKVLAD
A0A6F9BGV6_BMF-01      ----------------------------------MQGHPLPQLSKQDLAD
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          -----------------------------------------------MDR
A0A803YBD7_BMF-02      -----------------------------------------------MDR
A0A672RK14_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A4W3JXA1_BMF-01      ------------------------------------------------MD
A0A452H3N6_BMF-01      -----------------------------------------------MDP
A0A674IPL3_BMF-01      -----------------------------------------------MDP
A0A673TA87_BMF-01      YFGNNTARATVASTRASPPAAAAAPASASRHPPQPAGLFPSFPIESGRQA
A0A287AIU8_BMF-02      -----------------------------------------------MEP
A0A7N5JI49_BMF-02      CPCLPPPATRRGPWAPSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEP
A0A7N5JI49_BMF-01      -------------WAPSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEP
G1PAU1_BMF-01          -----------------------------------------------MEP
Q91ZE9_BMF-02          ------------------------------------------MSPGEMEP
A0A287AIU8_BMF-01      -----------------------------------------------MEP
A0A4X1UQ42_BMF-01      -----------------------------------------------MEP
A0A4X1UQ42_BMF-02      -----------------------------------------------MEP
A0A7N5JI49_BMF-03      ----------------------------------MRAWWLLLRAVREMEP
A0A671DWL6_BMF-02      --------------------------------------MPYYALTGEMEP
A0A286XXB0_BMF-03      ------------------------------------------VFPREMEP
A0A287CXH0_BMF-02      ------------------------------------------VFPEEMEP
A0A6I8NF73_BMF-01      -----------------------------------------------LEE
A0A493T7X1_BMF-01      -----------------------------------------------EED
A0A670JUU6_BMF-02      -----------------------------------------------EED
A0A670JUU6_BMF-04      -----------------------------------------------EED
A0A674GIP8_BMF-03      -----------------------------------------------EED
A0A7M4FPU2_BMF-01      -----------------------------------------------EED
K7FRX2_BMF-01          -----------------------------------------------EED
A0A3Q2UCA0_BMF-01      -----------------------------------------------EED
A0A3Q2UCA0_BMF-02      -----------------------------------------------EED
A0A669PL85_BMF-02      -----------------------------------------------EED
A0A663MPI8_BMF-01      -----------------------------------------------EED
A0A674GIP8_BMF-02      -----------------------------------------------EED
U3JS06_BMF-01          -----------------------------------------------EED
A0A674GIP8_BMF-01      -----------------------------------------------EED
A0A803YBD7_BMF-01      -----------------------------------------------EED
A0A663DZQ4_BMF-01      -----------------------------------------------EED
A0A672V891_BMF-01      -----------------------------------------------EED
A0A493T7X1_BMF-02      -----------------------------------------------EED
A0A3Q2UCA0_BMF-03      -----------------------------------------------EED
A0A3Q2UCA0_BMF-04      -----------------------------------------------EED
A0A669PL85_BMF-01      -----------------------------------------------EED
A0A670XMZ5_BMF-01      -----------------------------------------------EDD
A0A803SZ00_BMF-02      -----------------------------------------------DDD
A0A803SZ00_BMF-01      -----------------------------------------------DDD
A0A803SZ00_BMF-03      -----------------------------------------------DDD
A0A670JUU6_BMF-01      -----------------------------------------------EED
A0A670JUU6_BMF-05      -----------------------------------------------EED
A0A670JUU6_BMF-03      -----------------------------------------------EED
A0A337ST43_BMF-02      -----------------------------------------------MEP
A0A2K5KGP2_BMF-01      -----------------------------------------------MEP
A0A2K6FFN3_BMF-02      -----------------------------------------------MEP
A0A2K5E1Q4_BMF-02      -----------------------------------------------MEP
A0A2K5RN49_BMF-02      -----------------------------------------------MEP
A0A2K6TW78_BMF-03      -----------------------------------------------MEP
A0A2K6RAW1_BMF-02      -----------------------------------------------MEP
A0A2I2Z168_BMF-02      -----------------------------------------------MEP
Q96LC9_BMF-05          -----------------------------------------------MEP
Q96LC9_BMF-07          -----------------------------------------------MEP
A0A2R9BS98_BMF-02      -----------------------------------------------MEP
A0A2J8QDD5_BMF-01      -----------------------------------------------MEP
A0A2K5MJW4_BMF-01      -----------------------------------------------MEP
A0A2K6B5F6_BMF-03      -----------------------------------------------MEP
A0A2K5Z4A9_BMF-02      -----------------------------------------------MEP
A0A2I3HD83_BMF-01      -----------------------------------------------MEP
F7HZL0_BMF-01          AARWAFSLLPNRVWASSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEP
A0A337ST43_BMF-04      TRSFVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEP
A0A337ST43_BMF-05      TRSFVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEP
F7HZL0_BMF-03          -----------------------------------------------MEP
Q91ZE9_BMF-06          -----------------------------------------------MEP
Q91ZE9_BMF-01          SPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEP
A0A287CXH0_BMF-01      -----------GSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEP
G3T7Z4_BMF-01          LPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEP
A0A5F8GKJ8_BMF-01      -----------------------------------------------MEP
A0A7N4PJP2_BMF-01      -----------------------------------------------MES
A0A4X2KLG2_BMF-01      -----------------------------------------------MEP
A0A3Q2HR24_BMF-02      -----------------------------------------------MEP
A0A3Q2HR24_BMF-01      -----------------------------------------------MEP
A0A5F4CJ04_BMF-03      -----------------------------------------------MEP
A0A5F4CJ04_BMF-02      -----------------------------------------------MEP
A0A5F4CJ04_BMF-01      -----------------------------------------------MEP
A0A286XXB0_BMF-02      VFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEP
Q96LC9_BMF-06          -----------------------------------------------MEP
F7HZL0_BMF-02          -----------------------------------------------MEP
A0A096NTE9_BMF-02      -----------------------------------------------MEP
A0A286XXB0_BMF-01      -----------------------------------------------MEP
A0A337ST43_BMF-03      -----------------------------------------------MEP
A0A7N9CRT3_BMF-02      -----------------------------------------------MEP
A0A2K6FFN3_BMF-01      -----------------------------------------------MEP
H0WYH6_BMF-01          -----------------------------------------------MEP
A0A2K5MJW4_BMF-02      -----------------------------------------------MEP
A0A2K5KGP2_BMF-02      -----------------------------------------------MEP
A0A7N9CRT3_BMF-01      -----------------------------------------------MEP
A0A5F7ZML1_BMF-03      -----------------------------------------------MEP
A0A5F7ZML1_BMF-02      -----------------------------------------------MEP
A0A2K6B5F6_BMF-01      -----------------------------------------------MEP
A0A2K6B5F6_BMF-02      -----------------------------------------------MEP
A0A2K6B5F6_BMF-04      -----------------------------------------------MEP
A0A2K5Z4A9_BMF-01      -----------------------------------------------MEP
A0A2K6L919_BMF-01      -----------------------------------------------MEP
A0A2K6L919_BMF-03      -----------------------------------------------MEP
A0A2K6RAW1_BMF-01      -----------------------------------------------MEP
A0A0D9R4R5_BMF-01      -----------------------------------------------MEP
A0A2K5E1Q4_BMF-01      -----------------------------------------------MEP
A0A2K6TW78_BMF-01      -----------------------------------------------MEP
A0A2K6TW78_BMF-02      -----------------------------------------------MEP
A0A2K5RN49_BMF-01      -----------------------------------------------MEP
A0A2I2Z168_BMF-01      -----------------------------------------------MEP
Q96LC9_BMF-01          -----------------------------------------------MEP
Q96LC9_BMF-02          -----------------------------------------------MEP
Q96LC9_BMF-03          -----------------------------------------------MEP
Q96LC9_BMF-04          -----------------------------------------------MEP
A0A2R9BS98_BMF-01      -----------------------------------------------MEP
A0A2J8QDD5_BMF-02      -----------------------------------------------MEP
A0A2J8T301_BMF-01      -----------------------------------------------MEP
A0A7N9CRT3_BMF-03      -----------------------------------------------MEP
A0A5F7ZML1_BMF-01      -----------------------------------------------MEP
A0A096NTE9_BMF-01      -----------------------------------------------MEP
A0A2K6L919_BMF-02      -----------------------------------------------MEP
G1SR62_BMF-01          -----------------------------------------------MEP
A0A337ST43_BMF-01      -----------------------------------------------MEP
W5QFV1_BMF-01          -------------------------------------------LTGEMEP
A0A4W2EII1_BMF-01      -----------------------------------------------MEP
A0A4W2EII1_BMF-01      -----------------------------------------------MEP
Q05KI3_BMF-01          -----------------------------------------------MEP
Q05KI3_BMF-02          -----------------------------------------------MEP
A0A4W2INA4_BMF-01      -----------------------------------------------MEP
L8IXF5_BMF-01          -----------------------------------------------MEP
A0A4W2INA4_BMF-01      -----------------------------------------------MEP
A0A452F2E0_BMF-02      -----------------------------------------------MEP
A0A452F2E0_BMF-01      -----------------------------------------------MEP
A0A667H967_BMF-01      -----------------------------------------------MEP
A0A2U4BC98_BMF-01      -----------------------------------------------MEP
A0A671DWL6_BMF-01      -----------------------------------------------MEP
M3YAD5_BMF-01          -----------------------------------------------MEP
U6CSY8_BMF-01          -----------------------------------------------MEP
A0A452SED0_BMF-01      -----------------------------------------------MEP
A0A384D070_BMF-01      -----------------------------------------------MEP
                                                                         

Q96LC9_BMF-09          SQCVEE-------LE----------DD-----------------------
Q96LC9_BMF-08          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A3KND0_BMF-01          ---MDE-------LD----------DDVFYPDA------FGYPDQTITSS
A0A3B4UNJ0_BMF-01      ---MDD-------EE----------EDMSQPI------------------
Q0GKC7_BMF-01          ---MDE-------DE----------DDVFRKG------------------
A0A673HDR4_BMF-01      ---MDE-------DE----------DDVRRKG------------------
A0A672JWL9_BMF-02      ---MDE-------DE----------DDVRRKG------------------
A0A671MNR9_BMF-01      ---MDE-------DE----------DDVRRKG------------------
A0A672JWL9_BMF-01      ---MDE-------DE----------DDVRRKG------------------
A0A3P9ICE1_BMF-01      PPRMDD-------EE----------DDVFEPD------------------
A0A671M0H4_BMF-01      ---MDE-------DE----------DDVRRKG------------------
A0A671M0H4_BMF-02      ---MDE-------DE----------DDVRRKG------------------
A0A3B4B6Y3_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A4W4DZH9_BMF-01      ---MDD-------EE----------DDVFRIA------------------
A0A3B1K1X5_BMF-01      ---MDD-------EE----------DDVFVTD------------------
A0A3B4CNJ8_BMF-01      ---MDE-------DE----------DDVFVMD------------------
A0A3B3RH63_BMF-01      ---MDD-------DD----------DDVFHTD------------------
W5N4P7_BMF-01          ---MEE-------DE----------DDVFHPSH-----------------
A0A2U9CJH3_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q2YCX7_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A3Q2YCX7_BMF-02      ---MED-------EE----------DDVFEPD------------------
A0A668TQU8_BMF-01      ---MDD-------EE----------DDVFEPK------------------
A0A3Q3VLX6_BMF-01      ---MDD-------DE----------DDVFEPE------------------
A0A3P8UA78_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3P8UA78_BMF-03      ---MDD-------EE----------DDVFEPD------------------
A0A3P8UA78_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A3B5KWG6_BMF-03      ---MDD-------EE----------DDVFQPD------------------
A0A3B5KWG6_BMF-01      ---MDD-------EE----------DDVFQPD------------------
A0A3B5KWG6_BMF-02      ---MDD-------EE----------DDVFQPD------------------
A0A3B3CGR9_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3B3HAU1_BMF-04      ---MDD-------EE----------DDVFEPD------------------
A0A3P9ICE1_BMF-04      ---MDD-------EE----------DDVFEPD------------------
A0A3P9K487_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A3B3HAU1_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3B3HAU1_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A3B3HAU1_BMF-03      ---MDD-------EE----------DDVFEPD------------------
A0A3P9ICE1_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A3P9ICE1_BMF-05      ---MDD-------EE----------DDVFEPD------------------
A0A3P9ICE1_BMF-03      ---MDD-------EE----------DDVFEPD------------------
A0A3P9K487_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A672HG10_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A673C8N3_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A3P8NFE2_BMF-02      ---MDD-------EE----------DDVFEPK------------------
I3K2D6_BMF-01          ---MDD-------EE----------DDVFEPK------------------
A0A3P8NFE2_BMF-01      ---MDD-------EE----------DDVFEPK------------------
A0A3Q3C5V2_BMF-01      ---MDD-------EE----------DDVFEPK------------------
A0A3P9DPJ5_BMF-01      ---MDD-------EE----------DDVFEPK------------------
A0A3P9DPJ5_BMF-02      ---MDD-------EE----------DDVFEPK------------------
A0A3B4ETH0_BMF-01      ---MDD-------EE----------DDVFEPK------------------
A0A3Q4G1I4_BMF-01      ---MDD-------EE----------DDVFEPK------------------
A0A3Q1FVH7_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A3Q1FVH7_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q2ZA20_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A665VG08_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q3RVI2_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q1D1K3_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3P8RKY9_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q3RVI2_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A4W6DUL1_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q1IPR4_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A0F8AD62_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A671X848_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A667YNR9_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3B4U5H8_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3B4WM88_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q3QZ16_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3Q3QZ16_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A3Q2PJX9_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A3Q2PJX9_BMF-02      ---MED-------EE----------DDVFEPD------------------
A0A3Q2PJX9_BMF-03      ---MED-------EE----------DDVFEPD------------------
A0A3B5QK08_BMF-02      ---MED-------EE----------DDVFEPD------------------
A0A3B5QK08_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A096LRV0_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A3B3WU80_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A3P9Q8E2_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A3Q2CXC4_BMF-02      ---MEE-------EE----------DDVFEPD------------------
A0A3Q2CXC4_BMF-01      ---MEE-------EE----------DDVFEPD------------------
A0A3Q3GUU5_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A3B5B8F6_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A1S3P5K4_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A1S3SNN2_BMF-01      ---MDD-------EE----------DDVFVPDS-----------------
A0A674EF64_BMF-01      ---MDD-------EE----------DDVFVPDS-----------------
A0A4W5N3A7_BMF-01      ---MDD-------EE----------DDVFVPDS-----------------
A0A4W5N721_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A0A1S3P5K4_BMF-02      ---MDD-------EE----------DDVFEPD------------------
A0A6F9B4C5_BMF-01      RRRMDD-------EE----------DDVFEPD------------------
A0A6F9BGV6_BMF-01      FCRMDD-------EE----------DDVFVPDS-----------------
A0A3P8ZIE7_BMF-01      ---MED-------EE----------DDVFEPD------------------
A0A673YQV3_BMF-01      ---MDD-------EE----------DDVFEPD------------------
A9XRH0_BMF-01          PSYLEEDYSSLDGLD----------DDVFHSDD-----------------
A0A803YBD7_BMF-02      PSYLEEDYSSLDGLD----------DDVFHSDD-----------------
A0A672RK14_BMF-01      -------------MD----------DE----ED-----------------
A0A673JJ10_BMF-01      -------------MD----------DE----ED-----------------
A0A4W3JXA1_BMF-01      LSDTEE-------LD--------SDDEVFAQDL--------TAPDSGYSD
A0A452H3N6_BMF-01      PNYLEDDYSSLDGLD----------DDVFHSDF--GLTG---QPGEMTPP
A0A674IPL3_BMF-01      PSYLEEDYSSLDGLD----------DDVFHSDF--GLTG---QPGEMTPP
A0A673TA87_BMF-01      PECSSR-------WTLARSPGITTRRRRLSPGV--TQQGRWSQPGSLLSA
A0A287AIU8_BMF-02      PQCVEE-------LE----------DDVFQPEE--GEPG--TQPRRV-SA
A0A7N5JI49_BMF-02      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A7N5JI49_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
G1PAU1_BMF-01          PQCVEE-------LE----------DDVFQPED---ELG--TQPGSLPSA
Q91ZE9_BMF-02          PQCVEE-------LE----------DDVFQSED--GEPG--TQPGGLLSA
A0A287AIU8_BMF-01      PQCVEE-------LE----------DDVFQPEE--GEPG--TQPRRV-SA
A0A4X1UQ42_BMF-01      PQCVEE-------LE----------DDVFQPEE--GEPG--TQPRRV-SA
A0A4X1UQ42_BMF-02      PQCVEE-------LE----------DDVFQPEE--GEPG--TQPRRV-SA
A0A7N5JI49_BMF-03      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A671DWL6_BMF-02      PQCVEE-------LE----------DDVFQPED--GDLG--TQPGSLPSA
A0A286XXB0_BMF-03      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A287CXH0_BMF-02      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A6I8NF73_BMF-01      LTGLEE-------LE----------DDVFHPETPVAESL--AQPGGPAPA
A0A493T7X1_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A670JUU6_BMF-02      FSNLDG-------LE----------DDVFHSED--CGLA--SQPNEMTFP
A0A670JUU6_BMF-04      FSNLDG-------LE----------DDVFHSED--CGLA--SQPNEMTFP
A0A674GIP8_BMF-03      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A7M4FPU2_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTST
K7FRX2_BMF-01          YSSLDG-------LD----------DDVFHSDD--FGLT--GQPGEMTPT
A0A3Q2UCA0_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A3Q2UCA0_BMF-02      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A669PL85_BMF-02      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A663MPI8_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A674GIP8_BMF-02      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
U3JS06_BMF-01          YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A674GIP8_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A803YBD7_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A663DZQ4_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A672V891_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A493T7X1_BMF-02      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A3Q2UCA0_BMF-03      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A3Q2UCA0_BMF-04      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A669PL85_BMF-01      YSSLDG-------LD----------DDVFHSDD--FGLA--GQPGEMTAT
A0A670XMZ5_BMF-01      FSHLDG-------LD----------DDVFHSDD--CELV--SQSSKMAFR
A0A803SZ00_BMF-02      FSTLDG-------LE----------DDVFHAED--CGLA--SQPSEMTFP
A0A803SZ00_BMF-01      FSTLDG-------LE----------DDVFHAED--CGLA--SQPSEMTFP
A0A803SZ00_BMF-03      FSTLDG-------LE----------DDVFHAED--CGLA--SQPSEMTFP
A0A670JUU6_BMF-01      FSNLDG-------LE----------DDVFHSED--CGLA--SQPNEMTFP
A0A670JUU6_BMF-05      FSNLDG-------LE----------DDVFHSED--CGLA--SQPNEMTFP
A0A670JUU6_BMF-03      FSNLDG-------LE----------DDVFHSED--CGLA--SQPNEMTFP
A0A337ST43_BMF-02      PQCVEE-------LE----------DDVFQPED--VEPG--TQPGSLLSA
A0A2K5KGP2_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6FFN3_BMF-02      SHCVEE-------LE----------DDVFQPED--GESG--TQPGSVLSA
A0A2K5E1Q4_BMF-02      SQCVEE-------LE----------DDVFQSED--GEPG--TQPGSLLSA
A0A2K5RN49_BMF-02      SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A2K6TW78_BMF-03      SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A2K6RAW1_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2I2Z168_BMF-02      SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
Q96LC9_BMF-05          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
Q96LC9_BMF-07          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A0A2R9BS98_BMF-02      SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A0A2J8QDD5_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A0A2K5MJW4_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6B5F6_BMF-03      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K5Z4A9_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2I3HD83_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
F7HZL0_BMF-01          SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A337ST43_BMF-04      PQCVEE-------LE----------DDVFQPED--VEPG--TQPGSLLSA
A0A337ST43_BMF-05      PQCVEE-------LE----------DDVFQPED--VEPG--TQPGSLLSA
F7HZL0_BMF-03          SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
Q91ZE9_BMF-06          PQCVEE-------LE----------DDVFQSED--GEPG--TQPGGLLSA
Q91ZE9_BMF-01          PQCVEE-------LE----------DDVFQSED--GEPG--TQPGGLLSA
A0A287CXH0_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
G3T7Z4_BMF-01          SQCVEE-------LE----------DDVFQPEE--GEPG--TQPGGLLSA
A0A5F8GKJ8_BMF-01      PHYVEE-------LE----------DDVFHPED--SEPG--AQPGGLTSA
A0A7N4PJP2_BMF-01      PHYVEE-------LE----------DDVFHPED--SEPG--AQPGGLTSP
A0A4X2KLG2_BMF-01      PHYVEE-------LE----------DDVFHPED--SEPG--AQPGGLTSA
A0A3Q2HR24_BMF-02      PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
A0A3Q2HR24_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
A0A5F4CJ04_BMF-03      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A5F4CJ04_BMF-02      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A5F4CJ04_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A286XXB0_BMF-02      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
Q96LC9_BMF-06          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
F7HZL0_BMF-02          SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A096NTE9_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A286XXB0_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A337ST43_BMF-03      PQCVEE-------LE----------DDVFQPED--VEPG--TQPGSLLSA
A0A7N9CRT3_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--SQPGSSLSA
A0A2K6FFN3_BMF-01      SHCVEE-------LE----------DDVFQPED--GESG--TQPGSVLSA
H0WYH6_BMF-01          SQCVEE-------LE----------DDVFQPED--GELG--T--GNVLSA
A0A2K5MJW4_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K5KGP2_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A7N9CRT3_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--SQPGSSLSA
A0A5F7ZML1_BMF-03      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A5F7ZML1_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6B5F6_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6B5F6_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6B5F6_BMF-04      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K5Z4A9_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6L919_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6L919_BMF-03      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6RAW1_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A0D9R4R5_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K5E1Q4_BMF-01      SQCVEE-------LE----------DDVFQSED--GEPG--TQPGSLLSA
A0A2K6TW78_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A2K6TW78_BMF-02      SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A2K5RN49_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A2I2Z168_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
Q96LC9_BMF-01          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
Q96LC9_BMF-02          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
Q96LC9_BMF-03          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
Q96LC9_BMF-04          SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A0A2R9BS98_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A0A2J8QDD5_BMF-02      SQCVEE-------LE----------DDVFQPED--GEPV--TQPGSLLSA
A0A2J8T301_BMF-01      SQCVEE-------LE----------DDVFQPED--GEPG--TQSGSLLSA
A0A7N9CRT3_BMF-03      SRCVEE-------LE----------DDVFQPED--GEPG--SQPGSSLSA
A0A5F7ZML1_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A096NTE9_BMF-01      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
A0A2K6L919_BMF-02      SRCVEE-------LE----------DDVFQPED--GEPG--AQPGSSLSA
G1SR62_BMF-01          PQCVEE-------LE----------DDVFQPED--GEPG--TQPQSLLSA
A0A337ST43_BMF-01      PQCVEE-------LE----------DDVFQPED--VEPG--TQPGSLLSA
W5QFV1_BMF-01          PQCVEE-------LE----------DDVFQPED--GEPG--AQPRRLLSA
A0A4W2EII1_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
A0A4W2EII1_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
Q05KI3_BMF-01          PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
Q05KI3_BMF-02          PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
A0A4W2INA4_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
L8IXF5_BMF-01          PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
A0A4W2INA4_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPRSLLSA
A0A452F2E0_BMF-02      PQCVEE-------LE----------DDVFQPED--GEPG--AQPRRLLSA
A0A452F2E0_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--AQPRRLLSA
A0A667H967_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A2U4BC98_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A671DWL6_BMF-01      PQCVEE-------LE----------DDVFQPED--GDLG--TQPGSLPSA
M3YAD5_BMF-01          PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
U6CSY8_BMF-01          PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A452SED0_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
A0A384D070_BMF-01      PQCVEE-------LE----------DDVFQPED--GEPG--TQPGSLLSA
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLR-----------------
A3KND0_BMF-01          SLFNQSQSYTCLLGRFHL---FPFSHCCGPGCRGTDN-------------
A0A3B4UNJ0_BMF-01      ------------------------SHLWGTSFRDVKY-------------
Q0GKC7_BMF-01          ------------------------LQHWPPPHLQIK--------------
A0A673HDR4_BMF-01      ------------------------LQRWPSSRVQIK--------------
A0A672JWL9_BMF-02      ------------------------LQHWPSSRVQIK--------------
A0A671MNR9_BMF-01      ------------------------LQHWPSSRVQIK--------------
A0A672JWL9_BMF-01      ------------------------LQHWPSSRVQIK--------------
A0A3P9ICE1_BMF-01      ------------------------PNKWRTTARKIKC-------------
A0A671M0H4_BMF-01      ------------------------LQRWPSS----RV-------------
A0A671M0H4_BMF-02      ------------------------LQRWPSS----RV-------------
A0A3B4B6Y3_BMF-01      ------------------------LHCWHTTFRQIKC-------------
A0A4W4DZH9_BMF-01      ------------------------AQYWPHSLREIKQ-------------
A0A3B1K1X5_BMF-01      ------------------------PEPWRSPISVIKQ-------------
A0A3B4CNJ8_BMF-01      ------------------------TQYWRSSIREIKQ-------------
A0A3B3RH63_BMF-01      ------------------------PLTYQPPFRDIKC-------------
W5N4P7_BMF-01          -----------------------FSHCWGTQFREIKY-------------
A0A2U9CJH3_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3Q2YCX7_BMF-01      ------------------------PHCWRTTFKEIKC-------------
A0A3Q2YCX7_BMF-02      ------------------------PHCWRTTFKEIKC-------------
A0A668TQU8_BMF-01      ------------------------ANCWRTTFREIKC-------------
A0A3Q3VLX6_BMF-01      ------------------------AHCWRTTFREIKC-------------
A0A3P8UA78_BMF-01      ------------------------PHSWHTTFREIRC-------------
A0A3P8UA78_BMF-03      ------------------------PHSWHTTFREIRC-------------
A0A3P8UA78_BMF-02      ------------------------PHSWHTTFREIRC-------------
A0A3B5KWG6_BMF-03      ------------------------PYSWRTTFQEIKC-------------
A0A3B5KWG6_BMF-01      ------------------------PYSWRTTFQEIKC-------------
A0A3B5KWG6_BMF-02      ------------------------PYSWRTTFQEIKC-------------
A0A3B3CGR9_BMF-01      ------------------------PNNWRTAVRKIKC-------------
A0A3B3HAU1_BMF-04      ------------------------PNKWRTTARKIKC-------------
A0A3P9ICE1_BMF-04      ------------------------PNKWRTTARKIKC-------------
A0A3P9K487_BMF-02      ------------------------PNKWRTTARKIKC-------------
A0A3B3HAU1_BMF-01      ------------------------PNKWRTTARKIKC-------------
A0A3B3HAU1_BMF-02      ------------------------PNKWRTTARKIKC-------------
A0A3B3HAU1_BMF-03      ------------------------PNKWRTTARKIKC-------------
A0A3P9ICE1_BMF-02      ------------------------PNKWRTTARKIKC-------------
A0A3P9ICE1_BMF-05      ------------------------PNKWRTTARKIKC-------------
A0A3P9ICE1_BMF-03      ------------------------PNKWRTTARKIKC-------------
A0A3P9K487_BMF-01      ------------------------PNKWRTTARKIKC-------------
A0A672HG10_BMF-01      ------------------------PRCWRTAFREIKC-------------
A0A673C8N3_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3P8NFE2_BMF-02      ------------------------ANCWRTTFREIKC-------------
I3K2D6_BMF-01          ------------------------ANCWRTTFREIKC-------------
A0A3P8NFE2_BMF-01      ------------------------ANCWRTTFREIKC-------------
A0A3Q3C5V2_BMF-01      ------------------------ANCWRTTFREIKC-------------
A0A3P9DPJ5_BMF-01      ------------------------ANCWRTTFREIKC-------------
A0A3P9DPJ5_BMF-02      ------------------------ANCWRTTFREIKC-------------
A0A3B4ETH0_BMF-01      ------------------------ANCWRTTFREIKC-------------
A0A3Q4G1I4_BMF-01      ------------------------ANCWRTTFREIKC-------------
A0A3Q1FVH7_BMF-02      ------------------------THCWRTTFREIKC-------------
A0A3Q1FVH7_BMF-01      ------------------------THCWRTTFREIKC-------------
A0A3Q2ZA20_BMF-01      ------------------------PSCWRTTFREIKC-------------
A0A665VG08_BMF-01      ------------------------PHFWRTTFREIKC-------------
A0A3Q3RVI2_BMF-01      ------------------------PHFWRTTFREIKC-------------
A0A3Q1D1K3_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3P8RKY9_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3Q3RVI2_BMF-02      ------------------------PHFWRTTFREIKC-------------
A0A4W6DUL1_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3Q1IPR4_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A0F8AD62_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A671X848_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A667YNR9_BMF-01      ------------------------LHCWRTTFREIKC-------------
A0A3B4U5H8_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3B4WM88_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A3Q3QZ16_BMF-01      ------------------------PHCWRTAFREIKC-------------
A0A3Q3QZ16_BMF-02      ------------------------PHCWRTAFREIKC-------------
A0A3Q2PJX9_BMF-01      ------------------------PNCWRTPFREIKC-------------
A0A3Q2PJX9_BMF-02      ------------------------PNCWRTPFREIKC-------------
A0A3Q2PJX9_BMF-03      ------------------------PNCWRTPFREIKC-------------
A0A3B5QK08_BMF-02      ------------------------PNCWRTPFREIKC-------------
A0A3B5QK08_BMF-01      ------------------------PNCWRTPFREIKC-------------
A0A096LRV0_BMF-01      ------------------------PNCWRTPFREIKC-------------
A0A3B3WU80_BMF-01      ------------------------PNCWRTPFREIKC-------------
A0A3P9Q8E2_BMF-01      ------------------------PNCWRTPFREIKC-------------
A0A3Q2CXC4_BMF-02      ------------------------PNSWHTPFREIKF-------------
A0A3Q2CXC4_BMF-01      ------------------------PNSWHTPFREIKF-------------
A0A3Q3GUU5_BMF-01      ------------------------PHSWRTYFQEIKC-------------
A0A3B5B8F6_BMF-01      ------------------------PHCWRTTFREIKC-------------
A0A1S3P5K4_BMF-01      ------------------------SHCWRTAFREIKY-------------
A0A1S3SNN2_BMF-01      ------------------------SHCWRTAFREIKY-------------
A0A674EF64_BMF-01      ------------------------SHCWRTAFREIKY-------------
A0A4W5N3A7_BMF-01      ------------------------SHCWRTAFREIKY-------------
A0A4W5N721_BMF-01      ------------------------SHCWRTAFREIKY-------------
A0A1S3P5K4_BMF-02      ------------------------SHCWRTAFREIKY-------------
A0A6F9B4C5_BMF-01      ------------------------FHCWRTAFREIKY-------------
A0A6F9BGV6_BMF-01      ------------------------SHCWRTAFREIKY-------------
A0A3P8ZIE7_BMF-01      ------------------------SYCWHTASREIKY-------------
A0A673YQV3_BMF-01      ------------------------SHCWRTAFREIKY-------------
A9XRH0_BMF-01          ---------------------FGLA-------------------------
A0A803YBD7_BMF-02      ---------------------FGLA-------------------------
A0A672RK14_BMF-01      ---------------------EQLPHCCETPLRNKSSENRDGRGGEVGQT
A0A673JJ10_BMF-01      ---------------------EQLPHCCETPLRNKSSENRDGPRGEVGQT
A0A4W3JXA1_BMF-01      NTSGTHESLTWRATRSRLRSPINSVHFCGPGCGRQVQ-------------
A0A452H3N6_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHAEQ-------------
A0A674IPL3_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHAEQ-------------
A0A673TA87_BMF-01      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
A0A287AIU8_BMF-02      DPFVQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A7N5JI49_BMF-02      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A7N5JI49_BMF-01      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
G1PAU1_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPISQ-------------
Q91ZE9_BMF-02          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPISQ-------------
A0A287AIU8_BMF-01      DPFVQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A4X1UQ42_BMF-01      DPFVQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A4X1UQ42_BMF-02      DPFVQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A7N5JI49_BMF-03      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A671DWL6_BMF-02      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A286XXB0_BMF-03      DLFAQSQ-LDCPLGRLHL---FPLTHCCGPGLRPTSQ-------------
A0A287CXH0_BMF-02      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A6I8NF73_BMF-01      APLTPGQPYSYLVGQLPL---FPLAPCCGPGLRTLSQ-------------
A0A493T7X1_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A670JUU6_BMF-02      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGTRHAKQ-------------
A0A670JUU6_BMF-04      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGTRHAKQ-------------
A0A674GIP8_BMF-03      GFFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
A0A7M4FPU2_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGSRHTEQ-------------
K7FRX2_BMF-01          GIFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHAEQ-------------
A0A3Q2UCA0_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A3Q2UCA0_BMF-02      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A669PL85_BMF-02      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRQPEQ-------------
A0A663MPI8_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
A0A674GIP8_BMF-02      GFFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
U3JS06_BMF-01          GFFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
A0A674GIP8_BMF-01      GFFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
A0A803YBD7_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A663DZQ4_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
A0A672V891_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGIRHPEQ-------------
A0A493T7X1_BMF-02      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A3Q2UCA0_BMF-03      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A3Q2UCA0_BMF-04      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRHPEQ-------------
A0A669PL85_BMF-01      GIFTQNQSYSCLLGRFQL---FPLTHCCGPGVRQPEQ-------------
A0A670XMZ5_BMF-01      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGSRHAKQ-------------
A0A803SZ00_BMF-02      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGSRQARQ-------------
A0A803SZ00_BMF-01      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGSRQARQ-------------
A0A803SZ00_BMF-03      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGSRQARQ-------------
A0A670JUU6_BMF-01      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGTRHAKQ-------------
A0A670JUU6_BMF-05      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGTRHAKQ-------------
A0A670JUU6_BMF-03      GIFTQSKSYNCLLGRFQL---FPLTHCCGPGTRHAKQ-------------
A0A337ST43_BMF-02      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5KGP2_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6FFN3_BMF-02      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5E1Q4_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5RN49_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6TW78_BMF-03      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6RAW1_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2I2Z168_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-05          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-07          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2R9BS98_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2J8QDD5_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5MJW4_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6B5F6_BMF-03      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5Z4A9_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2I3HD83_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
F7HZL0_BMF-01          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A337ST43_BMF-04      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
A0A337ST43_BMF-05      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
F7HZL0_BMF-03          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q91ZE9_BMF-06          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPISQ-------------
Q91ZE9_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPISQ-------------
A0A287CXH0_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
G3T7Z4_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRHTSQ-------------
A0A5F8GKJ8_BMF-01      ALFAQSQ-PDYMLDGLQL---FPLTHCCGPGLRSVGQ-------------
A0A7N4PJP2_BMF-01      ALFAQSQ-PDYMLDGLQL---FPLTHCCGPGLRSVGQ-------------
A0A4X2KLG2_BMF-01      ALFAQSQ-PDYMLDGLQL---FPLTHCCGPGLRSVGQ-------------
A0A3Q2HR24_BMF-02      DLFAPSQ-LDCPLSHLRL---FPLTHCCGPGLRPTSQ-------------
A0A3Q2HR24_BMF-01      DLFAPSQ-LDCPLSHLRL---FPLTHCCGPGLRPTSQ-------------
A0A5F4CJ04_BMF-03      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A5F4CJ04_BMF-02      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A5F4CJ04_BMF-01      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A286XXB0_BMF-02      DLFAQSQ-LDCPLGRLHL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-06          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
F7HZL0_BMF-02          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A096NTE9_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A286XXB0_BMF-01      DLFAQSQ-LDCPLGRLHL---FPLTHCCGPGLRPTSQ-------------
A0A337ST43_BMF-03      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
A0A7N9CRT3_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6FFN3_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
H0WYH6_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5MJW4_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5KGP2_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A7N9CRT3_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A5F7ZML1_BMF-03      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A5F7ZML1_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6B5F6_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6B5F6_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6B5F6_BMF-04      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5Z4A9_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6L919_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6L919_BMF-03      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6RAW1_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A0D9R4R5_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5E1Q4_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6TW78_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6TW78_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K5RN49_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2I2Z168_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-01          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-02          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-03          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q96LC9_BMF-04          DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2R9BS98_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2J8QDD5_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2J8T301_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A7N9CRT3_BMF-03      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A5F7ZML1_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A096NTE9_BMF-01      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A2K6L919_BMF-02      DLFAQSL-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
G1SR62_BMF-01          DPFAQSQ-LDCPLGRLHL---FPLTHCCGPGLRPTSQ-------------
A0A337ST43_BMF-01      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
W5QFV1_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A4W2EII1_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A4W2EII1_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q05KI3_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
Q05KI3_BMF-02          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A4W2INA4_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
L8IXF5_BMF-01          DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A4W2INA4_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A452F2E0_BMF-02      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A452F2E0_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A667H967_BMF-01      NLFAQSQ-LDCPLSHLQL---FPLTHCCGPGLRPTSQ-------------
A0A2U4BC98_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
A0A671DWL6_BMF-01      DLFAQSQ-LDCPLSRLQL---FPLTHCCGPGLRPTSQ-------------
M3YAD5_BMF-01          DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
U6CSY8_BMF-01          DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A452SED0_BMF-01      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
A0A384D070_BMF-01      DLFAQSQ-LDCPLSRLHL---FPLTHCCGPGLRPTSQ-------------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          -------EDKATQTLG----SPSQDIMLP---------------------
A0A3B4UNJ0_BMF-01      -------EDRATPIAA---------GQAL---------------------
Q0GKC7_BMF-01          ----------QTELAG--RPAGSRNGMLL---------------------
A0A673HDR4_BMF-01      ----------QTETAG--RPPLSPSGMLP---------------------
A0A672JWL9_BMF-02      ----------QTETAG--IPPLCPSGMLP---------------------
A0A671MNR9_BMF-01      ----------QTETAG--RPPLSPSGMLP---------------------
A0A672JWL9_BMF-01      ----------QTETAG--IPPLCPSGMLP---------------------
A0A3P9ICE1_BMF-01      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A671M0H4_BMF-01      -------QIKQTETAG--TPPVSPSGMLP---------------------
A0A671M0H4_BMF-02      -------QIKQTETAG--TPPVSPSGMLP---------------------
A0A3B4B6Y3_BMF-01      -------EDRATQTPG--PALAPNKGMLP---------------------
A0A4W4DZH9_BMF-01      -------EERGTQTAG--RPLARPNGMLP---------------------
A0A3B1K1X5_BMF-01      -------EERGTQTPG--RPPARTNGMLP---------------------
A0A3B4CNJ8_BMF-01      -------EERGTQTPG--RPPARPNGMLP---------------------
A0A3B3RH63_BMF-01      -------ENRGTQTPG--PALVQGLNMLP---------------------
W5N4P7_BMF-01          -------EDKGTQTPS--PALVHGDNMLP---------------------
A0A2U9CJH3_BMF-01      -------EDRGTQTPG--PALALNNGMLP---------------------
A0A3Q2YCX7_BMF-01      -------EERATQTPG--PVPASNNGMLP---------------------
A0A3Q2YCX7_BMF-02      -------EERATQTPG--PVPASNNGMLP---------------------
A0A668TQU8_BMF-01      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3Q3VLX6_BMF-01      -------EDRGTQTPG--PALAPYSGMLP---------------------
A0A3P8UA78_BMF-01      -------EDRGTQTPG--PDLALNNGMLP---------------------
A0A3P8UA78_BMF-03      -------EDRGTQTPG--PDLALNNGMLP---------------------
A0A3P8UA78_BMF-02      -------EDRGTQTPG--PDLALNNGMLP---------------------
A0A3B5KWG6_BMF-03      -------EDRGTQTPG--PTLAPHSGMLP---------------------
A0A3B5KWG6_BMF-01      -------EDRGTQTPG--PTLAPHSGMLP---------------------
A0A3B5KWG6_BMF-02      -------EDRGTQTPG--PTLAPHSGMLP---------------------
A0A3B3CGR9_BMF-01      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3B3HAU1_BMF-04      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3P9ICE1_BMF-04      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3P9K487_BMF-02      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3B3HAU1_BMF-01      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3B3HAU1_BMF-02      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3B3HAU1_BMF-03      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3P9ICE1_BMF-02      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3P9ICE1_BMF-05      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3P9ICE1_BMF-03      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A3P9K487_BMF-01      -------EDRGTQTPG--PALVPNNGMLL---------------------
A0A672HG10_BMF-01      -------EDRGTQTPG--PVLVPNNGMLP---------------------
A0A673C8N3_BMF-01      -------EDRGTQTPG--LALAPNNGMLP---------------------
A0A3P8NFE2_BMF-02      -------EHRGTQTPG--PALVPNNGMLP---------------------
I3K2D6_BMF-01          -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3P8NFE2_BMF-01      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3Q3C5V2_BMF-01      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3P9DPJ5_BMF-01      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3P9DPJ5_BMF-02      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3B4ETH0_BMF-01      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3Q4G1I4_BMF-01      -------EHRGTQTPG--PALVPNNGMLP---------------------
A0A3Q1FVH7_BMF-02      -------EDRGTQTPG--PALQPNNGMLP---------------------
A0A3Q1FVH7_BMF-01      -------EDRGTQTPG--PALQPNNGMLP---------------------
A0A3Q2ZA20_BMF-01      -------EDRGTQTPG--PALVPHSGMLP---------------------
A0A665VG08_BMF-01      -------EHRGTQTPG--PALGPNNGMLP---------------------
A0A3Q3RVI2_BMF-01      -------EDRGTQTPG--PALALNNGMLP---------------------
A0A3Q1D1K3_BMF-01      -------EDRGTQTPG--PALQPNNGMLP---------------------
A0A3P8RKY9_BMF-01      -------EDRGTQTPG--PALQPNNGMLP---------------------
A0A3Q3RVI2_BMF-02      -------EDRGTQTPG--PALALNNGMLP---------------------
A0A4W6DUL1_BMF-01      -------EDRGTQTPG--PALALNNGMLP---------------------
A0A3Q1IPR4_BMF-01      -------QDRGTQTPG--PALPQNNGMLP---------------------
A0A0F8AD62_BMF-01      -------EDQGTQTPG--PALAPYNGMLP---------------------
A0A671X848_BMF-01      -------EDRGTQTPG--PALALYNGMLP---------------------
A0A667YNR9_BMF-01      -------EDRGTQTPG--PALTLANGMLP---------------------
A0A3B4U5H8_BMF-01      -------EDRGTQTPG--PALALNNGMLP---------------------
A0A3B4WM88_BMF-01      -------EDRGTQTPG--PALALNNGMLP---------------------
A0A3Q3QZ16_BMF-01      -------EDRGTQTAG--PTLAPNNSMLP---------------------
A0A3Q3QZ16_BMF-02      -------EDRGTQTAG--PTLAPNNSMLP---------------------
A0A3Q2PJX9_BMF-01      -------EDRGTQTPG--PALAPNNGMLP---------------------
A0A3Q2PJX9_BMF-02      -------EDRGTQTPG--PALAPNNGMLP---------------------
A0A3Q2PJX9_BMF-03      -------EDRGTQTPG--PALAPNNGMLP---------------------
A0A3B5QK08_BMF-02      -------EDRGTQTPG--PGQALHNGMLP---------------------
A0A3B5QK08_BMF-01      -------EDRGTQTPG--PGQALHNGMLP---------------------
A0A096LRV0_BMF-01      -------EDRGTQTPG--PGQALHNGMLP---------------------
A0A3B3WU80_BMF-01      -------EDRGTQTPG--PGQALHNGMLP---------------------
A0A3P9Q8E2_BMF-01      -------EDRGTQTPG--PGQALHNGMLP---------------------
A0A3Q2CXC4_BMF-02      -------EDRGTQTPG--PGVAPHNVMLP---------------------
A0A3Q2CXC4_BMF-01      -------EDRGTQTPG--PGVAPHNVMLP---------------------
A0A3Q3GUU5_BMF-01      -------EDRGTQTPG--PALAPNNGMLP---------------------
A0A3B5B8F6_BMF-01      -------EDRGTQTPG--PALQPNNGMLP---------------------
A0A1S3P5K4_BMF-01      -------EDRGTQTPS--PVLPLPNNMLP---------------------
A0A1S3SNN2_BMF-01      -------EDRGTQTPS--PALALPNDMLP---------------------
A0A674EF64_BMF-01      -------EDRGTQTPS--PALALPNDMLP---------------------
A0A4W5N3A7_BMF-01      -------EDRGTQTPS--PALALRNNMLP---------------------
A0A4W5N721_BMF-01      -------EDRGTQTPS--PVLPLPNNMLP---------------------
A0A1S3P5K4_BMF-02      -------EDRGTQTPS--PVLPLPNNMLP---------------------
A0A6F9B4C5_BMF-01      -------EDRGTQTPS--PVLALPNSMVP---------------------
A0A6F9BGV6_BMF-01      -------EDRGTQTPS--PALALPNDMLP---------------------
A0A3P8ZIE7_BMF-01      -------EDRGTQTPT--TALALLNDMLP---------------------
A0A673YQV3_BMF-01      -------EDRGTQTPS--PVLPLPNNMLP---------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A672RK14_BMF-01      ANRHGRFEDRSTQTASSVLNSVRNGDMAPFQGLEGDASSPCRAVDARTAF
A0A673JJ10_BMF-01      ANRHGRFEDRSTQTARTVLNSARDGDMAPFQ-------------------
A0A4W3JXA1_BMF-01      -------CDKATQTPTSIPGSDLAEPSLP---------------------
A0A452H3N6_BMF-01      -------QDKATQTLS--PSSSTQDVMLP---------------------
A0A674IPL3_BMF-01      -------QDKATQTLS--PSSSTQDVMLP---------------------
A0A673TA87_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A287AIU8_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A7N5JI49_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A7N5JI49_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
G1PAU1_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
Q91ZE9_BMF-02          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A287AIU8_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4X1UQ42_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4X1UQ42_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A7N5JI49_BMF-03      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A671DWL6_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A286XXB0_BMF-03      -------EDKATQTLS--PSSPSQGVMLP---------------------
A0A287CXH0_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A6I8NF73_BMF-01      -------EDKTTQTLS--PAAPSQGVMLP---------------------
A0A493T7X1_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A670JUU6_BMF-02      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A670JUU6_BMF-04      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A674GIP8_BMF-03      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A7M4FPU2_BMF-01      -------QDKATQTLN--PSSSSQDVMLP---------------------
K7FRX2_BMF-01          -------QDKATQTLS--PSSSTQDVMLP---------------------
A0A3Q2UCA0_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A3Q2UCA0_BMF-02      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A669PL85_BMF-02      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A663MPI8_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A674GIP8_BMF-02      -------QDKATQTLS--PSSSSQDVMLP---------------------
U3JS06_BMF-01          -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A674GIP8_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A803YBD7_BMF-01      -------QDKATQTLS--PSSS----------------------------
A0A663DZQ4_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A672V891_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A493T7X1_BMF-02      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A3Q2UCA0_BMF-03      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A3Q2UCA0_BMF-04      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A669PL85_BMF-01      -------QDKATQTLS--PSSSSQDVMLP---------------------
A0A670XMZ5_BMF-01      -------QDKATQTLN--ASSSSQDIMLP---------------------
A0A803SZ00_BMF-02      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A803SZ00_BMF-01      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A803SZ00_BMF-03      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A670JUU6_BMF-01      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A670JUU6_BMF-05      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A670JUU6_BMF-03      -------QDKATQTLN--PSSSSQDVMLP---------------------
A0A337ST43_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K5KGP2_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6FFN3_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K5E1Q4_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K5RN49_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K6TW78_BMF-03      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K6RAW1_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2I2Z168_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
Q96LC9_BMF-05          -------EDKATQTLS--PASPSQGVMLP---------------------
Q96LC9_BMF-07          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2R9BS98_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2J8QDD5_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K5MJW4_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6B5F6_BMF-03      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K5Z4A9_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2I3HD83_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
F7HZL0_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A337ST43_BMF-04      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A337ST43_BMF-05      -------EDKATQTLS--PASPSQGVMLP---------------------
F7HZL0_BMF-03          -------EDKATQTLS--PASPSQGVMLP---------------------
Q91ZE9_BMF-06          -------EDKATQTLS--PASPSQGVMLP---------------------
Q91ZE9_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A287CXH0_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
G3T7Z4_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A5F8GKJ8_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A7N4PJP2_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4X2KLG2_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A3Q2HR24_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A3Q2HR24_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A5F4CJ04_BMF-03      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A5F4CJ04_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A5F4CJ04_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A286XXB0_BMF-02      -------EDKATQTLS--PSSPSQGVMLP---------------------
Q96LC9_BMF-06          -------EDKATQTLS--PASPSQGVMLP---------------------
F7HZL0_BMF-02          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A096NTE9_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A286XXB0_BMF-01      -------EDKATQTLS--PSSPSQGVMLP---------------------
A0A337ST43_BMF-03      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A7N9CRT3_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6FFN3_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
H0WYH6_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K5MJW4_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K5KGP2_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A7N9CRT3_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A5F7ZML1_BMF-03      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A5F7ZML1_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6B5F6_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6B5F6_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6B5F6_BMF-04      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K5Z4A9_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6L919_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6L919_BMF-03      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6RAW1_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A0D9R4R5_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K5E1Q4_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K6TW78_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K6TW78_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2K5RN49_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2I2Z168_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
Q96LC9_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
Q96LC9_BMF-02          -------EDKATQTLS--PASPSQGVMLP---------------------
Q96LC9_BMF-03          -------EDKATQTLS--PASPSQGVMLP---------------------
Q96LC9_BMF-04          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2R9BS98_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2J8QDD5_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2J8T301_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A7N9CRT3_BMF-03      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A5F7ZML1_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A096NTE9_BMF-01      -------EDKATQTLG--PASPSQGVMLP---------------------
A0A2K6L919_BMF-02      -------EDKATQTLG--PASPSQGVMLP---------------------
G1SR62_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A337ST43_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
W5QFV1_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4W2EII1_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4W2EII1_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
Q05KI3_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
Q05KI3_BMF-02          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4W2INA4_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
L8IXF5_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A4W2INA4_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A452F2E0_BMF-02      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A452F2E0_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A667H967_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A2U4BC98_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A671DWL6_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
M3YAD5_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
U6CSY8_BMF-01          -------EDKATQTLS--PASPSQGVMLP---------------------
A0A452SED0_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
A0A384D070_BMF-01      -------EDKATQTLS--PASPSQGVMLP---------------------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          ---------------CGVSETPQRLFYGKEALSEIY--------------
A0A3B4UNJ0_BMF-01      ---------------TAVTAAPLILF-------VWW-VPHWELSPSTKMN
Q0GKC7_BMF-01          ---------------CRHLQQHGHFLYGNAELLVLA-ASSRAQPPDVVLR
A0A673HDR4_BMF-01      ---------------CRVHVEPRRFLYGNTGLLLLA-PPSRSRPPDVVLR
A0A672JWL9_BMF-02      ---------------CRVHVEPRRFLYGNTGLLLLA-PPSRSRPPDVVLR
A0A671MNR9_BMF-01      ---------------CRVNVEPRRFLYGNTGLLLLA-PPSRSRPPDVVLR
A0A672JWL9_BMF-01      ---------------CRVHVEPRRFLYGNTGLLLLA-PPSRSRPPDVVLR
A0A3P9ICE1_BMF-01      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A671M0H4_BMF-01      ---------------CRVHVEPTRFLYGNAGLLLLA-SPSRSQPPDVVLR
A0A671M0H4_BMF-02      ---------------CRVHVEPTRFLYGNAGLLLLA-SPSRSQPPDVVLR
A0A3B4B6Y3_BMF-01      ---------------CGVAEEPRPLFY-----------AHFELGEDQEAS
A0A4W4DZH9_BMF-01      ---------------CGVSEEPRRLFYGSAGLLLLA-PPARPNSADDAML
A0A3B1K1X5_BMF-01      ---------------CGISEEPRRLFYGSAGLLLLA-PSARSERVGDAMF
A0A3B4CNJ8_BMF-01      ---------------CGVSEEPRRLFYGSAGLLLLA-PSVRPEHVEGAML
A0A3B3RH63_BMF-01      ---------------CGVGQEPRRLFYGSAGLRLHF-PA-LSVPGGHPPQ
W5N4P7_BMF-01          ---------------CGVGAEPRRLFYGNAAFRLHF-PAHFEQGGDEEEE
A0A2U9CJH3_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELFGDQEVR
A0A3Q2YCX7_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGEQEER
A0A3Q2YCX7_BMF-02      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGEQEER
A0A668TQU8_BMF-01      ---------------CGVAEEPRPLFYGECYCTDLT-PA----------R
A0A3Q3VLX6_BMF-01      ---------------CGVAEEPRHLFY---------------VTSSLAPD
A0A3P8UA78_BMF-01      ---------------CGVGEEPRPLFYGNAGFRLHF-PAHFELIGDRETR
A0A3P8UA78_BMF-03      ---------------CGVGEEPRPLFYGNAGFRLHF-PAHFELIGDRETR
A0A3P8UA78_BMF-02      ---------------CGVGEEPRPLFYGNAGFRLHF-PAHFELIGDRETR
A0A3B5KWG6_BMF-03      ---------------CGVAEEPRLLFYGNAGFRLHF-PARFEVLGDRGVR
A0A3B5KWG6_BMF-01      ---------------CGVAEEPRLLFYGNAGFRLHF-PARFEVLGDRGVR
A0A3B5KWG6_BMF-02      ---------------CGVAEEPRLLFYGNAGFRLHF-PARFEVLGDRGVR
A0A3B3CGR9_BMF-01      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEAR
A0A3B3HAU1_BMF-04      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3P9ICE1_BMF-04      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3P9K487_BMF-02      ---------------CGLSEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3B3HAU1_BMF-01      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3B3HAU1_BMF-02      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3B3HAU1_BMF-03      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3P9ICE1_BMF-02      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3P9ICE1_BMF-05      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3P9ICE1_BMF-03      ---------------CGLAEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A3P9K487_BMF-01      ---------------CGLSEEPRPLFYGNAGFRLHF-PARFELAGDLEVR
A0A672HG10_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDHRVR
A0A673C8N3_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELFGDPVRR
A0A3P8NFE2_BMF-02      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
I3K2D6_BMF-01          ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAR
A0A3P8NFE2_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
A0A3Q3C5V2_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
A0A3P9DPJ5_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
A0A3P9DPJ5_BMF-02      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
A0A3B4ETH0_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
A0A3Q4G1I4_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELVGDHRAS
A0A3Q1FVH7_BMF-02      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELI----AR
A0A3Q1FVH7_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELI----AR
A0A3Q2ZA20_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELIRDLEAR
A0A665VG08_BMF-01      ---------------CGIAKEPRPLFYGNAGFRLHF-PAQFELAGDQEVR
A0A3Q3RVI2_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDQEVR
A0A3Q1D1K3_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELIGNHQAR
A0A3P8RKY9_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELIGNHQAR
A0A3Q3RVI2_BMF-02      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDQEVR
A0A4W6DUL1_BMF-01      ---------------CGVEEEPRPLFYGNAGFRLHF-PAHFELAGNQEAR
A0A3Q1IPR4_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDLEVR
A0A0F8AD62_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A671X848_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A667YNR9_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A3B4U5H8_BMF-01      ---------------CGVAKEPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A3B4WM88_BMF-01      ---------------CGVAKEPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A3Q3QZ16_BMF-01      ---------------CGVAEDPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A3Q3QZ16_BMF-02      ---------------CGVAEDPRPLFYGNAGFRLHF-PAHFELVGDQEAR
A0A3Q2PJX9_BMF-01      ---------------CGVAEEPRQLFYGNAGFRLHF-PAHFELVGDFDAR
A0A3Q2PJX9_BMF-02      ---------------CGVAEEPRQLFYGNAGFRLHF-PAHFELVGDFDAR
A0A3Q2PJX9_BMF-03      ---------------CGVAEEPRQLFYGNAGFRLHF-PAHFELVGDFDAR
A0A3B5QK08_BMF-02      ---------------CGVVEEPRRLFYGNAGFRLHF-PAHFELVGDFDAR
A0A3B5QK08_BMF-01      ---------------CGVVEEPRRLFYGNAGFRLHF-PAHFELVGDFDAR
A0A096LRV0_BMF-01      ---------------CGVAEEPRRLFYGNAGFRLHF-PAHFELVGDFDAR
A0A3B3WU80_BMF-01      ---------------CGVAEEPRRLFYGNAGFRLHF-PAHFELVGDFDAR
A0A3P9Q8E2_BMF-01      ---------------CGVAEEPRRLFYGNAGFRLHF-PAHFELVRDFDAR
A0A3Q2CXC4_BMF-02      ---------------CGVVEEPRPLFYRNAGFRLHF-PAHFELVGDFDVR
A0A3Q2CXC4_BMF-01      ---------------CGVVEEPRPLFYRNAGFRLHF-PAHFELVGDFDVR
A0A3Q3GUU5_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PANFELVGDQEES
A0A3B5B8F6_BMF-01      ---------------CGVAEEPRPLFYGNAGFRLHF-PARFELIGDHQAR
A0A1S3P5K4_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PAQFERVGDQGP-
A0A1S3SNN2_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PARFEQVGDQGPQ
A0A674EF64_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PARFEQVGDQGPQ
A0A4W5N3A7_BMF-01      ---------------CG---EPRPLFYGNAGFRLHF-PARFEQVGDQGPH
A0A4W5N721_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PAQFERVGDQGP-
A0A1S3P5K4_BMF-02      ---------------CGVAQEPRPLFYGNAGFRLHF-PAQFERVGDQGP-
A0A6F9B4C5_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PAQFERVGDQGP-
A0A6F9BGV6_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PARFEQVGDQGPQ
A0A3P8ZIE7_BMF-01      ---------------CRLDQDPRPLFYGNAGFRLHF-PAQFECVGDPGPQ
A0A673YQV3_BMF-01      ---------------CGVAQEPRPLFYGNAGFRLHF-PAQFERVGDQGPL
A9XRH0_BMF-01          ---------------------------GNAGYRLHVPPVGFAL-------
A0A803YBD7_BMF-02      ---------------------------GNAGYRLHVPPVGFAL-------
A0A672RK14_BMF-01      GVNCGTGGLASLTMAPGASEGPRALFHGNAGFRAHF-PALFEP--LLDGT
A0A673JJ10_BMF-01      -------------------EGPRALFHGNAGFRSHF-PALFEP--VPDST
A0A4W3JXA1_BMF-01      ---------------GGVGAHPRRLFYGNAGYRLGS-PEVFEVPRSSGLP
A0A452H3N6_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLHVPPVGFAL-------
A0A674IPL3_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLHVPPVGFAL-------
A0A673TA87_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A287AIU8_BMF-02      ---------------CGVTEEPQRLFY-----------------------
A0A7N5JI49_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A7N5JI49_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
G1PAU1_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q91ZE9_BMF-02          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A287AIU8_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PAGFPA-------
A0A4X1UQ42_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PAGFPA-------
A0A4X1UQ42_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PAGFPA-------
A0A7N5JI49_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A671DWL6_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A286XXB0_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A287CXH0_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A6I8NF73_BMF-01      ---------------CGVTEEPRRLFYGHAGYRLSS-LTSFPG-------
A0A493T7X1_BMF-01      ---------------CGVTEEPRRLFYASAEQKSSV-VAAFSL-------
A0A670JUU6_BMF-02      ---------------CGVTEEPQRLFYGNAGFRLHVNPIGFSL-------
A0A670JUU6_BMF-04      ---------------CGVTEEPQRLFYGNAGFRLHVNPIGFSL-------
A0A674GIP8_BMF-03      ---------------CGVTEEPRRLFYGSAGYRLHVPPAGFVL-------
A0A7M4FPU2_BMF-01      ---------------CGVTEEPQRLFYGNVGYRLRVPPVGFAL-------
K7FRX2_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLHEPPVGFAL-------
A0A3Q2UCA0_BMF-01      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A3Q2UCA0_BMF-02      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A669PL85_BMF-02      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A663MPI8_BMF-01      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A674GIP8_BMF-02      ---------------CGVTEEPRRLFYGSAGYRLHVPPAGFVL-------
U3JS06_BMF-01          ---------------CGVTEEPRRLFYGSAGYRLHVPPAGFVL-------
A0A674GIP8_BMF-01      ---------------CGVTEEPRRLFYGSAGYRLHVPPAGFVL-------
A0A803YBD7_BMF-01      --------------------KPRRLFYGNAGYRLHVPPVGFAL-------
A0A663DZQ4_BMF-01      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A672V891_BMF-01      ---------------CGVTEEPRRLFYGNAGYRLHIPPVGFAL-------
A0A493T7X1_BMF-02      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A3Q2UCA0_BMF-03      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A3Q2UCA0_BMF-04      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A669PL85_BMF-01      ---------------CGVTEEPRRLFYGNAGYRLHVPPVGFAL-------
A0A670XMZ5_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLHVQPIGFTL-------
A0A803SZ00_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLHVSPIGFSL-------
A0A803SZ00_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLHVSPIGFSL-------
A0A803SZ00_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLHVSPIGFSL-------
A0A670JUU6_BMF-01      ---------------CGVTEEPQRLFYGNAGFRLHVNPIGFSL-------
A0A670JUU6_BMF-05      ---------------CGVTEEPQRLFYGNAGFRLHVNPIGFSL-------
A0A670JUU6_BMF-03      ---------------CGVTEEPQRLFYGNAGFRLHVNPIGFSL-------
A0A337ST43_BMF-02      ---------------CGVTEEPQRLFYAPAKPPSSV-VADSPL-------
A0A2K5KGP2_BMF-01      ---------------CGVTEEPQRLFYAPAEPKSRV-VADPPL-------
A0A2K6FFN3_BMF-02      ---------------CGVTEEPQRLFYAPAEPKSHV-VADPPL-------
A0A2K5E1Q4_BMF-02      ---------------CGVTEEPQRLFYASAEPKSRV-VAGPPL-------
A0A2K5RN49_BMF-02      ---------------CGVTEEPQRLFYAPAEPKSRV-VAGPPL-------
A0A2K6TW78_BMF-03      ---------------CGVTEEPQRLFYAPAEPKSCV-VAGPPL-------
A0A2K6RAW1_BMF-02      ---------------CGVTEEPQRLFYAPAEPKSRV-VADPPL-------
A0A2I2Z168_BMF-02      ---------------CGVTEEPQRLFYAPAEPKSCV-VADPPL-------
Q96LC9_BMF-05          ---------------CGVTEEPQRLFYAPAEPKSCV-VADPPL-------
Q96LC9_BMF-07          ---------------CGVTEEPQRLFYAPAEPKSCV-VADPPL-------
A0A2R9BS98_BMF-02      ---------------CGVTEEPQRLFYAPAEPKSCV-VADPPL-------
A0A2J8QDD5_BMF-01      ---------------CGVTEEPQRLFYAPAEPKSCV-VADPPL-------
A0A2K5MJW4_BMF-01      ---------------CGVTEEPQRLFYAPAEPKSRV-VADPPL-------
A0A2K6B5F6_BMF-03      ---------------CGVTEEPQRLFYAPAEPKSRV-VADPPL-------
A0A2K5Z4A9_BMF-02      ---------------CGVTEEPQRLFYAPAEPKSRV-VADPPL-------
A0A2I3HD83_BMF-01      ---------------CGVTEEPQRLFYAPAEPKSRV-VADPPL-------
F7HZL0_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A337ST43_BMF-04      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A337ST43_BMF-05      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
F7HZL0_BMF-03          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q91ZE9_BMF-06          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q91ZE9_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A287CXH0_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
G3T7Z4_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F8GKJ8_BMF-01      ---------------CGVTEEPHRLFYGNAGYRLPL-PASFPA-------
A0A7N4PJP2_BMF-01      ---------------CGVTEEPHRLFYGNAGYRLPL-PANFPS-------
A0A4X2KLG2_BMF-01      ---------------CGVTEEPHRLFYGNAGYRLPL-PANFPV-------
A0A3Q2HR24_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A3Q2HR24_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F4CJ04_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F4CJ04_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F4CJ04_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A286XXB0_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q96LC9_BMF-06          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
F7HZL0_BMF-02          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A096NTE9_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A286XXB0_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A337ST43_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A7N9CRT3_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6FFN3_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
H0WYH6_BMF-01          ---------------CGVTEEPQRLFYGNVGYRLPL-PASFPA-------
A0A2K5MJW4_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K5KGP2_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A7N9CRT3_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F7ZML1_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F7ZML1_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6B5F6_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6B5F6_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6B5F6_BMF-04      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K5Z4A9_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6L919_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6L919_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6RAW1_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A0D9R4R5_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K5E1Q4_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6TW78_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6TW78_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K5RN49_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2I2Z168_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q96LC9_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q96LC9_BMF-02          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q96LC9_BMF-03          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
Q96LC9_BMF-04          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2R9BS98_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2J8QDD5_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2J8T301_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A7N9CRT3_BMF-03      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A5F7ZML1_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A096NTE9_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2K6L919_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
G1SR62_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A337ST43_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
W5QFV1_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A4W2EII1_BMF-01      ---------------CGVTEEPQRLFYGHAGYRLPL-PASFPA-------
A0A4W2EII1_BMF-01      ---------------CGVTEEPQRLFYGHAGYRLPL-PASFPA-------
Q05KI3_BMF-01          ---------------CGVTEEPQRLFYGHAGYRLPL-PASFPA-------
Q05KI3_BMF-02          ---------------CGVTEEPQRLFYGHAGYRLPL-PASFPA-------
A0A4W2INA4_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
L8IXF5_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A4W2INA4_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A452F2E0_BMF-02      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A452F2E0_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A667H967_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A2U4BC98_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PAGFPA-------
A0A671DWL6_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
M3YAD5_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
U6CSY8_BMF-01          ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A452SED0_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
A0A384D070_BMF-01      ---------------CGVTEEPQRLFYGNAGYRLPL-PASFPA-------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          -------------------------------------RMFNASIPHESHR
A0A3B4UNJ0_BMF-01      MLRFSEN-------------------RPEEQAGVSVEAQIGRKLREIGDK
Q0GKC7_BMF-01          QNV------SPMERPE-------------PRPAQSVETLIGQKLQLIGDQ
A0A673HDR4_BMF-01      QNL------RMMD------------------PAESVETLIGQKLQLIGDQ
A0A672JWL9_BMF-02      QNL------RMMD------------------PAESVETLIGQKLQLIGDQ
A0A671MNR9_BMF-01      QNL------RMMD------------------PAESVETLIGQKLQLIGDQ
A0A672JWL9_BMF-01      QNL------RMMD------------------PAESVETLIGQKLQLIGDQ
A0A3P9ICE1_BMF-01      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A671M0H4_BMF-01      QDL------RMMDPAV-------------ARPERSVETLIGQKLQLIGDQ
A0A671M0H4_BMF-02      QDL------RMMDPAV-------------ARPERSVETLIGQKLQLIGDQ
A0A3B4B6Y3_BMF-01      ESLQEGEMQNGREPLP----------RH-PVAVRSMEACIGHKLQLIGDQ
A0A4W4DZH9_BMF-01      PEN-----QLAVEPPR-------------RRPLHSVEASIGQKLQMIGDQ
A0A3B1K1X5_BMF-01      REE-----HRAVE-PR-------------RRPAHSVEARIGQKLQMIGDQ
A0A3B4CNJ8_BMF-01      QED-----QLAME-PR-------------RRPPHSVEARIGQKLQMIGDQ
A0A3B3RH63_BMF-01      EER-----------------------QPDDRPQPSAEVRIGQKLQMIGDQ
W5N4P7_BMF-01          TGE-----------------------AE-EQPVRSAEVRIGQKLQRIGDQ
A0A2U9CJH3_BMF-01      GHE-SEEERSGMEQLP----------RQQQPVAHSVEACIGQKLQLIGDQ
A0A3Q2YCX7_BMF-01      LQESDDGMEQQLQQQQ----------QQ-QPVARSIEACVGQKLQLIGDQ
A0A3Q2YCX7_BMF-02      LQESDDGMEQQLQQQQ----------QQ-QPVARSIEACVGQKLQLIGDQ
A0A668TQU8_BMF-01      RQE-IAEQQNSMERLP----------RQ-QPAARSVEACIGQKLQLIGDQ
A0A3Q3VLX6_BMF-01      SRD-NCRERNGMERLP----------RQ-QPVAHSVEACIGQKLQLIGDQ
A0A3P8UA78_BMF-01      RRQ-SDEERNRMEPRPQQQQQQQRQQQQ-QPVQRSVEVRIGQKLQLIGDQ
A0A3P8UA78_BMF-03      RRQ-SDEERNRMEPRPQQQQQQQRQQQQ-QPVQRSVEVRIGQKLQLIGDQ
A0A3P8UA78_BMF-02      RRQ-SDEERNRMEPRPQQQQQQQRQQQQ-QPVQRSVEVRIGQKLQLIGDQ
A0A3B5KWG6_BMF-03      RRD-TGGAPNGMEPLP----------QQ-GPVVRSTEACIGQKLQLIGDQ
A0A3B5KWG6_BMF-01      RRD-TGGAPNGMEPLP----------QQ-GPVVRSTEACIGQKLQLIGDQ
A0A3B5KWG6_BMF-02      RRD-TGGAPNGMEPLP----------QH-GPVVRSTEACIGQKLQLIGDQ
A0A3B3CGR9_BMF-01      RHD-REAERGGMERLP----------RQ-QPAARSTEACIAQKLQLIGDQ
A0A3B3HAU1_BMF-04      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3P9ICE1_BMF-04      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3P9K487_BMF-02      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3B3HAU1_BMF-01      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3B3HAU1_BMF-02      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3B3HAU1_BMF-03      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3P9ICE1_BMF-02      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3P9ICE1_BMF-05      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3P9ICE1_BMF-03      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A3P9K487_BMF-01      RHD-REAERRGMERLP----------RQ-QPVARSTEACIAQKLQLIGDQ
A0A672HG10_BMF-01      RRE-SEEQQNGMDQLP----------RQ-RPAAQSVEACIGQKLQLIGDQ
A0A673C8N3_BMF-01      QVS-EEEEQNGMEQLP----------RQ-QPMARSVEACIGQKLQLIGDQ
A0A3P8NFE2_BMF-02      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
I3K2D6_BMF-01          RQE-IAEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3P8NFE2_BMF-01      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3Q3C5V2_BMF-01      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3P9DPJ5_BMF-01      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3P9DPJ5_BMF-02      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3B4ETH0_BMF-01      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3Q4G1I4_BMF-01      RQG-STEQQNSMERLP----------RQ-RPAARSVEACIGQKLQLIGDQ
A0A3Q1FVH7_BMF-02      QQG-SEMEQNGMEQLP----------RQ-QPMAHSVEACIGQKLQLIGDQ
A0A3Q1FVH7_BMF-01      QQG-SEMEQNGMEQLP----------RQ-QPMAHSVEACIGQKLQLIGDQ
A0A3Q2ZA20_BMF-01      QQD-REEEPNRMERLP----------RQ-LPVARSLEVCIGQKLQLIGDQ
A0A665VG08_BMF-01      GQG-SEEEQNGMEQLP----------RQ-QPVARSIEVCIGQKLQLIGDQ
A0A3Q3RVI2_BMF-01      QQE-REEEQNRMEQLP----------RQ-QPLVHSVEACIGQKLQLIGDQ
A0A3Q1D1K3_BMF-01      QQG-SEMEQNGMEQLP----------RQ-QPVARSMEACIGQKLQLIGDQ
A0A3P8RKY9_BMF-01      QQG-SEMEQNGMEQLP----------RQ-QPVARSMEACIGQKLQLIGDQ
A0A3Q3RVI2_BMF-02      QQE-REEEQNRMEQLP----------RQ-QPLVHSVEACIGQKLQLIGDQ
A0A4W6DUL1_BMF-01      RQE-SEEERNGMEQLP----------QR-QPVARSVEACIGQKLQLIGDQ
A0A3Q1IPR4_BMF-01      QQD-SEEEQNGMEIPP----------RQ-QPLMQSVEACIGQKLQLIGDQ
A0A0F8AD62_BMF-01      HQE-SEGEQNRMEQLP----------RQ-QPVARSVEACIGQKLQLIGDQ
A0A671X848_BMF-01      RQD-SGGEQSGMEQLP----------RP-QPVARSVEACIGQKLQLIGDQ
A0A667YNR9_BMF-01      QQE-REEEQNGMEQRP----------RQ-QPVARSVEARIGQKLQLIGDQ
A0A3B4U5H8_BMF-01      RQG-SGEERNGMEQLP----------RQ-QPVARSVEACIGQKLQLIGDQ
A0A3B4WM88_BMF-01      RQG-SGEERNGMEQLP----------RQ-QPVARSVEACIGQKLQLIGDQ
A0A3Q3QZ16_BMF-01      RQE----DQNGMEHLP----------RQ-QRVARSVEACIGQKLQLIGDQ
A0A3Q3QZ16_BMF-02      RQE----DQNGMEHLP----------RQ-QRVARSVEACIGQKLQLIGDQ
A0A3Q2PJX9_BMF-01      RQE----EQNRMEPLP----------LH-QPAALSLEACIGQKLQLIGDQ
A0A3Q2PJX9_BMF-02      RQE----EQNRMEPLP----------LH-QPAALSLEACIGQKLQLIGDQ
A0A3Q2PJX9_BMF-03      RQE----EQNRMEPLP----------LH-QPAALSLEACIGQKLQLIGDQ
A0A3B5QK08_BMF-02      QQE----EQNRMEQLP----------LH-QPAALSLEASIGQKLQLIGDQ
A0A3B5QK08_BMF-01      QQE----EQNRMEQLP----------LH-QPAALSLEASIGQKLQLIGDQ
A0A096LRV0_BMF-01      QQE----EQNRMEQLP----------LH-QPAALSLEACIGQKLQLIGDQ
A0A3B3WU80_BMF-01      QQE----EQNRMEQLP----------LH-QPAALSLEACIGQKLQLIGDQ
A0A3P9Q8E2_BMF-01      QQE----EQNRMEQLP----------LH-QPAALSLEACIGQKLQLIGDQ
A0A3Q2CXC4_BMF-02      RQA----EHNRMEQLP----------LQ-QPAALSLEACIGQKLQIIGDQ
A0A3Q2CXC4_BMF-01      RQA----EHNRMEQLP----------LQ-QPAALSLEACIGQKLQIIGDQ
A0A3Q3GUU5_BMF-01      GQE-SELQQIGMEQ-------------Q-QPVAHSVEASIGLKLQLIGDQ
A0A3B5B8F6_BMF-01      QQQGSEMEQNGMEQLP----------RQ-QPVARSVEACIGQKLQLIGDQ
A0A1S3P5K4_BMF-01      -----LGERGGMERLN----------QQPQQPARSIEICIGQKLQLIGDQ
A0A1S3SNN2_BMF-01      EQH--QGERGRMERLQ-------------QQPAQSMEVCIGQKLQLIGDQ
A0A674EF64_BMF-01      EQH--QGERGRMERLL-------------QQPVQSMEVCIGQKLQLIGDQ
A0A4W5N3A7_BMF-01      EQH--QGERGRMEWLQ----------QQPQQPAHSMEVCIGQKLQLIGDQ
A0A4W5N721_BMF-01      -----LGERGGMERLD----------QQPQLPARSIEVCIGQKLQLIGDQ
A0A1S3P5K4_BMF-02      -----LGERGGMERLN----------QQPQQPARSIEICIGQKLQLIGDQ
A0A6F9B4C5_BMF-01      -----QGERGGMERLE----------QQPQQPARSIEVYIGQKLQLIGDQ
A0A6F9BGV6_BMF-01      ERH--QGERGRMERLQ----------QQPQQPAQSMEVCIGQKLQLIGDQ
A0A3P8ZIE7_BMF-01      QRP--QAVRGGMEHPQ----------QLPQQP---VARCIGQKLQLIGDQ
A0A673YQV3_BMF-01      GE---RGERGGMERLN----------QQPQQPARSIEICIGQKLQLIGDQ
A9XRH0_BMF-01          --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A803YBD7_BMF-02      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A672RK14_BMF-01      QNA--EEDEGRPEEKE----------DERDV-GISVEIQIGRKLREMGDQ
A0A673JJ10_BMF-01      QNA--EEDGGTPEEKE----------DERDV-GISVEIQIGRKLREMGDQ
A0A4W3JXA1_BMF-01      HQG--RGDGMPMELQP----------------EDRVEVGIGRKLQQIGDQ
A0A452H3N6_BMF-01      --------NPHLQEEP----------REGQR-EALAEVQIARKLQCIADQ
A0A674IPL3_BMF-01      --------NPHLQEEP----------REGQR-EARTEVQIARKLQCIADQ
A0A673TA87_BMF-01      --------GLPLGEQP----------PEGHW-QHRAEVQIARKLQCIADQ
A0A287AIU8_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A7N5JI49_BMF-02      --------GLPLGEQP----------PEGPW-QHRAEVQIARKLQCIADQ
A0A7N5JI49_BMF-01      --------GLPLGEQP----------PEGPW-QHRAEVQIARKLQCIADQ
G1PAU1_BMF-01          --------GSPLGEQP----------PEGQWQHHRAEIQIARKLQSIADQ
Q91ZE9_BMF-02          --------GSPLGEQP----------PEGQFLQHRAEVQIARKLQCIADQ
A0A287AIU8_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A4X1UQ42_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A4X1UQ42_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A7N5JI49_BMF-03      --------GLPLGEQP----------PEGPW-QHRAEVQIARKLQCIADQ
A0A671DWL6_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A286XXB0_BMF-03      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A287CXH0_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A6I8NF73_BMF-01      --------DPSLGEEP----------PEAPW-ERRPEMQVARKLQCIADQ
A0A493T7X1_BMF-01      --------STQLGLKR----------GGEQE-PHWAEVSFTHLFQATSS-
A0A670JUU6_BMF-02      --------SPHLREEP----------RESPQ-ELRTEVQIARKLQCIADQ
A0A670JUU6_BMF-04      --------SPHLREEP----------RESPQ-ELRTEVQIARKLQCIADQ
A0A674GIP8_BMF-03      --------DPHLQEEP----------QEGQR-EARAEVQIARKLQCIADQ
A0A7M4FPU2_BMF-01      --------SPHLQEEH----------QEGHQ-EVRAEVQIARKLQCIADQ
K7FRX2_BMF-01          --------NPHLQEEP----------REGHQ-EARAEVQIARKLQCIADQ
A0A3Q2UCA0_BMF-01      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A3Q2UCA0_BMF-02      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A669PL85_BMF-02      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A663MPI8_BMF-01      --------DPHLQEEP----------REGQR-EARAEVQIARKLQCIADQ
A0A674GIP8_BMF-02      --------DPHLQEEP----------QEGQR-EARAEVQIARKLQCIADQ
U3JS06_BMF-01          --------DPHLQEEP----------QEGQR-EARAEVQIARKLQCIADQ
A0A674GIP8_BMF-01      --------DPHLQEEP----------QEGQR-EARAEVQIARKLQCIADQ
A0A803YBD7_BMF-01      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A663DZQ4_BMF-01      --------DPHLQEEP----------QEGQR-EARAEVQIARKLQCIADQ
A0A672V891_BMF-01      --------DPHLQEEP----------QEGQR-EARAEVQIARKLQCIADQ
A0A493T7X1_BMF-02      --------DPHLQEEP----------QEGQQ-EARAEVQIARKLQCIADQ
A0A3Q2UCA0_BMF-03      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A3Q2UCA0_BMF-04      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A669PL85_BMF-01      --------DPNLQEEP----------QEGQR-EARTEVQIARKLQCIADQ
A0A670XMZ5_BMF-01      --------NPHLQEEP----------QESLQ-ELRTEVQIARKLQCIADQ
A0A803SZ00_BMF-02      --------NPHFQEEP----------QESPQ-ELRTEVQIARKLQCIADQ
A0A803SZ00_BMF-01      --------NPHFQEEP----------QESPQ-ELRTEVQIARKLQCIADQ
A0A803SZ00_BMF-03      --------NPHFQEEP----------QESPQ-ELRTEVQIARKLQCIADQ
A0A670JUU6_BMF-01      --------SPHLREEP----------RESPQ-ELRTEVQIARKLQCIADQ
A0A670JUU6_BMF-05      --------SPHLREEP----------RESPQ-ELRTEVQIARKLQCIADQ
A0A670JUU6_BMF-03      --------SPHLREEP----------RESPQ-ELRTEVQIARKLQCIADQ
A0A337ST43_BMF-02      ---------------P----------TQPGF-ECRREQEWGRSQVRLGCP
A0A2K5KGP2_BMF-01      ---------------P----------AQPCF-EWRREQERGGPQVRLGCP
A0A2K6FFN3_BMF-02      ---------------P----------TQPCF-ERRREQERGRSQ------
A0A2K5E1Q4_BMF-02      ---------------S----------AQPGF-EWRREQEWGRPE------
A0A2K5RN49_BMF-02      ---------------P----------AQPGF-EWRREQEWGRPE------
A0A2K6TW78_BMF-03      ---------------P----------AQPGF-EWRRKQEWGRSE------
A0A2K6RAW1_BMF-02      ---------------P----------AQPCF-EWRRE-------------
A0A2I2Z168_BMF-02      ---------------P----------AQPCF-EWRREQERGRP-------
Q96LC9_BMF-05          ---------------P----------AQPCF-EWRREQERGRP-------
Q96LC9_BMF-07          ---------------P----------AQPCF-EWRREQERGRP-------
A0A2R9BS98_BMF-02      ---------------P----------AQPCF-EWRREQERGRP-------
A0A2J8QDD5_BMF-01      ---------------P----------AQPCF-EWRREQERGRP-------
A0A2K5MJW4_BMF-01      ---------------P----------AQPCF-EWRREQERGGP-------
A0A2K6B5F6_BMF-03      ---------------P----------AQPCF-EWRREQERGGP-------
A0A2K5Z4A9_BMF-02      ---------------P----------AQPCF-EWRREQERGGP-------
A0A2I3HD83_BMF-01      ---------------P----------AQPCF-EWRREQEWGRP-------
F7HZL0_BMF-01          --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A337ST43_BMF-04      --------GLPLGEQP----------PEGHW-QHRAEVQIARKLQCIADQ
A0A337ST43_BMF-05      --------GLPLGEQP----------PEGHW-QHRAEVQIARKLQCIADQ
F7HZL0_BMF-03          --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
Q91ZE9_BMF-06          --------GSPLGEQP----------PEGQFLQHRAEVQIARKLQCIADQ
Q91ZE9_BMF-01          --------GSPLGEQP----------PEGQFLQHRAEVQIARKLQCIADQ
A0A287CXH0_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
G3T7Z4_BMF-01          --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADH
A0A5F8GKJ8_BMF-01      --------SLRLGEEP----------PEEQW-EHRAEVQIAQKLQCIADQ
A0A7N4PJP2_BMF-01      --------SLRLGAEP----------PEEQW-EHRAEVQIARKLQCIADQ
A0A4X2KLG2_BMF-01      --------SLRLGEEP----------PQEQW-EHRTEVQIARKLQCIADQ
A0A3Q2HR24_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A3Q2HR24_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A5F4CJ04_BMF-03      --------GLPLLEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A5F4CJ04_BMF-02      --------GLPLLEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A5F4CJ04_BMF-01      --------GLPLLEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A286XXB0_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
Q96LC9_BMF-06          --------VLPIGEQP----------PEGQW-QHQAE-------------
F7HZL0_BMF-02          --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A096NTE9_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A286XXB0_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A337ST43_BMF-03      --------GLPLGEQP----------PEGHW-QHRAEVQIARKLQCIADQ
A0A7N9CRT3_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6FFN3_BMF-01      --------GLPLGEQP----------AEGQW-QHRAEVQIARKLQCIADQ
H0WYH6_BMF-01          --------GLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K5MJW4_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K5KGP2_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A7N9CRT3_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A5F7ZML1_BMF-03      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A5F7ZML1_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6B5F6_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6B5F6_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6B5F6_BMF-04      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K5Z4A9_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6L919_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6L919_BMF-03      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6RAW1_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A0D9R4R5_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K5E1Q4_BMF-01      --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6TW78_BMF-01      --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6TW78_BMF-02      --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K5RN49_BMF-01      --------VLPLGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2I2Z168_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
Q96LC9_BMF-01          --------VLPIGEQP----------PEGQW-QHQAEVQIARKLQCIADQ
Q96LC9_BMF-02          --------VLPIGEQP----------PEGQW-QHQAEVQIARKLQCIADQ
Q96LC9_BMF-03          --------VLPIGEQP----------PEGQW-QHQAEVQIARKLQCIADQ
Q96LC9_BMF-04          --------VLPIGEQP----------PEGQW-QHQAEVQIARKLQCIADQ
A0A2R9BS98_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2J8QDD5_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2J8T301_BMF-01      --------VLPTGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A7N9CRT3_BMF-03      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A5F7ZML1_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A096NTE9_BMF-01      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A2K6L919_BMF-02      --------VLPIGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
G1SR62_BMF-01          --------NFALGEQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A337ST43_BMF-01      --------GLPLGEQP----------PEGHW-QHRAEVQIARKLQCIADQ
W5QFV1_BMF-01          --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A4W2EII1_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A4W2EII1_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
Q05KI3_BMF-01          --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
Q05KI3_BMF-02          --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A4W2INA4_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
L8IXF5_BMF-01          --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A4W2INA4_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A452F2E0_BMF-02      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A452F2E0_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
A0A667H967_BMF-01      --------GLPLGEQP----------PEGHW-QHRAEVQIARKLQCIADQ
A0A2U4BC98_BMF-01      --------GLPLGEQP----------AEGQW-QHRAEVQIARKLQRIADQ
A0A671DWL6_BMF-01      --------GLPLGEQP----------PEGQW-QHRAEIQIARKLQCIADQ
M3YAD5_BMF-01          --------GLPLGDQP----------PEGQW-QHRAEVQIARKLQCIADQ
U6CSY8_BMF-01          --------GLPLGDQP----------PEGQW-QHRAEVQIARKLQCIADQ
A0A452SED0_BMF-01      --------GLPLGEQP----------PEGPW-QHRAEVQIARKLQCIADQ
A0A384D070_BMF-01      --------GLPLGEQP----------PEGPW-QHRAEVQIARKLQCIADQ
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          FHRLF---------------------------------------------
A0A3B4UNJ0_BMF-01      FQQDHF-----------------------------MRHQRQNL-------
Q0GKC7_BMF-01          FYQEHIMH---------------------------HQRPQ--D-------
A0A673HDR4_BMF-01      FYQEHMM-----------------------------------V-------
A0A672JWL9_BMF-02      FYQD--------------------------------------A-------
A0A671MNR9_BMF-01      FYQEHMMH---------------------------HRNQRNRE-------
A0A672JWL9_BMF-01      FYQEHMMH---------------------------HRNQRNRE-------
A0A3P9ICE1_BMF-01      FHRERLQL--------------------Y------HRNQRNQG-------
A0A671M0H4_BMF-01      FYQEHMMV---------------------------SRVGSGDPVNVF---
A0A671M0H4_BMF-02      FYQEHMMV---------------------------SRVGSGDPVNVF---
A0A3B4B6Y3_BMF-01      FHRDHLQR---------------------------VREH-----------
A0A4W4DZH9_BMF-01      FYQEHMLQ---------------------------HRNQRNHQ-------
A0A3B1K1X5_BMF-01      FYQEHMLQ---------------------------HRNQRNQQ-------
A0A3B4CNJ8_BMF-01      FYQEHMLQ---------------------------HRNQRNQQ-------
A0A3B3RH63_BMF-01      FHQDQLQL--------------------Y------HRNQRNQQ-------
W5N4P7_BMF-01          FHRDYLHM--------------------Y------RRNQRNHQ-------
A0A2U9CJH3_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q2YCX7_BMF-01      FHREHLQL--------------------V------SRNQHKHK-------
A0A3Q2YCX7_BMF-02      FHREHLQL--------------------V------SRNQHKHK-------
A0A668TQU8_BMF-01      FHWERLQL--------------------V------R--------------
A0A3Q3VLX6_BMF-01      FHREHMQL--------------------Y------HRNQRNQG-------
A0A3P8UA78_BMF-01      FHRDHLQL--------------------Y------HRNQRNHG-------
A0A3P8UA78_BMF-03      FHRDHLQL--------------------Y------HRNQRNHG-------
A0A3P8UA78_BMF-02      FHRDHLQL--------------------Y------HRNQRNHG-------
A0A3B5KWG6_BMF-03      FHRERVQL--------------------Y------QRNQRNQG-------
A0A3B5KWG6_BMF-01      FHRERVQL--------------------Y------QRNQRNQG-------
A0A3B5KWG6_BMF-02      FHRERVQL--------------------Y------QRNQRNQG-------
A0A3B3CGR9_BMF-01      FHRERLQL--------------------Y------HQNQRNQG-------
A0A3B3HAU1_BMF-04      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3P9ICE1_BMF-04      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3P9K487_BMF-02      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3B3HAU1_BMF-01      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3B3HAU1_BMF-02      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3B3HAU1_BMF-03      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3P9ICE1_BMF-02      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3P9ICE1_BMF-05      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3P9ICE1_BMF-03      FHRERLQL--------------------Y------HRNQRNQG-------
A0A3P9K487_BMF-01      FHRERLQL--------------------Y------HRNQRNQG-------
A0A672HG10_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A673C8N3_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3P8NFE2_BMF-02      FHWERLQL--------------------V------KASRIQTC-------
I3K2D6_BMF-01          FHWERLQL--------------------Y------HRNQRNQG-------
A0A3P8NFE2_BMF-01      FHWERLQL--------------------Y------HRNQRNQG-------
A0A3Q3C5V2_BMF-01      FHWERLQL--------------------Y------HRNQRNQG-------
A0A3P9DPJ5_BMF-01      FHWERLQL--------------------Y------HRNQRNQG-------
A0A3P9DPJ5_BMF-02      FHWERLQL--------------------Y------HRNQRNQG-------
A0A3B4ETH0_BMF-01      FHWERLQL--------------------Y------HRNQRNQG-------
A0A3Q4G1I4_BMF-01      FHWERLQL--------------------Y------QRNQRNQG-------
A0A3Q1FVH7_BMF-02      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q1FVH7_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q2ZA20_BMF-01      FHREHLQQ--------------------Y------HRNQRNQG-------
A0A665VG08_BMF-01      FHREHLQL--------------------Y------HQNQRNQG-------
A0A3Q3RVI2_BMF-01      FHREHLQL------------------------------------------
A0A3Q1D1K3_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3P8RKY9_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q3RVI2_BMF-02      FHREHLQL--------------------Y------HLNQRNQG-------
A0A4W6DUL1_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q1IPR4_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A0F8AD62_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A671X848_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A667YNR9_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3B4U5H8_BMF-01      FHREHLQL--------------------Y------HQNQRNQG-------
A0A3B4WM88_BMF-01      FHREHLQL--------------------Y------HQNQRNHG-------
A0A3Q3QZ16_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q3QZ16_BMF-02      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3Q2PJX9_BMF-01      FHREHLQQ--------------------R------GSFRSSLAAGEVGK-
A0A3Q2PJX9_BMF-02      FHREHLQQ--------------------Y------HQNQRNQG-------
A0A3Q2PJX9_BMF-03      FHREHLQQ--------------------Y------HQNQRNQG-------
A0A3B5QK08_BMF-02      FHREHLQQ--------------------Y------QQNQRNQG-------
A0A3B5QK08_BMF-01      FHREHLQQ--------------------Y------QQNQRNQG-------
A0A096LRV0_BMF-01      FHREHLQQ--------------------Y------QQNQRNQG-------
A0A3B3WU80_BMF-01      FHREHLQQ--------------------Y------QQNQRNQG-------
A0A3P9Q8E2_BMF-01      FHREHLQQ--------------------Y------QQNQRNQG-------
A0A3Q2CXC4_BMF-02      FHREHLQQ--------------------IPGQPFPHLVHQHQALTLPPL-
A0A3Q2CXC4_BMF-01      FHREHLQQ--------------------Y------HQNQRNQG-------
A0A3Q3GUU5_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A3B5B8F6_BMF-01      FHREHLQL--------------------Y------HRNQRNQG-------
A0A1S3P5K4_BMF-01      FHQEHVQV-VRIPNVTDCTAQLKPTEQAY------CTQRSAERETEQQKW
A0A1S3SNN2_BMF-01      FYQEHLQL--------------------Y------HRNQRNMR-------
A0A674EF64_BMF-01      FYQEHLQL--------------------Y------HRNQRNMR-------
A0A4W5N3A7_BMF-01      FHQEHLQL--------------------Y------HRNQRNMR-------
A0A4W5N721_BMF-01      FHQEHLQV--------------------Y------HRNQRNMR-------
A0A1S3P5K4_BMF-02      FHQEHVQV--------------------Y------HRNQRNMR-------
A0A6F9B4C5_BMF-01      FLQQHLQL--------------------Y------HRNQRNMR-------
A0A6F9BGV6_BMF-01      FHQEHLQL--------------------Y------HRNQRNMR-------
A0A3P8ZIE7_BMF-01      FHEEHLQL--------------------Y------HRNQRNLR-------
A0A673YQV3_BMF-01      FHQEHVQV--------------------Y------HRNQRNMR-------
A9XRH0_BMF-01          FHRLHIQR-----------------------------HQQNRN-------
A0A803YBD7_BMF-02      FHRLHIQR-----------------------------HQQNRN-------
A0A672RK14_BMF-01      FQQDHLQL--------------------------VRVISDET--------
A0A673JJ10_BMF-01      FQQEHLQL--------------------------VILISDETS-------
A0A4W3JXA1_BMF-01      FHSSCMER-----------------------------HHRMEN-------
A0A452H3N6_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A674IPL3_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A673TA87_BMF-01      FHRLHMQQ-----------------------------HQQNRN-------
A0A287AIU8_BMF-02      FHRLHMQQ-----------------------------HQQNQN-------
A0A7N5JI49_BMF-02      FHRLHMQQ-----------------------------HQQNQN-------
A0A7N5JI49_BMF-01      FHRLHMQQ-----------------------------HQQNQN-------
G1PAU1_BMF-01          FHRLQMQQ-----------------------------HQQNRN-------
Q91ZE9_BMF-02          FHRLHTQQ-----------------------------HQQNRD-------
A0A287AIU8_BMF-01      FHRLHMQQ-----------------------------HQQNQN-------
A0A4X1UQ42_BMF-01      FHRLHMQQ-----------------------------HQQNQN-------
A0A4X1UQ42_BMF-02      FHRLHMQQ-----------------------------HQQNQN-------
A0A7N5JI49_BMF-03      FHRLHMQQ-----------------------------HQQNQN-------
A0A671DWL6_BMF-02      FHRLHMQQ-----------------------------HQQNRN-------
A0A286XXB0_BMF-03      FHRLHIQQ-----------------------------HQQNRN-------
A0A287CXH0_BMF-02      FHRLHMQQ-----------------------------HQQNRN-------
A0A6I8NF73_BMF-01      FHRLHTQR-----------------------------HQRNRN-------
A0A493T7X1_BMF-01      -------------------------------------LQGALN-------
A0A670JUU6_BMF-02      FHRLHLQR-----------------------------ICMKD--------
A0A670JUU6_BMF-04      FHRLHLQR-----------------------------ICMKD--------
A0A674GIP8_BMF-03      FHRLHIQR-----------------------------VGRTEI-------
A0A7M4FPU2_BMF-01      FHRLHVQR-----------------------------HQQNRN-------
K7FRX2_BMF-01          FHRLHIQR-----------------------------HQQNRN-------
A0A3Q2UCA0_BMF-01      FHRLHIQR-----------------------------VGCFHR-------
A0A3Q2UCA0_BMF-02      FHRLHIQR-----------------------------VGCFHR-------
A0A669PL85_BMF-02      FHRLHIQR-----------------------------VGCFLR-------
A0A663MPI8_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A674GIP8_BMF-02      FHRLHIQR-------------------------------QNRN-------
U3JS06_BMF-01          FHRLHIQR-----------------------------HQQNRN-------
A0A674GIP8_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A803YBD7_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A663DZQ4_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A672V891_BMF-01      FHRLHMQR-----------------------------HQQNRN-------
A0A493T7X1_BMF-02      FHRLHIQR-----------------------------HQQNRN-------
A0A3Q2UCA0_BMF-03      FHRLHIQR-----------------------------HQQNRN-------
A0A3Q2UCA0_BMF-04      FHRLHIQR-----------------------------HQQNRN-------
A0A669PL85_BMF-01      FHRLHIQR-----------------------------HQQNRN-------
A0A670XMZ5_BMF-01      FHRLHLQR-----------------------------HQQNRN-------
A0A803SZ00_BMF-02      FHRLHLQR-----------------------------HQQNRN-------
A0A803SZ00_BMF-01      FHRLHLQR-----------------------------H--NMG-------
A0A803SZ00_BMF-03      FHRLHLQR-----------------------------HQQNRN-------
A0A670JUU6_BMF-01      FHRLHLQR-----------------------------HQQNRN-------
A0A670JUU6_BMF-05      FHRLHLQR-----------------------------HQQNRN-------
A0A670JUU6_BMF-03      FHRLHLQR-----------------------------LYP----------
A0A337ST43_BMF-02      PRMGHHRK------------------------------DISED-------
A0A2K5KGP2_BMF-01      LHMGHQEH------------------------------RQEGH-------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
F7HZL0_BMF-01          FHRLHVQQ-----------------------------HQQNRN-------
A0A337ST43_BMF-04      FHRLHMQQ-----------------------------HQQNRR-------
A0A337ST43_BMF-05      FHRLHMQQVGMGAWGGGRVCWGWGARTCLSNSVSARLYQDMVP-------
F7HZL0_BMF-03          FHRLHVQQLNKWRPIEIRMTFLQRHNQEMPSWALNPKTRRRRQ-------
Q91ZE9_BMF-06          FHRLHTQQ-----------------------------HQQNRD-------
Q91ZE9_BMF-01          FHRLHTQQ-----------------------------HQQNRD-------
A0A287CXH0_BMF-01      FHRLHMQQ-----------------------------HQQNRN-------
G3T7Z4_BMF-01          FHRLHMQR-----------------------------HQQNRN-------
A0A5F8GKJ8_BMF-01      FHRLHMQR-----------------------------HQQNRN-------
A0A7N4PJP2_BMF-01      FHRLHMQR-----------------------------HQQNQN-------
A0A4X2KLG2_BMF-01      FHRLHMQR-----------------------------HQQNRN-------
A0A3Q2HR24_BMF-02      FHRLHMQQ-----------------------------HQQNRN-------
A0A3Q2HR24_BMF-01      FHRLHMQQ-----------------------------HQQNRN-------
A0A5F4CJ04_BMF-03      FHRLHMQQ-----------------------------HQQNQN-------
A0A5F4CJ04_BMF-02      FHRLHMQQ-----------------------------HQQNQN-------
A0A5F4CJ04_BMF-01      FHRLHMQQ-----------------------------HQQNQN-------
A0A286XXB0_BMF-02      FHRLHIQQ-----------------------------HQQNRN-------
Q96LC9_BMF-06          -------------------------------------HQQNQN-------
F7HZL0_BMF-02          FHRLHVQQ----------------------------------E-------
A0A096NTE9_BMF-02      FHRLHVQQ---------------------------------TS-------
A0A286XXB0_BMF-01      FHRLHIQQ-----------------------------HQQNRN-------
A0A337ST43_BMF-03      FHRLHMQQVGMGAWGGGRVCWGWGARTCLSNSVSARLYQDMVP-------
A0A7N9CRT3_BMF-02      FHRLHV--------------------------------QQNRN-------
A0A2K6FFN3_BMF-01      FHRLHVQQ-----------------------------HQQNQN-------
H0WYH6_BMF-01          FHRLHVQQ-----------------------------HQQNQN-------
A0A2K5MJW4_BMF-02      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K5KGP2_BMF-02      FHRLHVQQ-----------------------------HQQNRN-------
A0A7N9CRT3_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A5F7ZML1_BMF-03      FHRLHVQQ-----------------------------HQQNRN-------
A0A5F7ZML1_BMF-02      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6B5F6_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6B5F6_BMF-02      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6B5F6_BMF-04      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K5Z4A9_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6L919_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6L919_BMF-03      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6RAW1_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A0D9R4R5_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K5E1Q4_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6TW78_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6TW78_BMF-02      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K5RN49_BMF-01      FHQLHVQQ-----------------------------HQQNRN-------
A0A2I2Z168_BMF-01      FHRLHVQQ-----------------------------HQQNQN-------
Q96LC9_BMF-01          FHRLHVQQ-----------------------------HQQNQN-------
Q96LC9_BMF-02          FHRLHVQQ-----------------------------HQQNQN-------
Q96LC9_BMF-03          FHRLHVQQ-----------------------------HQQNQN-------
Q96LC9_BMF-04          FHRLHVQQ-----------------------------HQQNQN-------
A0A2R9BS98_BMF-01      FHRLHVQQ-----------------------------HQQNQN-------
A0A2J8QDD5_BMF-02      FHRLHVQQ-----------------------------HQQNQN-------
A0A2J8T301_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A7N9CRT3_BMF-03      FHRLHVQQ-----------------------------HQQNRN-------
A0A5F7ZML1_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A096NTE9_BMF-01      FHRLHVQQ-----------------------------HQQNRN-------
A0A2K6L919_BMF-02      FHRLHVQQ-----------------------------HQQNRN-------
G1SR62_BMF-01          FHRLHLQQ-----------------------------HQQNRN-------
A0A337ST43_BMF-01      FHRLHMQQ-----------------------------HQQNRR-------
W5QFV1_BMF-01          FHRLHMQQ-----------------------------HQQNRN-------
A0A4W2EII1_BMF-01      FHRLHMQQ-----------------------------YQQNRN-------
A0A4W2EII1_BMF-01      FHRLHMQQ-----------------------------YQQNRN-------
Q05KI3_BMF-01          FHRLHMQQ-----------------------------YQQNRN-------
Q05KI3_BMF-02          FHRLHMQQ-----------------------------YQQNRN-------
A0A4W2INA4_BMF-01      FHRLHMQQ-----------------------------YQQNRN-------
L8IXF5_BMF-01          FHRLHMQQ-----------------------------YQQNRN-------
A0A4W2INA4_BMF-01      FHRLHMQQ-----------------------------YQQNRN-------
A0A452F2E0_BMF-02      FHRLHMQQ-----------------------------HQQNRN-------
A0A452F2E0_BMF-01      FHRLHMQQ-----------------------------HQQNRN-------
A0A667H967_BMF-01      FHRLHMQQ-----------------------------HQQNRR-------
A0A2U4BC98_BMF-01      FHRLHMQQ-----------------------------HQQNRN-------
A0A671DWL6_BMF-01      FHRLHMQQ-----------------------------HQQNRN-------
M3YAD5_BMF-01          FHRLHMQQ-----------------------------HQQNQN-------
U6CSY8_BMF-01          FHRLHMQQ-----------------------------HQQNQN-------
A0A452SED0_BMF-01      FHRLHMQQ-----------------------------HQQNQN-------
A0A384D070_BMF-01      FHRLHMQQ-----------------------------HQQNQN-------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          -----QV-------------------------------------------
A0A3B4UNJ0_BMF-01      -----PA----WM-----------------RLTMALFGFL------FPRQ
Q0GKC7_BMF-01          -----PL----WR-----------------RVATAVLTLL------FGAR
A0A673HDR4_BMF-01      -----TL----LY-----------------TKVFSVCRVC------FGRT
A0A672JWL9_BMF-02      -----PL----HK-----------------SVPCAVF-VL------AGLF
A0A671MNR9_BMF-01      -----PL----WW-----------------RVAVAFYTLL------FGRE
A0A672JWL9_BMF-01      -----PL----WW-----------------RVAVAFYTLL------FGRE
A0A3P9ICE1_BMF-01      -----PV----WW-----------------RLATALVSLL------FDRG
A0A671M0H4_BMF-01      -----SV----RW---------------IIIALCLALALV------YTKA
A0A671M0H4_BMF-02      -----SV----RW---------------IIIALCLALALV------YTKA
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      -----PF----WL-----------------RLASALYVLL------FERE
A0A3B1K1X5_BMF-01      -----PL----WL-----------------RLASALYTLL------FERE
A0A3B4CNJ8_BMF-01      -----PF----WL-----------------RLASALYTLL------FERE
A0A3B3RH63_BMF-01      -----PV----WW-----------------RLVMALCGLL------FERR
W5N4P7_BMF-01          -----PM----WW-----------------RLALALFTFL------FERQ
A0A2U9CJH3_BMF-01      -----PL----WW-----------------RLAAALLSLL------FDRG
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      ------------------------------RMDAF---------------
A0A3Q3VLX6_BMF-01      -----PL----WW-----------------RLGSALLSLL------FDRG
A0A3P8UA78_BMF-01      -----PL----WW-----------------RLTTTLLSLL------FNRG
A0A3P8UA78_BMF-03      -----PL----WW-----------------RLTTTLLSLL------FNRG
A0A3P8UA78_BMF-02      -----PL----WW-----------------RLTTTLLSLL------FNRG
A0A3B5KWG6_BMF-03      -----PL----WW-----------------APGHRSAQPS------V---
A0A3B5KWG6_BMF-01      -----PL----WW-----------------RLGTALLSLL------FDRG
A0A3B5KWG6_BMF-02      -----PL----WW-----------------RLGTALLSLL------FDRG
A0A3B3CGR9_BMF-01      -----PL----WW-----------------RLTTALVSLL------LDRG
A0A3B3HAU1_BMF-04      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3P9ICE1_BMF-04      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3P9K487_BMF-02      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3B3HAU1_BMF-01      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3B3HAU1_BMF-02      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3B3HAU1_BMF-03      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3P9ICE1_BMF-02      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3P9ICE1_BMF-05      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3P9ICE1_BMF-03      -----PV----WW-----------------RLATALVSLL------FDRG
A0A3P9K487_BMF-01      -----PV----WW-----------------RLATALVSLL------FDRG
A0A672HG10_BMF-01      -----PL----WW-----------------RLATTLLSLL------FDRG
A0A673C8N3_BMF-01      -----PL----WW-----------------RLAAALLSLL------FDRG
A0A3P8NFE2_BMF-02      ------------W---------------LETAEAYATPCK------VHHS
I3K2D6_BMF-01          -----PM----WW-----------------RLAAALLSLL------FDRG
A0A3P8NFE2_BMF-01      -----PM----WW-----------------RLAAAILSLL------FDRG
A0A3Q3C5V2_BMF-01      -----PM----WW-----------------RLAAAILSLL------FDRG
A0A3P9DPJ5_BMF-01      -----PM----WW-----------------RLAAAILSLL------FDRG
A0A3P9DPJ5_BMF-02      -----PM----WW-----------------RLAAAILSLL------FDRG
A0A3B4ETH0_BMF-01      -----PM----WW-----------------RLAAAILSLL------FDRG
A0A3Q4G1I4_BMF-01      -----PM----WW-----------------RLAAAILSLL------FDRG
A0A3Q1FVH7_BMF-02      -----PL----WW-----------------RLVAAILSLL------FDGG
A0A3Q1FVH7_BMF-01      -----PL----WW-----------------RLVAAILSLL------FDGG
A0A3Q2ZA20_BMF-01      -----PL----WW-----------------RLTAALLSLL------FDRG
A0A665VG08_BMF-01      -----PL----WW-----------------RLATALLSLL------FDRG
A0A3Q3RVI2_BMF-01      -----QV----GW---------------APETSGSLPVLL------ACLT
A0A3Q1D1K3_BMF-01      -----PL----WW-----------------RLAAAVLSLL------FDRG
A0A3P8RKY9_BMF-01      -----PL----WW-----------------RLAAAVLSLL------FDRG
A0A3Q3RVI2_BMF-02      -----LL----WW-----------------RLATALLSLL------FDRG
A0A4W6DUL1_BMF-01      -----PL----WW-----------------RLAAALLSLL------FDRG
A0A3Q1IPR4_BMF-01      -----PL----WW-----------------RLAAAMLSLL------FDRG
A0A0F8AD62_BMF-01      -----PL----WW-----------------RLGAALLSLL------FDRG
A0A671X848_BMF-01      -----PL----WW-----------------RLGAALINLL------FDRR
A0A667YNR9_BMF-01      -----PL----WW-----------------RLASALLNLL------FDRG
A0A3B4U5H8_BMF-01      -----PL----WW-----------------RLAVALLSLL------FDRG
A0A3B4WM88_BMF-01      -----PL----WW-----------------RLAAALLSLL------FDRG
A0A3Q3QZ16_BMF-01      -----PL----WW-----------------RLATTLLSLL------FDRG
A0A3Q3QZ16_BMF-02      -----PL----WW-----------------RLATTLLSLL------FDRG
A0A3Q2PJX9_BMF-01      -----PM----YYTNVYSQCPTCWLANCLSRLAAELLILC------EFPT
A0A3Q2PJX9_BMF-02      -----PL----WW-----------------RMTAALLSLL------LDRG
A0A3Q2PJX9_BMF-03      -----PL----WW-----------------RMTAALLSLL------LDRG
A0A3B5QK08_BMF-02      -----PL----WW-----------------RMTAALLSLL------FDRG
A0A3B5QK08_BMF-01      -----PL----WW-----------------RMTAALLSLL------FDRG
A0A096LRV0_BMF-01      -----PL----WW-----------------RMTAALLSLL------FHRG
A0A3B3WU80_BMF-01      -----PL----WW-----------------RMTAALLSLL------FHRG
A0A3P9Q8E2_BMF-01      -----PL----WW-----------------RMTAALLSLL------FDRG
A0A3Q2CXC4_BMF-02      -----PV----YF-----------------SLLSPVVPL-----------
A0A3Q2CXC4_BMF-01      -----PL----WW-----------------RMTAALLSLL------FDRG
A0A3Q3GUU5_BMF-01      -----PL----WW-----------------RLGAALLSLL------FDRG
A0A3B5B8F6_BMF-01      -----PL----WW-----------------RLAAALLSLL------FDRG
A0A1S3P5K4_BMF-01      LLYGHPL----CS-----------------RLSVPCLFWL------VSEH
A0A1S3SNN2_BMF-01      -----PM----WW-----------------RLASALFTLL------FEQE
A0A674EF64_BMF-01      -----PL----WW-----------------RLASALFTLL------FEQE
A0A4W5N3A7_BMF-01      -----PL----WW-----------------RVASALLTLL------FEQE
A0A4W5N721_BMF-01      -----PL----WR-----------------RLASALLTLL------FEQE
A0A1S3P5K4_BMF-02      -----PL----WR-----------------RLASALLTLL------FEQE
A0A6F9B4C5_BMF-01      -----PL----WR-----------------RLASALLTLL------FEQE
A0A6F9BGV6_BMF-01      -----PL----WW-----------------RLASALLTLL------FEQE
A0A3P8ZIE7_BMF-01      -----PL----WW-----------------RLASALLTLL------WEQE
A0A673YQV3_BMF-01      -----PL----WR-----------------RLASALLTLL------FEQE
A9XRH0_BMF-01          -----QV----WW---------Q------------LFLFL------HNLA
A0A803YBD7_BMF-02      -----QV----WW---------Q------------LFLFL------HNLA
A0A672RK14_BMF-01      --------SSLWF-------SLQWFLSRCAMTSSSVISML------HMQI
A0A673JJ10_BMF-01      -----FFSSSLWF-------SLQWFLSRCAMTSSSVISML------HMQM
A0A4W3JXA1_BMF-01      -----HVDQPFWW---------R------------LLVLL------FAMI
A0A452H3N6_BMF-01      -----QV----WW---------Q------------ILLFI------HNLA
A0A674IPL3_BMF-01      -----QV----WW---------Q------------ILLFL------HNLA
A0A673TA87_BMF-01      -----RV----WW---------Q------------LLLFL------HNLA
A0A287AIU8_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A7N5JI49_BMF-02      -----RV----WW---------Q------------VLLFL------HNLA
A0A7N5JI49_BMF-01      -----RV----WW---------Q------------VLLFL------HNLA
G1PAU1_BMF-01          -----RM----WW---------Q------------FLLFL------HNLA
Q91ZE9_BMF-02          -----RA----WW---------Q------------VFLFL------QNLA
A0A287AIU8_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A4X1UQ42_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A4X1UQ42_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A7N5JI49_BMF-03      -----RV----WW---------Q------------VLLFL------HNLA
A0A671DWL6_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A286XXB0_BMF-03      -----RA----WW---------Q------------VLLFM------HNLG
A0A287CXH0_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A6I8NF73_BMF-01      -----HV----WW---------R------------VLPLL------HNLA
A0A493T7X1_BMF-01      -----KH----WF-------GGETCTPPAGCEDSEILLLVFKFGVLWTPL
A0A670JUU6_BMF-02      -----------------------------------LHFPLLSVKIKVRFP
A0A670JUU6_BMF-04      -----------------------------------LHFPLLSVKIKVRFP
A0A674GIP8_BMF-03      -----KC----GG---------S------------FFSSY------TTWP
A0A7M4FPU2_BMF-01      -----QV----WW---------Q------------ILLFL------HNLA
K7FRX2_BMF-01          -----QV----WW---------Q------------ILLFL------HNLA
A0A3Q2UCA0_BMF-01      -----GR----WG---------L------------SYLRVVLQKTGSRLR
A0A3Q2UCA0_BMF-02      -----GR----WG---------L------------SYLRVVLQKTGSRLR
A0A669PL85_BMF-02      -----GR----WG---------I------------SYPRVVLQKTGSRLQ
A0A663MPI8_BMF-01      -----QV----WW---------Q------------LFLFL------HNLA
A0A674GIP8_BMF-02      -----QV----WW---------Q------------LFLFL------HNLA
U3JS06_BMF-01          -----QV----WW---------Q------------LFLFL------HNLA
A0A674GIP8_BMF-01      -----QV----WW---------Q------------LFLFL------HNLA
A0A803YBD7_BMF-01      -----QV----WW---------Q------------LFLFL------HNLA
A0A663DZQ4_BMF-01      -----QV----WW---------Q------------LFLFL------HNLA
A0A672V891_BMF-01      -----QV----WW---------Q------------LFLFL------HNLA
A0A493T7X1_BMF-02      -----QV----WW---------Q------------LFLFL------HNLA
A0A3Q2UCA0_BMF-03      -----QV----WW---------Q------------LFLFL------HNLA
A0A3Q2UCA0_BMF-04      -----QV----WW---------Q------------LFLFL------HNLA
A0A669PL85_BMF-01      -----QV----WW---------Q------------LFLFL------HNLA
A0A670XMZ5_BMF-01      -----QV----WW---------Q------------ILLFL------HNLA
A0A803SZ00_BMF-02      -----QV----WW---------Q------------IFFFL------HNVA
A0A803SZ00_BMF-01      -----LL----LW---------TSSERGWADPSCGCFTWR------SCTK
A0A803SZ00_BMF-03      -----QV----WW---------Q------------IFFFL------HNVA
A0A670JUU6_BMF-01      -----QV----WW---------Q------------ILLFL------HNVA
A0A670JUU6_BMF-05      -----QV----WW---------Q------------ILLFL------HNVA
A0A670JUU6_BMF-03      ------------W---------P------------LSL------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      -----RA----GL---------T------------LCLVK------LFFC
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
F7HZL0_BMF-01          -----RM----WW---------Q------------VLLFL------HNLA
A0A337ST43_BMF-04      -----RV----WW---------Q------------ILLFL------HNLA
A0A337ST43_BMF-05      -----EF----WP---------R------------LL-------------
F7HZL0_BMF-03          -----DF----AW---------E------------V---R------GRQG
Q91ZE9_BMF-06          -----RA----WW---------Q------------VFLFL------QNLA
Q91ZE9_BMF-01          -----RA----WW---------Q------------VFLFL------QNLA
A0A287CXH0_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
G3T7Z4_BMF-01          -----PA----WR---------Q------------ILQFL------HHLA
A0A5F8GKJ8_BMF-01      -----HV----WW---------Q------------ILLFL------HNLA
A0A7N4PJP2_BMF-01      -----HV----WW---------Q------------ILLFL------HNLA
A0A4X2KLG2_BMF-01      -----HV----WW---------Q------------ILLFL------HNLA
A0A3Q2HR24_BMF-02      -----RV----WW---------Q------------TLLFL------HNLA
A0A3Q2HR24_BMF-01      -----RV----WW---------Q------------TLLFL------HNLA
A0A5F4CJ04_BMF-03      -----RV----WW---------Q------------ILLFL------HNLA
A0A5F4CJ04_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A5F4CJ04_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A286XXB0_BMF-02      -----RA----WW---------Q------------VLLFM------HNLG
Q96LC9_BMF-06          -----RV----WW---------Q------------ILLFL------HNLA
F7HZL0_BMF-02          -----TE----AW---------R------------IEVTR------PSHT
A0A096NTE9_BMF-02      -----KI----WS---------Q--------------------------S
A0A286XXB0_BMF-01      -----RA----WW---------Q------------VLLFM------HNLG
A0A337ST43_BMF-03      -----EF----WP---------R------------LL-------------
A0A7N9CRT3_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6FFN3_BMF-01      -----RM----WW---------Q------------ILLFL------HNLA
H0WYH6_BMF-01          -----RV----WW---------Q------------VLFFL------HNLA
A0A2K5MJW4_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K5KGP2_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A7N9CRT3_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A5F7ZML1_BMF-03      -----RV----WW---------Q------------ILLFL------HNLA
A0A5F7ZML1_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6B5F6_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6B5F6_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6B5F6_BMF-04      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K5Z4A9_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6L919_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6L919_BMF-03      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6RAW1_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A0D9R4R5_BMF-01      -----RM----WW---------Q------------ILLFL------HNLA
A0A2K5E1Q4_BMF-01      -----RV----WW---------Q------------VLLFL------HNLA
A0A2K6TW78_BMF-01      -----RV----WW---------Q------------VLLFL------HNLA
A0A2K6TW78_BMF-02      -----RV----WW---------Q------------VLLFL------HNLA
A0A2K5RN49_BMF-01      -----RV----WW---------Q------------VLLFL------HNLA
A0A2I2Z168_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
Q96LC9_BMF-01          -----RV----WW---------Q------------ILLFL------HNLA
Q96LC9_BMF-02          -----RV----WW---------Q------------ILLFL------HNLA
Q96LC9_BMF-03          -----RV----WW---------Q------------ILLFL------HNLA
Q96LC9_BMF-04          -----RV----WW---------Q------------ILLFL------HNLA
A0A2R9BS98_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A2J8QDD5_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
A0A2J8T301_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A7N9CRT3_BMF-03      -----RV----WW---------Q------------ILLFL------HNLA
A0A5F7ZML1_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A096NTE9_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A2K6L919_BMF-02      -----RV----WW---------Q------------ILLFL------HNLA
G1SR62_BMF-01          -----RV----WW---------Q------------ILLFL------HNLA
A0A337ST43_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
W5QFV1_BMF-01          -----RM----WW---------Q------------ILLFL------HNVA
A0A4W2EII1_BMF-01      -----RM----WW---------Q------------ILLFL------HNVA
A0A4W2EII1_BMF-01      -----RM----WW---------Q------------ILLFL------HNVA
Q05KI3_BMF-01          -----RM----WW---------Q------------ILLFL------HNVA
Q05KI3_BMF-02          -----RM----WW---------Q------------ILLFL------HNVA
A0A4W2INA4_BMF-01      -----RM----WW---------Q------------ILLFL------HNVA
L8IXF5_BMF-01          -----RM----WW---------Q------------ILLFL------HNVA
A0A4W2INA4_BMF-01      -----RM----WW---------Q------------ILLFL------HNVA
A0A452F2E0_BMF-02      -----RM----WW---------Q------------ILLFL------HNVA
A0A452F2E0_BMF-01      -----RM----WW---------Q------------ILLFL------HNVA
A0A667H967_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A2U4BC98_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A671DWL6_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
M3YAD5_BMF-01          -----RV----WW---------Q------------ILLFL------HNLA
U6CSY8_BMF-01          -----RV----WW---------Q------------ILLFL------HNLA
A0A452SED0_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
A0A384D070_BMF-01      -----RV----WW---------Q------------ILLFL------HNLA
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      ALVPR-LRG--EQR------------------------------------
Q0GKC7_BMF-01          ENRR----------------------------------------------
A0A673HDR4_BMF-01      VS------------------------------------------------
A0A672JWL9_BMF-02      PDSGL-VV------------------------------------------
A0A671MNR9_BMF-01      PNARA-NRR-----------------------------------------
A0A672JWL9_BMF-01      PNARA-NRR-----------------------------------------
A0A3P9ICE1_BMF-01      FIAGA-GGA--GQR------------------------------------
A0A671M0H4_BMF-01      FSMCR-VCF--GRTVS----------------------------------
A0A671M0H4_BMF-02      FSMCR-VCF--GRTVS----------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      PAARW-RGV--DQR------------------------------------
A0A3B1K1X5_BMF-01      PAAHG-RRE--DRR------------------------------------
A0A3B4CNJ8_BMF-01      PVANG-RRV--DQR------------------------------------
A0A3B3RH63_BMF-01      QRA--------EQR------------------------------------
W5N4P7_BMF-01          GNRNQ-LRG--DQR------------------------------------
A0A2U9CJH3_BMF-01      FLAGG-GGA--GRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPP
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      -----------G--------------------------------------
A0A3Q3VLX6_BMF-01      FFAGG-GGA--GRR------------------------------------
A0A3P8UA78_BMF-01      FFAGG-GAA--GRR------------------------------------
A0A3P8UA78_BMF-03      FFAGG-GAA--GRR------------------------------------
A0A3P8UA78_BMF-02      FFAGG-GAA--GRR------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A3B5KWG6_BMF-01      FVAGG-GGA--GRR------------------------------------
A0A3B5KWG6_BMF-02      FVAGG-GGA--GRR------------------------------------
A0A3B3CGR9_BMF-01      FIAGG-GGA--GQR------------------------------------
A0A3B3HAU1_BMF-04      FIAGA-GGA--GQRQSVVSD------------------------------
A0A3P9ICE1_BMF-04      FIAGA-GGA--GQRLSVLSD------------------------------
A0A3P9K487_BMF-02      FIAGA-GGA--GQRLSVMSD------------------------------
A0A3B3HAU1_BMF-01      FIAGA-GGA--GQR------------------------------------
A0A3B3HAU1_BMF-02      FIAGA-GGA--GQR------------------------------------
A0A3B3HAU1_BMF-03      FIAGA-GGA--GQR------------------------------------
A0A3P9ICE1_BMF-02      FIAGA-GGA--GQR------------------------------------
A0A3P9ICE1_BMF-05      FIAGA-GGA--GQR------------------------------------
A0A3P9ICE1_BMF-03      FIAGA-GGA--GQR------------------------------------
A0A3P9K487_BMF-01      FIAGA-GGA--GQR------------------------------------
A0A672HG10_BMF-01      VIAGG-GGGGAGRR------------------------------------
A0A673C8N3_BMF-01      FIAGR-GGA--GQR------------------------------------
A0A3P8NFE2_BMF-02      VITVW-KPR--GLSQWQFLTVN----------------------------
I3K2D6_BMF-01          FIAGG-GGG--GRR------------------------------------
A0A3P8NFE2_BMF-01      FIAGG-GGG--GRR------------------------------------
A0A3Q3C5V2_BMF-01      FIAGG-GGG--GRR------------------------------------
A0A3P9DPJ5_BMF-01      FIAGG-GGG--GRR------------------------------------
A0A3P9DPJ5_BMF-02      FIAGG-GGG--GRR------------------------------------
A0A3B4ETH0_BMF-01      FIAGG-GGG--GRR------------------------------------
A0A3Q4G1I4_BMF-01      FIAGG-GGG--GRR------------------------------------
A0A3Q1FVH7_BMF-02      FIAGG-GGA--GRR------------------------------------
A0A3Q1FVH7_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3Q2ZA20_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A665VG08_BMF-01      LIAGG-GGA--GRR------------------------------------
A0A3Q3RVI2_BMF-01      LITGV-WRE--G--------------------------------------
A0A3Q1D1K3_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3P8RKY9_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3Q3RVI2_BMF-02      FIAGG-GRA--GRR------------------------------------
A0A4W6DUL1_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3Q1IPR4_BMF-01      LIAGG-GGA--GRR------------------------------------
A0A0F8AD62_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A671X848_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A667YNR9_BMF-01      AFAGG-GGA--GRR------------------------------------
A0A3B4U5H8_BMF-01      LIAGG-GGA--GRR------------------------------------
A0A3B4WM88_BMF-01      LIAGG-GGA--GRR------------------------------------
A0A3Q3QZ16_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3Q3QZ16_BMF-02      FIAGG-GGA--GRR------------------------------------
A0A3Q2PJX9_BMF-01      LL------------------------------------------------
A0A3Q2PJX9_BMF-02      FVAGR-GGA--GRR------------------------------------
A0A3Q2PJX9_BMF-03      FVAGR-GGA--GRR------------------------------------
A0A3B5QK08_BMF-02      FIAGG-GGA--GRR------------------------------------
A0A3B5QK08_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A096LRV0_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3B3WU80_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3P9Q8E2_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A3Q2CXC4_BMF-02      -CCGG-KWH-----------------------------------------
A0A3Q2CXC4_BMF-01      LIGGA-GWR-----------------------------------------
A0A3Q3GUU5_BMF-01      FIA----GA--GRR------------------------------------
A0A3B5B8F6_BMF-01      FIAGG-GGA--GRR------------------------------------
A0A1S3P5K4_BMF-01      ALAQC-SDL--SFYPPKT--------------------------------
A0A1S3SNN2_BMF-01      AIAGR-GRA--GWR------------------------------------
A0A674EF64_BMF-01      AIAGR-GRA--GWR------------------------------------
A0A4W5N3A7_BMF-01      AIAGG-GRA--GWR------------------------------------
A0A4W5N721_BMF-01      AIAGG-GRA--GWR------------------------------------
A0A1S3P5K4_BMF-02      AIAGG-ERA--GWR------------------------------------
A0A6F9B4C5_BMF-01      AVAGG-GRA--GWR------------------------------------
A0A6F9BGV6_BMF-01      AIAGR-GR------------------------------------------
A0A3P8ZIE7_BMF-01      AVAGG-GRA--GWR------------------------------------
A0A673YQV3_BMF-01      AIAGG-ERA--GWR------------------------------------
A9XRH0_BMF-01          LNVEA-NRNRTGQR------------------------------------
A0A803YBD7_BMF-02      LNVEA-NRNRTGQR------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      LSGRDDIIFGLPELYCVFVVVKN---------------------------
A0A4W3JXA1_BMF-01      FDPEE-NRAMPGQR------------------------------------
A0A452H3N6_BMF-01      LNVEV-NRNHVGQR------------------------------------
A0A674IPL3_BMF-01      LNVEA-NRNNVGQR------------------------------------
A0A673TA87_BMF-01      LNAEE-NRNGAGPR------------------------------------
A0A287AIU8_BMF-02      LHGDE-NRNGAGPR------------------------------------
A0A7N5JI49_BMF-02      LNADE-NRNGAGPR------------------------------------
A0A7N5JI49_BMF-01      LNADE-NRNGAGPR------------------------------------
G1PAU1_BMF-01          LNGDE-NRNGAGPR------------------------------------
Q91ZE9_BMF-02          LNRQE-NREGVGPW------------------------------------
A0A287AIU8_BMF-01      LHGDE-NRNGAGPR------------------------------------
A0A4X1UQ42_BMF-01      LHGDE-NRNGAGPR------------------------------------
A0A4X1UQ42_BMF-02      LHGDE-NRNGAGPR------------------------------------
A0A7N5JI49_BMF-03      LNADE-NRNGAGPR------------------------------------
A0A671DWL6_BMF-02      LNGDE-NRNGAGPR------------------------------------
A0A286XXB0_BMF-03      LNGEE-NREGAGPR------------------------------------
A0A287CXH0_BMF-02      LNGDE-NRDRAGPR------------------------------------
A0A6I8NF73_BMF-01      LGMEE-NGQGGGPR------------------------------------
A0A493T7X1_BMF-01      CCSLPCEAGSSCPTLSKESQNVGVFGKACCWVPAPVTSVQERQVLG----
A0A670JUU6_BMF-02      PRILS-TCSAVGKKKGMVRFERALDPQREGTYTQLYP--------WPLSL
A0A670JUU6_BMF-04      PRILS-TCSAVGKKKGMVRFERALDPQREGTYTQANPTTGSEGTLWRKRM
A0A674GIP8_BMF-03      --------------------------------------------------
A0A7M4FPU2_BMF-01      LNVEA-NRNQAGQR------------------------------------
K7FRX2_BMF-01          LNVEA-NRNHIGQR------------------------------------
A0A3Q2UCA0_BMF-01      LSRLL-PKAAAGYRQ-----------------------------------
A0A3Q2UCA0_BMF-02      LSRLL-PKAAAGYRQ-----------------------------------
A0A669PL85_BMF-02      LSNGL-GQP-----------------------------------------
A0A663MPI8_BMF-01      LNAEA-NRNHTGQR------------------------------------
A0A674GIP8_BMF-02      LNTEV-NRNHTGQR------------------------------------
U3JS06_BMF-01          LNTEV-NRNHTGQRDNGNLHS-----------------------------
A0A674GIP8_BMF-01      LNTEV-NRNHTGQRNHWLCLK-----------------------------
A0A803YBD7_BMF-01      LNVEA-NRNRTGQR------------------------------------
A0A663DZQ4_BMF-01      LNAEV-NRNHTGQR------------------------------------
A0A672V891_BMF-01      LNAEV-NRNHTGQR------------------------------------
A0A493T7X1_BMF-02      LNVEA-NRNHTGQR------------------------------------
A0A3Q2UCA0_BMF-03      LNVEA-NRNRTGQR------------------------------------
A0A3Q2UCA0_BMF-04      LNVEA-NRNRTGQR------------------------------------
A0A669PL85_BMF-01      LNVEA-NRNRTGQR------------------------------------
A0A670XMZ5_BMF-01      LNVEA-NRQRVGQR------------------------------------
A0A803SZ00_BMF-02      LNMEA-NRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI-------
A0A803SZ00_BMF-01      QRIEL-NGPKGPFQ--------------LYAS------------------
A0A803SZ00_BMF-03      LNMEA-NRHRAGRR------------------------------------
A0A670JUU6_BMF-01      LNMEA-NRHHAGRS-----------FIHGHSA------------------
A0A670JUU6_BMF-05      LNMEA-NRHHAGRR------------------------------------
A0A670JUU6_BMF-03      ------KRDSAGRPKRLQCLSPAQRTLWCISE------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      CYFAF---------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
F7HZL0_BMF-01          LNGEE-NRNGAGPSFQPGQKGMLWNPAGSRLPLHVFPSLPAAVLMERI--
A0A337ST43_BMF-04      LNAEE-NRNGAGPR------------------------------------
A0A337ST43_BMF-05      --------------------------------------------------
F7HZL0_BMF-03          LGREEKKRSGEGVPAHSALPRAGLFSAFPDFLPPL---------------
Q91ZE9_BMF-06          LNRQE-NREGVGPW------------------------------------
Q91ZE9_BMF-01          LNRQE-NREGVGPW------------------------------------
A0A287CXH0_BMF-01      LNGDE-NRDRAGPR------------------------------------
G3T7Z4_BMF-01          VNGEE-NRNGAGPR------------------------------------
A0A5F8GKJ8_BMF-01      LNREE-NRNGAGPR------------------------------------
A0A7N4PJP2_BMF-01      LNREE-NRNGAGPR------------------------------------
A0A4X2KLG2_BMF-01      LNREE-NRNGAGPR------------------------------------
A0A3Q2HR24_BMF-02      LNGDE-NRNGAGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFV
A0A3Q2HR24_BMF-01      LNGDE-NRNGAGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENL
A0A5F4CJ04_BMF-03      LNADE-NRNGAGPS-------------------FQLVPGISCSGAQQDCS
A0A5F4CJ04_BMF-02      LNADE-NRNGAGPS------------QSLQIRFWRLSRNLPCSLRSKTTT
A0A5F4CJ04_BMF-01      LNADE-NRNGAGPS------------QSLQIRFWRLSRNLPCSLRRPATR
A0A286XXB0_BMF-02      LNGEE-NREGAGPR------------------------------------
Q96LC9_BMF-06          LNGEE-NRNGAGPR------------------------------------
F7HZL0_BMF-02          IIC-----------------------------------------------
A0A096NTE9_BMF-02      FGSCG-CHGQDGPNWMSILPSSLSSTLVNCPLSTHVP-------------
A0A286XXB0_BMF-01      LNGEE-NREGAGPR------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
A0A7N9CRT3_BMF-02      LNGEE-NRNGAGPR------------------------------------
A0A2K6FFN3_BMF-01      LNGEE-NRNGAGPR------------------------------------
H0WYH6_BMF-01          LNGEE-NRNGAGPR------------------------------------
A0A2K5MJW4_BMF-02      LNGEE-NRNGAGPR------------------------------------
A0A2K5KGP2_BMF-02      LNGEE-NRNGAGPR------------------------------------
A0A7N9CRT3_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A5F7ZML1_BMF-03      LNGEQ-NRNGAGPR------------------------------------
A0A5F7ZML1_BMF-02      LNGEQ-NRNGAGPR------------------------------------
A0A2K6B5F6_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2K6B5F6_BMF-02      LNGEE-NRNGAGPR------------------------------------
A0A2K6B5F6_BMF-04      LNGEE-NRNGAGPR------------------------------------
A0A2K5Z4A9_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2K6L919_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2K6L919_BMF-03      LNGEE-NRNGAGPR------------------------------------
A0A2K6RAW1_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A0D9R4R5_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2K5E1Q4_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2K6TW78_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2K6TW78_BMF-02      LNGEE-NRNGAGPR------------------------------------
A0A2K5RN49_BMF-01      LNGEE-NRNGAGLR------------------------------------
A0A2I2Z168_BMF-01      LNGEE-NRNGAGPR------------------------------------
Q96LC9_BMF-01          LNGEE-NRNGAGPR------------------------------------
Q96LC9_BMF-02          LNGEE-NRNGAGPR------------------------------------
Q96LC9_BMF-03          LNGEE-NRNGAGPR------------------------------------
Q96LC9_BMF-04          LNGEE-NRNGAGPR------------------------------------
A0A2R9BS98_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A2J8QDD5_BMF-02      LNGEE-NRNGAGPR------------------------------------
A0A2J8T301_BMF-01      LNGEE-NRNGAGPR------------------------------------
A0A7N9CRT3_BMF-03      LNGEE-NRNGAGPRPLTWNGAVVKPC------------------------
A0A5F7ZML1_BMF-01      LNGEQ-NRNGAGPRPLTWNGAVVKPC------------------------
A0A096NTE9_BMF-01      LNGEE-NRNGADPRPLTWNGAVVKPC------------------------
A0A2K6L919_BMF-02      LNGEE-NRNGAGPRPLTWNGGRCQTLLKGRLMCL----------------
G1SR62_BMF-01          LNGDE-NRDGAGPR------------------------------------
A0A337ST43_BMF-01      LNAEE-NRNGAGPRTSPGMRAFVKHC------------------------
W5QFV1_BMF-01          LNGDE-NRNGAGPR------------------------------------
A0A4W2EII1_BMF-01      LNGDE-NRNGAGPR------------------------------------
A0A4W2EII1_BMF-01      LNGDE-NRNGAGPR------------------------------------
Q05KI3_BMF-01          LNGDE-NRNGAGPR------------------------------------
Q05KI3_BMF-02          LNGDE-NRNGAGPR------------------------------------
A0A4W2INA4_BMF-01      LNGDE-NRNGAGPR------------------------------------
L8IXF5_BMF-01          LNGDE-NRNGAGPR------------------------------------
A0A4W2INA4_BMF-01      LNGDE-NRNGAGPR------------------------------------
A0A452F2E0_BMF-02      LNGDE-NRNGAGPR------------------------------------
A0A452F2E0_BMF-01      LNGDE-NRNGAGPR------------------------------------
A0A667H967_BMF-01      LNAEE-NRNGAGPR------------------------------------
A0A2U4BC98_BMF-01      LNGDE-NRNGAGPR------------------------------------
A0A671DWL6_BMF-01      LNGDE-NRNGAGPR------------------------------------
M3YAD5_BMF-01          LNADE-NRNGAGPR------------------------------------
U6CSY8_BMF-01          LNADG-NRNGAGPR------------------------------------
A0A452SED0_BMF-01      LNADE-NRDGAGPR------------------------------------
A0A384D070_BMF-01      LNADE-NRDGAGPR------------------------------------
                                                                         

Q96LC9_BMF-09          --------------------------
Q96LC9_BMF-08          --------------------------
A3KND0_BMF-01          --------------------------
A0A3B4UNJ0_BMF-01      --------------------------
Q0GKC7_BMF-01          --------------------------
A0A673HDR4_BMF-01      --------------------------
A0A672JWL9_BMF-02      --------------------------
A0A671MNR9_BMF-01      --------------------------
A0A672JWL9_BMF-01      --------------------------
A0A3P9ICE1_BMF-01      --------------------------
A0A671M0H4_BMF-01      --------------------------
A0A671M0H4_BMF-02      --------------------------
A0A3B4B6Y3_BMF-01      --------------------------
A0A4W4DZH9_BMF-01      --------------------------
A0A3B1K1X5_BMF-01      --------------------------
A0A3B4CNJ8_BMF-01      --------------------------
A0A3B3RH63_BMF-01      --------------------------
W5N4P7_BMF-01          --------------------------
A0A2U9CJH3_BMF-01      QQLPPPANGRLPCALIG---------
A0A3Q2YCX7_BMF-01      --------------------------
A0A3Q2YCX7_BMF-02      --------------------------
A0A668TQU8_BMF-01      --------------------------
A0A3Q3VLX6_BMF-01      --------------------------
A0A3P8UA78_BMF-01      --------------------------
A0A3P8UA78_BMF-03      --------------------------
A0A3P8UA78_BMF-02      --------------------------
A0A3B5KWG6_BMF-03      --------------------------
A0A3B5KWG6_BMF-01      --------------------------
A0A3B5KWG6_BMF-02      --------------------------
A0A3B3CGR9_BMF-01      --------------------------
A0A3B3HAU1_BMF-04      --------------------------
A0A3P9ICE1_BMF-04      --------------------------
A0A3P9K487_BMF-02      --------------------------
A0A3B3HAU1_BMF-01      --------------------------
A0A3B3HAU1_BMF-02      --------------------------
A0A3B3HAU1_BMF-03      --------------------------
A0A3P9ICE1_BMF-02      --------------------------
A0A3P9ICE1_BMF-05      --------------------------
A0A3P9ICE1_BMF-03      --------------------------
A0A3P9K487_BMF-01      --------------------------
A0A672HG10_BMF-01      --------------------------
A0A673C8N3_BMF-01      --------------------------
A0A3P8NFE2_BMF-02      --------------------------
I3K2D6_BMF-01          --------------------------
A0A3P8NFE2_BMF-01      --------------------------
A0A3Q3C5V2_BMF-01      --------------------------
A0A3P9DPJ5_BMF-01      --------------------------
A0A3P9DPJ5_BMF-02      --------------------------
A0A3B4ETH0_BMF-01      --------------------------
A0A3Q4G1I4_BMF-01      --------------------------
A0A3Q1FVH7_BMF-02      --------------------------
A0A3Q1FVH7_BMF-01      --------------------------
A0A3Q2ZA20_BMF-01      --------------------------
A0A665VG08_BMF-01      --------------------------
A0A3Q3RVI2_BMF-01      --------------------------
A0A3Q1D1K3_BMF-01      --------------------------
A0A3P8RKY9_BMF-01      --------------------------
A0A3Q3RVI2_BMF-02      --------------------------
A0A4W6DUL1_BMF-01      --------------------------
A0A3Q1IPR4_BMF-01      --------------------------
A0A0F8AD62_BMF-01      --------------------------
A0A671X848_BMF-01      --------------------------
A0A667YNR9_BMF-01      --------------------------
A0A3B4U5H8_BMF-01      --------------------------
A0A3B4WM88_BMF-01      --------------------------
A0A3Q3QZ16_BMF-01      --------------------------
A0A3Q3QZ16_BMF-02      --------------------------
A0A3Q2PJX9_BMF-01      --------------------------
A0A3Q2PJX9_BMF-02      --------------------------
A0A3Q2PJX9_BMF-03      --------------------------
A0A3B5QK08_BMF-02      --------------------------
A0A3B5QK08_BMF-01      --------------------------
A0A096LRV0_BMF-01      --------------------------
A0A3B3WU80_BMF-01      --------------------------
A0A3P9Q8E2_BMF-01      --------------------------
A0A3Q2CXC4_BMF-02      --------------------------
A0A3Q2CXC4_BMF-01      --------------------------
A0A3Q3GUU5_BMF-01      --------------------------
A0A3B5B8F6_BMF-01      --------------------------
A0A1S3P5K4_BMF-01      --------------------------
A0A1S3SNN2_BMF-01      --------------------------
A0A674EF64_BMF-01      --------------------------
A0A4W5N3A7_BMF-01      --------------------------
A0A4W5N721_BMF-01      --------------------------
A0A1S3P5K4_BMF-02      --------------------------
A0A6F9B4C5_BMF-01      --------------------------
A0A6F9BGV6_BMF-01      --------------------------
A0A3P8ZIE7_BMF-01      --------------------------
A0A673YQV3_BMF-01      --------------------------
A9XRH0_BMF-01          --------------------------
A0A803YBD7_BMF-02      --------------------------
A0A672RK14_BMF-01      --------------------------
A0A673JJ10_BMF-01      --------------------------
A0A4W3JXA1_BMF-01      --------------------------
A0A452H3N6_BMF-01      --------------------------
A0A674IPL3_BMF-01      --------------------------
A0A673TA87_BMF-01      --------------------------
A0A287AIU8_BMF-02      --------------------------
A0A7N5JI49_BMF-02      --------------------------
A0A7N5JI49_BMF-01      --------------------------
G1PAU1_BMF-01          --------------------------
Q91ZE9_BMF-02          --------------------------
A0A287AIU8_BMF-01      --------------------------
A0A4X1UQ42_BMF-01      --------------------------
A0A4X1UQ42_BMF-02      --------------------------
A0A7N5JI49_BMF-03      --------------------------
A0A671DWL6_BMF-02      --------------------------
A0A286XXB0_BMF-03      --------------------------
A0A287CXH0_BMF-02      --------------------------
A0A6I8NF73_BMF-01      --------------------------
A0A493T7X1_BMF-01      --------------------------
A0A670JUU6_BMF-02      KRDSAGRPKRLQCLSPAQRTLWCISE
A0A670JUU6_BMF-04      LQTTDGGVLE-QEVHPRKPTEHVIPK
A0A674GIP8_BMF-03      --------------------------
A0A7M4FPU2_BMF-01      --------------------------
K7FRX2_BMF-01          --------------------------
A0A3Q2UCA0_BMF-01      --------------------------
A0A3Q2UCA0_BMF-02      --------------------------
A0A669PL85_BMF-02      --------------------------
A0A663MPI8_BMF-01      --------------------------
A0A674GIP8_BMF-02      --------------------------
U3JS06_BMF-01          --------------------------
A0A674GIP8_BMF-01      --------------------------
A0A803YBD7_BMF-01      --------------------------
A0A663DZQ4_BMF-01      --------------------------
A0A672V891_BMF-01      --------------------------
A0A493T7X1_BMF-02      --------------------------
A0A3Q2UCA0_BMF-03      --------------------------
A0A3Q2UCA0_BMF-04      --------------------------
A0A669PL85_BMF-01      --------------------------
A0A670XMZ5_BMF-01      --------------------------
A0A803SZ00_BMF-02      --------------------------
A0A803SZ00_BMF-01      --------------------------
A0A803SZ00_BMF-03      --------------------------
A0A670JUU6_BMF-01      --------------------------
A0A670JUU6_BMF-05      --------------------------
A0A670JUU6_BMF-03      --------------------------
A0A337ST43_BMF-02      --------------------------
A0A2K5KGP2_BMF-01      --------------------------
A0A2K6FFN3_BMF-02      --------------------------
A0A2K5E1Q4_BMF-02      --------------------------
A0A2K5RN49_BMF-02      --------------------------
A0A2K6TW78_BMF-03      --------------------------
A0A2K6RAW1_BMF-02      --------------------------
A0A2I2Z168_BMF-02      --------------------------
Q96LC9_BMF-05          --------------------------
Q96LC9_BMF-07          --------------------------
A0A2R9BS98_BMF-02      --------------------------
A0A2J8QDD5_BMF-01      --------------------------
A0A2K5MJW4_BMF-01      --------------------------
A0A2K6B5F6_BMF-03      --------------------------
A0A2K5Z4A9_BMF-02      --------------------------
A0A2I3HD83_BMF-01      --------------------------
F7HZL0_BMF-01          --------------------------
A0A337ST43_BMF-04      --------------------------
A0A337ST43_BMF-05      --------------------------
F7HZL0_BMF-03          --------------------------
Q91ZE9_BMF-06          --------------------------
Q91ZE9_BMF-01          --------------------------
A0A287CXH0_BMF-01      --------------------------
G3T7Z4_BMF-01          --------------------------
A0A5F8GKJ8_BMF-01      --------------------------
A0A7N4PJP2_BMF-01      --------------------------
A0A4X2KLG2_BMF-01      --------------------------
A0A3Q2HR24_BMF-02      LS--WS--------------------
A0A3Q2HR24_BMF-01      KQPVWLL-------------------
A0A5F4CJ04_BMF-03      CL------------------------
A0A5F4CJ04_BMF-02      PQD-G---------------------
A0A5F4CJ04_BMF-01      IRSLG---------------------
A0A286XXB0_BMF-02      --------------------------
Q96LC9_BMF-06          --------------------------
F7HZL0_BMF-02          --------------------------
A0A096NTE9_BMF-02      --------------------------
A0A286XXB0_BMF-01      --------------------------
A0A337ST43_BMF-03      --------------------------
A0A7N9CRT3_BMF-02      --------------------------
A0A2K6FFN3_BMF-01      --------------------------
H0WYH6_BMF-01          --------------------------
A0A2K5MJW4_BMF-02      --------------------------
A0A2K5KGP2_BMF-02      --------------------------
A0A7N9CRT3_BMF-01      --------------------------
A0A5F7ZML1_BMF-03      --------------------------
A0A5F7ZML1_BMF-02      --------------------------
A0A2K6B5F6_BMF-01      --------------------------
A0A2K6B5F6_BMF-02      --------------------------
A0A2K6B5F6_BMF-04      --------------------------
A0A2K5Z4A9_BMF-01      --------------------------
A0A2K6L919_BMF-01      --------------------------
A0A2K6L919_BMF-03      --------------------------
A0A2K6RAW1_BMF-01      --------------------------
A0A0D9R4R5_BMF-01      --------------------------
A0A2K5E1Q4_BMF-01      --------------------------
A0A2K6TW78_BMF-01      --------------------------
A0A2K6TW78_BMF-02      --------------------------
A0A2K5RN49_BMF-01      --------------------------
A0A2I2Z168_BMF-01      --------------------------
Q96LC9_BMF-01          --------------------------
Q96LC9_BMF-02          --------------------------
Q96LC9_BMF-03          --------------------------
Q96LC9_BMF-04          --------------------------
A0A2R9BS98_BMF-01      --------------------------
A0A2J8QDD5_BMF-02      --------------------------
A0A2J8T301_BMF-01      --------------------------
A0A7N9CRT3_BMF-03      --------------------------
A0A5F7ZML1_BMF-01      --------------------------
A0A096NTE9_BMF-01      --------------------------
A0A2K6L919_BMF-02      --------------------------
G1SR62_BMF-01          --------------------------
A0A337ST43_BMF-01      --------------------------
W5QFV1_BMF-01          --------------------------
A0A4W2EII1_BMF-01      --------------------------
A0A4W2EII1_BMF-01      --------------------------
Q05KI3_BMF-01          --------------------------
Q05KI3_BMF-02          --------------------------
A0A4W2INA4_BMF-01      --------------------------
L8IXF5_BMF-01          --------------------------
A0A4W2INA4_BMF-01      --------------------------
A0A452F2E0_BMF-02      --------------------------
A0A452F2E0_BMF-01      --------------------------
A0A667H967_BMF-01      --------------------------
A0A2U4BC98_BMF-01      --------------------------
A0A671DWL6_BMF-01      --------------------------
M3YAD5_BMF-01          --------------------------
U6CSY8_BMF-01          --------------------------
A0A452SED0_BMF-01      --------------------------
A0A384D070_BMF-01      --------------------------
                                                 

© 1998-2022Legal notice