Dataset for protein Bmf of organism all

[Download (right click)] [Sequences] [Repertoires]

385 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-05      ---M-NS--------------------------------YI---------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      ---M-NS--------------------------------YI---------
A0A8C2TYD3_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      ---M-NS--------------------------------YI---------
A0A8C0U4T1_BMF-01      --------------------------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      --------------------------------------------------
A0A8C9F3R5_BMF-01      ---H-RS--------------------------------P---K------
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A8B9NX34_BMF-01      --------------------------------------------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      --------------------------------------------------
A0A8C6JG54_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-01      ---H-LE--QDGGLSFPAKTGDAQ----------AVISQGCSPRRAALSP
A0A663MPI8_BMF-01      ---M-LL--------------------------------SCLSC------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      --------------------------------------------------
A0A8C2TYD3_BMF-04      --------------------------------------------------
A0AA35JSQ3_BMF-01      ---M-HS----GASEIPSNSTNLCFYDTRHLHDIIQLLHSCVPRPHVCSD
A0A8C6VCH5_BMF-01      ---M-Q--------------------------------------------
A0A6I8NF73_BMF-01      ---M-KW--------------------------------PWPGR------
A0A8D2L6A0_BMF-01      ---M-WV--------------------------------PSP---ESSAL
A0A669PL85_BMF-02      --------------------------------------------------
A0A8C2TYD3_BMF-05      --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      --------------------------------------------------
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      --------------------------------------------------
A0A8I3W4Q3_BMF-03      --------------------------------------------------
A0A8C0RSS3_BMF-02      --------------------------------------------------
A0A8C2SHH9_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-03      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A337ST43_BMF-05      ---M-TR--------------------------------TS--P------
A0A7N5JI49_BMF-01      ---MFPR---E----------------------------AG--L------
A0A0N8EUV8_BMF-02      ---M-AL--------------------------------LC---------
A0A8C2VBL6_BMF-01      ---M-PR--------------------------------AG--V------
A0A8I3W4Q3_BMF-01      ---M-PR--------------------------------AG--V------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      ---M-PR--------------------------------AG--V------
A0A287CXH0_BMF-01      ---M-PR--------------------------------AG--V------
A0A8C0XK68_BMF-01      ---Q-----------------------------------LG--F------
A0A3Q2HR24_BMF-02      ---M-GG-------------------------------------------
G3T7Z4_BMF-01          ---M-PR--------------------------------AG--V------
A0A671DWL6_BMF-02      ---M-PY-------------------------------------------
A0A8C6GZK8_BMF-01      ---M-PG--------------------------------AG--V------
A0A3Q2HR24_BMF-05      --------------------------------------------------
A0A8C5R6G2_BMF-01      ---M----------------------------------------------
A0A7N5JI49_BMF-03      ---M-R-------------------------------------A------
A0A8C0TVZ9_BMF-03      --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-06      --------------------------------------------------
A0A7N5JI49_BMF-02      ---M-PR--------------------------------AG--V------
A0A8C6R2L6_BMF-01      ---M-PR--------------------------------AG--V------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-03      ---M-PG--------------------------------AG--V------
A0A8C0TVZ9_BMF-04      ---M-GA---R----------------------------EG--L------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      --------------------------------------------------
A0A2K5VLA3_BMF-03      --------------------------------------------------
A0A673TA87_BMF-01      CFQG-KVRTFV----------------------------TV--P------
A0A8D2HTN1_BMF-02      ---M-RC-------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      --------------------------------------------------
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      --------------------------------------------------
A0A8B9FZ48_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A803SZ00_BMF-03      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A663DZQ4_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A8C0EML4_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      --------------------------------------------------
A0A8C0PT40_BMF-01      --------------------------------------------------
A0A8C0TVZ9_BMF-05      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A8C0XK68_BMF-02      --------------------------------------------------
A0A8C3WX89_BMF-01      --------------------------------------------------
A0A8C3VHE5_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A286XXB0_BMF-02      ---M-PG--------------------------------AG--V------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A8C0GH19_BMF-01      --------------------------------------------------
A0A8C3XI05_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-02      --------------------------------------------------
A0A8C3LTE5_BMF-01      --------------------------------------------------
A0A8C3EY31_BMF-02      --------------------------------------------------
A0A8C3EY31_BMF-01      --------------------------------------------------
A0A8C2MZN7_BMF-02      --------------------------------------------------
A0A8C2MZN7_BMF-01      ---M-PG--------------------------------AG--V------
A0A7M4FPU2_BMF-01      --------------------------------------------------
A0A8C3QVS1_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      --------------------------------------------------
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-04      --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A8C5K765_BMF-01      --------------------------------------------------
A0A8C5K765_BMF-02      --------------------------------------------------
A0A8C5IIR3_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      --------------------------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------------------------------
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A8C6B0J8_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          ---M-PG--------------------------------AG--V------
Q91ZE9_BMF-02          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      --------------------------------------------------
A0A8C6VCH5_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A8C8WD49_BMF-02      --------------------------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A0A8C8RL12_BMF-01      --------------------------------------------------
A0A6I9LHF8_BMF-01      ---M-PG--------------------------------AG--V------
A0A8C9LTX9_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-04      ---M-NS--------------------------------YI---------
A0A670JUU6_BMF-05      --------------------------------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      --------------------------------------------------
A0A8C8ZAV1_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------------------
A0A8I6GLK7_BMF-01      ---M-PG--------------------------------AG--V------
Q8K589_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A8D2AYP3_BMF-01      --------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      --------------------------------------------------
A0A672V891_BMF-01      --------------------------------------------------
A0A287BML0_BMF-01      --------------------------------------------------
A0A287BML0_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-03      ---M-R-------------------------------------A------
A0A674GIP8_BMF-02      --------------------------------------------------
A0A674GIP8_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-01      --------------------------------------------------
A0A8C4XVG9_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      --------------------------------------------------
A0A8B9BPF5_BMF-01      --------------------------------------------------
A0A8B9EVW2_BMF-01      --------------------------------------------------
A0A8C3GPS7_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      --------------------------------------------------
A0A8D0FU29_BMF-01      --------------------------------------------------
A0A8C0JZ72_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-01      --------------------------------------------------
A0A8I3PRV2_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A8D2E2Z1_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-01      --------------------------------------------------
A0A669PL85_BMF-01      --------------------------------------------------
A0A8C5THT3_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-02      --------------------------------------------------
A0A8C3N153_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A8C6A5T3_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-03      --------------------------------------------------
A0A8C5IIR3_BMF-02      --------------------------------------------------
A0A8D2MHD7_BMF-01      --------------------------------------------------
A0A8D2MHD7_BMF-02      --------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-01      --------------------------------------------------
A0A8C9BKQ1_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A670XMZ5_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      --------------------------------------------------
A0A8C0U4T1_BMF-01      --------------------------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      --------------------------------------------------
A0A8C9F3R5_BMF-01      ---------NTPT-PRSERP-KSRRGTA----------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A8B9NX34_BMF-01      --------------------------------------------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      --------------------------------------------------
A0A8C6JG54_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-01      GRGLGPLLRLRPT-PGTDEESGEASTRGSPPGLARPAGVLRAGSCGVTDG
A0A663MPI8_BMF-01      --------------------------------------------------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      --------------------------------------------------
A0A8C2TYD3_BMF-04      --------------------------------------------------
A0AA35JSQ3_BMF-01      I-----LGKNNKCLKGAEEE-KERKDRG----------------------
A0A8C6VCH5_BMF-01      --------------------------------------------------
A0A6I8NF73_BMF-01      --------------------------------------------------
A0A8D2L6A0_BMF-01      N-----FNRLNNA-KRKEEESED---------------------------
A0A669PL85_BMF-02      --------------------------------------------------
A0A8C2TYD3_BMF-05      --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      --------------------------------------------------
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      --------------------------------------------------
A0A8I3W4Q3_BMF-03      --------------------------------------------------
A0A8C0RSS3_BMF-02      --------------------------------------------------
A0A8C2SHH9_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-03      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A337ST43_BMF-05      -----------------GQK--K---------------------RPRWE-
A0A7N5JI49_BMF-01      -----------------F--------------------------------
A0A0N8EUV8_BMF-02      --------------------------------------------------
A0A8C2VBL6_BMF-01      -----------------FWK--Q--------------------YRAVCP-
A0A8I3W4Q3_BMF-01      -----------------FWK--Q--------------------YRTVRS-
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      -----------------FWK--Q--------------------YRAVRG-
A0A287CXH0_BMF-01      -----------------FWK--Q--------------------YRAVRS-
A0A8C0XK68_BMF-01      -----------------F--------------------------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
G3T7Z4_BMF-01          -----------------FWK--Q--------------------YRTVLS-
A0A671DWL6_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-01      -----------------FWK--Q--------------------YRAVCL-
A0A3Q2HR24_BMF-05      --------------------------------------------------
A0A8C5R6G2_BMF-01      --------------------------------------------------
A0A7N5JI49_BMF-03      -----------------WWL--L--------------------LRA----
A0A8C0TVZ9_BMF-03      --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-06      --------------------------------------------------
A0A7N5JI49_BMF-02      -----------------FWK--Q--------------------YRAVHS-
A0A8C6R2L6_BMF-01      -----------------FWK--Q--------------------YRALSR-
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-03      -----------------FWK--Q--------------------YRAVRR-
A0A8C0TVZ9_BMF-04      -----------------G--------------------------------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      --------------------------------------------------
A0A2K5VLA3_BMF-03      --------------------------------------------------
A0A673TA87_BMF-01      -----------------GS-------------------------RPARD-
A0A8D2HTN1_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      --------------------------------------------------
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      --------------------------------------------------
A0A8B9FZ48_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A803SZ00_BMF-03      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A663DZQ4_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A8C0EML4_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      --------------------------------------------------
A0A8C0PT40_BMF-01      --------------------------------------------------
A0A8C0TVZ9_BMF-05      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A8C0XK68_BMF-02      --------------------------------------------------
A0A8C3WX89_BMF-01      --------------------------------------------------
A0A8C3VHE5_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A286XXB0_BMF-02      -----------------FWK--Q--------------------YRARRR-
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A8C0GH19_BMF-01      --------------------------------------------------
A0A8C3XI05_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-02      --------------------------------------------------
A0A8C3LTE5_BMF-01      --------------------------------------------------
A0A8C3EY31_BMF-02      --------------------------------------------------
A0A8C3EY31_BMF-01      --------------------------------------------------
A0A8C2MZN7_BMF-02      --------------------------------------------------
A0A8C2MZN7_BMF-01      -----------------FWK--Q--------------------YREVRR-
A0A7M4FPU2_BMF-01      --------------------------------------------------
A0A8C3QVS1_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      --------------------------------------------------
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-04      --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A8C5K765_BMF-01      --------------------------------------------------
A0A8C5K765_BMF-02      --------------------------------------------------
A0A8C5IIR3_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      --------------------------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------------------------------
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A8C6B0J8_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          -----------------FWK--Q--------------------YRAVCR-
Q91ZE9_BMF-02          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      --------------------------------------------------
A0A8C6VCH5_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A8C8WD49_BMF-02      --------------------------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A0A8C8RL12_BMF-01      --------------------------------------------------
A0A6I9LHF8_BMF-01      -----------------FWK--Q--------------------YRAVRR-
A0A8C9LTX9_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-04      --------------------------------------------------
A0A670JUU6_BMF-05      --------------------------------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      --------------------------------------------------
A0A8C8ZAV1_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------------------
A0A8I6GLK7_BMF-01      -----------------FWK--Q--------------------YRAVRG-
Q8K589_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A8D2AYP3_BMF-01      --------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      --------------------------------------------------
A0A672V891_BMF-01      --------------------------------------------------
A0A287BML0_BMF-01      --------------------------------------------------
A0A287BML0_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-03      -----------------WWF--L--------------------LRP----
A0A674GIP8_BMF-02      --------------------------------------------------
A0A674GIP8_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-01      --------------------------------------------------
A0A8C4XVG9_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      --------------------------------------------------
A0A8B9BPF5_BMF-01      --------------------------------------------------
A0A8B9EVW2_BMF-01      --------------------------------------------------
A0A8C3GPS7_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      --------------------------------------------------
A0A8D0FU29_BMF-01      --------------------------------------------------
A0A8C0JZ72_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-01      --------------------------------------------------
A0A8I3PRV2_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A8D2E2Z1_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-01      --------------------------------------------------
A0A669PL85_BMF-01      --------------------------------------------------
A0A8C5THT3_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-02      --------------------------------------------------
A0A8C3N153_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A8C6A5T3_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-03      --------------------------------------------------
A0A8C5IIR3_BMF-02      --------------------------------------------------
A0A8D2MHD7_BMF-01      --------------------------------------------------
A0A8D2MHD7_BMF-02      --------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-01      --------------------------------------------------
A0A8C9BKQ1_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A670XMZ5_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      --------------------------------------------------
A0A8C0U4T1_BMF-01      --------------------------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      --------------------------------------------------
A0A8C9F3R5_BMF-01      -----ALLAAP--GPAAPPEAG---SPSARLSRPSPQ----PF---PGRP
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A8B9NX34_BMF-01      --------------------------------------------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      --------------------------------------------------
A0A8C6JG54_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-01      SPGRAPAGAGP--GRAQPAPAR---GGDSRPRPPAPQ----PGRAGPGRA
A0A663MPI8_BMF-01      --------------------------------------------------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      --------------------------------------------------
A0A8C2TYD3_BMF-04      --------------------------------------------------
A0AA35JSQ3_BMF-01      -----AFLTQG--SVTN---------------------------------
A0A8C6VCH5_BMF-01      --------------------------------------------------
A0A6I8NF73_BMF-01      --------------------------------------------------
A0A8D2L6A0_BMF-01      --------------------------------------------------
A0A669PL85_BMF-02      --------------------------------------------------
A0A8C2TYD3_BMF-05      --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      --------------------------------------------------
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      --------------------------------------------------
A0A8I3W4Q3_BMF-03      --------------------------------------------------
A0A8C0RSS3_BMF-02      --------------------------------------------------
A0A8C2SHH9_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-03      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A337ST43_BMF-05      -----WLWEGP--GR--RCGASLS-SEAGHIWGGCHPQWYFIT---RSFV
A0A7N5JI49_BMF-01      ----------------------------------------------PSFP
A0A0N8EUV8_BMF-02      --------------------------------------------------
A0A8C2VBL6_BMF-01      -----GLLRAR--PP--------------RRPPPAAL----GF---PLLP
A0A8I3W4Q3_BMF-01      -----GLLPPR--PA--SAVAA---ALCLRLPPPAAARW--AF---SLLP
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      -----GLLRRP--PE--SAAAAGP-ASGSRLPPPASRQSPLLS---PSFP
A0A287CXH0_BMF-01      -----GLLRRP--PE--SAAAAGP-ASGSRLP------------------
A0A8C0XK68_BMF-01      ----------------------------------------------PPSQ
A0A3Q2HR24_BMF-02      --------------------------------------------------
G3T7Z4_BMF-01          -----LVHQRP--PA--LAAAA---VRSPRLPPLPAE----LF---PSFP
A0A671DWL6_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-01      -----GLLPRQLAPA--AFAAA---ARATASHRSPLE----FA---PFFP
A0A3Q2HR24_BMF-05      --------------------------------------------------
A0A8C5R6G2_BMF-01      --------------------------------------------------
A0A7N5JI49_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-03      --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-06      --------------------------------------------------
A0A7N5JI49_BMF-02      -----GLLPRQ--PA--SCRRR----PCPCLPPPATR-------------
A0A8C6R2L6_BMF-01      -----GLLPRQLVPA--AAAAA---PCATRLP------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-03      -----GLLRAH--PR--RRRRS---PSP----------------------
A0A8C0TVZ9_BMF-04      --------------------------------------------------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      --------------------------------------------------
A0A2K5VLA3_BMF-03      --------------------------------------------------
A0A673TA87_BMF-01      -----LGLHSP--LA--GRGRDAREAGPHQLFAGCPERAYF---------
A0A8D2HTN1_BMF-02      ---------------------------RTHIWAHCSKWKLW---------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      --------------------------------------------------
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      --------------------------------------------------
A0A8B9FZ48_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A803SZ00_BMF-03      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A663DZQ4_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A8C0EML4_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      --------------------------------------------------
A0A8C0PT40_BMF-01      --------------------------------------------------
A0A8C0TVZ9_BMF-05      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A8C0XK68_BMF-02      --------------------------------------------------
A0A8C3WX89_BMF-01      --------------------------------------------------
A0A8C3VHE5_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A286XXB0_BMF-02      ----------------------------RRGP------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A8C0GH19_BMF-01      --------------------------------------------------
A0A8C3XI05_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-02      --------------------------------------------------
A0A8C3LTE5_BMF-01      --------------------------------------------------
A0A8C3EY31_BMF-02      --------------------------------------------------
A0A8C3EY31_BMF-01      --------------------------------------------------
A0A8C2MZN7_BMF-02      --------------------------------------------------
A0A8C2MZN7_BMF-01      -----GLLPRQLAPA--AATAP---ARATASCRSPLE----FA---PSFP
A0A7M4FPU2_BMF-01      --------------------------------------------------
A0A8C3QVS1_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      --------------------------------------------------
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-04      --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A8C5K765_BMF-01      --------------------------------------------------
A0A8C5K765_BMF-02      --------------------------------------------------
A0A8C5IIR3_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      --------------------------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------------------------------
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A8C6B0J8_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          -----GLLPRQLAPA--AVAAA---ARATASHRSPLE----FA---PFFP
Q91ZE9_BMF-02          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      --------------------------------------------------
A0A8C6VCH5_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A8C8WD49_BMF-02      --------------------------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A0A8C8RL12_BMF-01      --------------------------------------------------
A0A6I9LHF8_BMF-01      -----GLLSRQLAPA--AAAAL---ARTTASRRSPLE----FA---PSFP
A0A8C9LTX9_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-04      --------------------------------------------------
A0A670JUU6_BMF-05      --------------------------------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      --------------------------------------------------
A0A8C8ZAV1_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------------------
A0A8I6GLK7_BMF-01      -----GLLPRQLTPT--AVAAR---ARATTSHRSPLE----FV---PFFP
Q8K589_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A8D2AYP3_BMF-01      --------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      --------------------------------------------------
A0A672V891_BMF-01      --------------------------------------------------
A0A287BML0_BMF-01      --------------------------------------------------
A0A287BML0_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-03      --------------------------------------------------
A0A674GIP8_BMF-02      --------------------------------------------------
A0A674GIP8_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-01      --------------------------------------------------
A0A8C4XVG9_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      --------------------------------------------------
A0A8B9BPF5_BMF-01      --------------------------------------------------
A0A8B9EVW2_BMF-01      --------------------------------------------------
A0A8C3GPS7_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      --------------------------------------------------
A0A8D0FU29_BMF-01      --------------------------------------------------
A0A8C0JZ72_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-01      --------------------------------------------------
A0A8I3PRV2_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A8D2E2Z1_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-01      --------------------------------------------------
A0A669PL85_BMF-01      --------------------------------------------------
A0A8C5THT3_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-02      --------------------------------------------------
A0A8C3N153_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A8C6A5T3_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-03      --------------------------------------------------
A0A8C5IIR3_BMF-02      --------------------------------------------------
A0A8D2MHD7_BMF-01      --------------------------------------------------
A0A8D2MHD7_BMF-02      --------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-01      --------------------------------------------------
A0A8C9BKQ1_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A670XMZ5_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-05      --------------------------EVTLTS------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      --------------------------EVTLTS------------------
A0A8C2TYD3_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      --------------------------EVTLTS------------------
A0A8C0U4T1_BMF-01      --------------------------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      --------------------------------------------------
A0A8C9F3R5_BMF-01      -LARGG-RC--RSAPPL---------LIGCRAGAGPARRGWGCRQLFAVR
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A8B9NX34_BMF-01      --------------------------------------------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      --------------------------------------------------
A0A8C6JG54_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-01      HLSRGGGGCPSRRAPPL---------PAHWPAGGGGARRGRGRRQLFAVR
A0A663MPI8_BMF-01      --------------------------------------------------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      --------------------------------------------------
A0A8C2TYD3_BMF-04      --------------------------------------------------
A0AA35JSQ3_BMF-01      -----------------------------------NLR------------
A0A8C6VCH5_BMF-01      --------------------------------------------------
A0A6I8NF73_BMF-01      --------------------------------------------------
A0A8D2L6A0_BMF-01      --------------------------------------------------
A0A669PL85_BMF-02      --------------------------------------------------
A0A8C2TYD3_BMF-05      --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      --------------------------------------------------
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      --------------------------------------------------
A0A8I3W4Q3_BMF-03      --------------------------------------------------
A0A8C0RSS3_BMF-02      --------------------------------------------------
A0A8C2SHH9_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-03      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A337ST43_BMF-05      -ISVG------PHFPQVEGKGERKGGVLQV----RP--------------
A0A7N5JI49_BMF-01      -IE-W------APSPRV---------LVTLDPGAEP--------------
A0A0N8EUV8_BMF-02      --------------------------------------------------
A0A8C2VBL6_BMF-01      -HRVW------APSPRV---------LVTLDPGAEP--------------
A0A8I3W4Q3_BMF-01      -NRVW------ASSPRV---------LVTLDPGAEP--------------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      -IESG------RQ-APV---------FITLDPGTEP--------------
A0A287CXH0_BMF-01      --GSG------VSLPQV---------FITLDPGAEP--------------
A0A8C0XK68_BMF-01      -SSLG------AKPPRV---------LVTLDPGAEP--------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
G3T7Z4_BMF-01          -IESG------RQAPRV---------LVTLDPGAEP--------------
A0A671DWL6_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-01      -IECG------HQAPRV---------FFTLDPGAEP--------------
A0A3Q2HR24_BMF-05      --------------------------------------------------
A0A8C5R6G2_BMF-01      --------------------------------------------------
A0A7N5JI49_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-03      --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-06      --------------------------------------------------
A0A7N5JI49_BMF-02      -RGPW------APSPRV---------LVTLDPGAEP--------------
A0A8C6R2L6_BMF-01      ------------PHPRL---------LVTLDPGAEP--------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-04      -----------------------------CGRVGGP--------------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      --------------------------------------------------
A0A2K5VLA3_BMF-03      --------------------------------------------------
A0A673TA87_BMF-01      --------------GNN---------TAR---------------------
A0A8D2HTN1_BMF-02      --------------GSI---------WNS---------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      --------------------------------------------------
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      --------------------------------------------------
A0A8B9FZ48_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A803SZ00_BMF-03      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A663DZQ4_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A8C0EML4_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      --------------------------------------------------
A0A8C0PT40_BMF-01      --------------------------------------------------
A0A8C0TVZ9_BMF-05      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A8C0XK68_BMF-02      --------------------------------------------------
A0A8C3WX89_BMF-01      --------------------------------------------------
A0A8C3VHE5_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A286XXB0_BMF-02      ------------DPPRV---------FVTLDPGTEP--------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A8C0GH19_BMF-01      --------------------------------------------------
A0A8C3XI05_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-02      --------------------------------------------------
A0A8C3LTE5_BMF-01      --------------------------------------------------
A0A8C3EY31_BMF-02      --------------------------------------------------
A0A8C3EY31_BMF-01      --------------------------------------------------
A0A8C2MZN7_BMF-02      --------------------------------------------------
A0A8C2MZN7_BMF-01      -IECG------RQAPRV---------LITLDPGAEP--------------
A0A7M4FPU2_BMF-01      --------------------------------------------------
A0A8C3QVS1_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      --------------------------------------------------
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-04      --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A8C5K765_BMF-01      --------------------------------------------------
A0A8C5K765_BMF-02      --------------------------------------------------
A0A8C5IIR3_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      --------------------------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------------------------------
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A8C6B0J8_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          -IECG------HQAPRV---------FFTLDPGAEP--------------
Q91ZE9_BMF-02          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      --------------------------------------------------
A0A8C6VCH5_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A8C8WD49_BMF-02      --------------------------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A0A8C8RL12_BMF-01      --------------------------------------------------
A0A6I9LHF8_BMF-01      -IECG------RQAPRV---------LVTLDPGAEP--------------
A0A8C9LTX9_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-04      --------------------------EVTLTS------------------
A0A670JUU6_BMF-05      --------------------------------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      --------------------------------------------------
A0A8C8ZAV1_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------------------
A0A8I6GLK7_BMF-01      -IECG------RQVPRV---------FVTLDPGAEP--------------
Q8K589_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A8D2AYP3_BMF-01      --------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      --------------------------------------------------
A0A672V891_BMF-01      --------------------------------------------------
A0A287BML0_BMF-01      --------------------------------------------------
A0A287BML0_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-03      --------------------------------------------------
A0A674GIP8_BMF-02      --------------------------------------------------
A0A674GIP8_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-01      --------------------------------------------------
A0A8C4XVG9_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      --------------------------------------------------
A0A8B9BPF5_BMF-01      --------------------------------------------------
A0A8B9EVW2_BMF-01      --------------------------------------------------
A0A8C3GPS7_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      --------------------------------------------------
A0A8D0FU29_BMF-01      --------------------------------------------------
A0A8C0JZ72_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-01      --------------------------------------------------
A0A8I3PRV2_BMF-02      --------------------------------------------------
A0A8I3PRV2_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A8D2E2Z1_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-01      --------------------------------------------------
A0A669PL85_BMF-01      --------------------------------------------------
A0A8C5THT3_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-02      --------------------------------------------------
A0A8C3N153_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A8C6A5T3_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-03      --------------------------------------------------
A0A8C5IIR3_BMF-02      --------------------------------------------------
A0A8D2MHD7_BMF-01      --------------------------------------------------
A0A8D2MHD7_BMF-02      --------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-01      --------------------------------------------------
A0A8C9BKQ1_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A670XMZ5_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      -------------------------------------------MEPP---
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      -------------------------------------------MDPP---
A0AA35JSQ3_BMF-05      -----------------VAM-----------------DLFPGEMDSP---
A0A8B9NX34_BMF-02      -------------------------------------------MDRP---
A0A670JUU6_BMF-02      -------------------------------------------MDSP---
A0A493T7X1_BMF-01      -------------------------------------------MDRP---
A0A670JUU6_BMF-01      -----------------VGM-----------------DLFPGEMDSP---
A0A8C2TYD3_BMF-03      -------------------------------------------MDRP---
A0A8B9VI07_BMF-02      -------------------------------------------MDRP---
A0A670JUU6_BMF-04      -----------------VGM-----------------DLFPGEMDSP---
A0A8C0U4T1_BMF-01      -------------------------------------------MDRP---
A0A8C5ST95_BMF-01      -------------------------------------------MDPP---
A0A803SZ00_BMF-02      -------------------------------------------MDPP---
A0A8C9F3R5_BMF-01      SA-AAAVWRWGGA--VTVPALGAPPSLWDARPGPARPGPLGGAMDRP---
A0A337ST43_BMF-02      -------------------------------------------MEPP---
A0A337ST43_BMF-04      -------------------------------------------MTRT---
A0A8B9NX34_BMF-01      -------------------------------------------MDRP---
A0A803JQ26_BMF-01      -------------------------------------------MEQE---
A0A674GIP8_BMF-03      -------------------------------------------MDRP---
A0A8B9VI07_BMF-03      -------------------------------------------MDRP---
A0A8C4J3Z9_BMF-02      -------------------------------------------MDHP---
A0A8C6JG54_BMF-02      -------------------------------------------MDRP---
A0A8B9MY06_BMF-01      PAAAAAVWRWGGA--AAAPGTPR--------PR-GTPVPLLGAMDRP---
A0A663MPI8_BMF-01      ----------FLK--C---------------------PFIAGAMDRP---
A0A8C9F3R5_BMF-02      -------------------------------------------MDRP---
A0A8C4J3Z9_BMF-04      -------------------------------------------MDHP---
A0A8C2TYD3_BMF-04      -------------------------------------------MDRP---
A0AA35JSQ3_BMF-01      -----------TG--R---------------------TKKKGEMDSP---
A0A8C6VCH5_BMF-01      -------------------------------------GQEIGEMDPP---
A0A6I8NF73_BMF-01      --------RYGCA--R---------------------SLSAGRMELS---
A0A8D2L6A0_BMF-01      ----CKKWRWFVT--G---------------------SNPLGEMEPS---
A0A669PL85_BMF-02      -------------------------------------------MDRP---
A0A8C2TYD3_BMF-05      -------------------------------------------MDRP---
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      -------------------------------------------MDRP---
A0A8C1UAR1_BMF-01      -------------------------------------------M------
A0A8I3W4Q3_BMF-02      -------------------------------------------MEPS---
A0A3Q2HR24_BMF-03      -------------------------------------------MEPP---
G1PAU1_BMF-01          -------------------------------------------MEPP---
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      -------------------------------------------MEPP---
A0A8I3W4Q3_BMF-03      -------------------------------------------MEPS---
A0A8C0RSS3_BMF-02      -------------------------------------------MEPP---
A0A8C2SHH9_BMF-01      -------------------------------------------MEPP---
A0A8C0PT40_BMF-03      -------------------------------------------MEPP---
A0A2K6L919_BMF-02      -------------------------------------------MEPS---
A0A096NTE9_BMF-02      -------------------------------------------MEPS---
A0A337ST43_BMF-05      -------SGRGQH--PRCLH-----------------CTPAGEMEPP---
A0A7N5JI49_BMF-01      -------WHHDSE--AETLS-----------------WSHPGEMEPP---
A0A0N8EUV8_BMF-02      -------SRR--A--EEAAT-----------------VTNSGEMEPP---
A0A8C2VBL6_BMF-01      -------WHHDSE--ADSLS-----------------WSHPGEMEPP---
A0A8I3W4Q3_BMF-01      -------WHHDSE--AETLS-----------------WSHPGEMEPS---
A0A803JQ26_BMF-02      -----------------------------------------MEQESY---
A0A8D2HTN1_BMF-01      -------WHHDSE--AETLS-----------------WSHPEEMEPP---
A0A287CXH0_BMF-01      -------WHHDSE--AETLS-----------------WSHPGEMEPP---
A0A8C0XK68_BMF-01      -------WHHDSE--AETLP-----------------WSHPGELEPP---
A0A3Q2HR24_BMF-02      --------------CGERFE-----------------VLETRDMEPP---
G3T7Z4_BMF-01          -------WRHDPE--TDTLS-----------------WSHPGEMEPS---
A0A671DWL6_BMF-02      -------------------------------------YALTGEMEPP---
A0A8C6GZK8_BMF-01      -------WHHNSE--AETLS-----------------WSHPGEMEPP---
A0A3Q2HR24_BMF-05      -------------------------------------------MEPP---
A0A8C5R6G2_BMF-01      --------------------------------------SYRMEQESF---
A0A7N5JI49_BMF-03      ----------------------------------------VREMEPP---
A0A8C0TVZ9_BMF-03      -------------------------------------------MEPP---
A0A3Q2HR24_BMF-01      -------------------------------------------MEPP---
A0A8C0RSS3_BMF-01      -------------------------------------------MEPP---
A0A3Q2HR24_BMF-06      -------------------------------------------MEPP---
A0A7N5JI49_BMF-02      -------WHHDSE--AETLS-----------------WSHPGEMEPP---
A0A8C6R2L6_BMF-01      -------WHHDSE--AETHS-----------------WSHPGEMEPP---
A0A2K5KGP2_BMF-01      -------------------------------------------MEPS---
A0A337ST43_BMF-01      -------------------------------------------MEPP---
A0A0N8EUV8_BMF-03      -------------------------------------------HRPP---
A0A8C0TVZ9_BMF-04      -------WRTGAPGCGNAVQ-----------------DPYLGEMEPP---
A0A4W3JXA1_BMF-01      -------------------------------------------MDLS---
A0A3Q2HR24_BMF-04      -------------------------------------------MEPP---
A0A2K5VLA3_BMF-03      -------------------------------------------MEPS---
A0A673TA87_BMF-01      -------------------A-----------------TVASTRASPP---
A0A8D2HTN1_BMF-02      -------------------K-----------------ELGAEEMEPP---
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      -------------------------------------------MV-A---
A0A8C9VER0_BMF-01      -------------------------------------------MNLA---
A0A8C4C2E0_BMF-02      -------------------------------------------M------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      -------------------------------------------MQGHPLP
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      -------------------------------------------MCLS---
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      -------------------------------------------MFRI---
A0A8C7JEQ7_BMF-02      -------------------------------------------MRGTCLS
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      -------------------------------------------MDRP---
A0A8B9FZ48_BMF-01      -------------------------------------------MDRP---
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      -------------------------------------------MDRP---
A0A803SZ00_BMF-03      -------------------------------------------MDPP---
A0A2K5E1Q4_BMF-02      -------------------------------------------MEPS---
A0A2K5E1Q4_BMF-01      -------------------------------------------MEPS---
A0A663DZQ4_BMF-01      -------------------------------------------MDRP---
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      -------------------------------------------MEPP---
L8IXF5_BMF-01          -------------------------------------------MEPP---
A0A8C0EML4_BMF-01      -------------------------------------------MDRP---
A0A8C3KIN9_BMF-02      -------------------------------------------MDRP---
A0A8C0JZ72_BMF-02      -------------------------------------------MEPP---
A0A8C0PT40_BMF-01      -------------------------------------------MEPP---
A0A8C0TVZ9_BMF-05      -------------------------------------------MEPP---
A0A452F2E0_BMF-02      -------------------------------------------MEPP---
A0A8C0XK68_BMF-02      --------------------------------------IFSGELEPP---
A0A8C3WX89_BMF-01      -------------------------------------------MEPP---
A0A8C3VHE5_BMF-01      -------------------------------------------MDRP---
A0A286XXB0_BMF-01      -------------------------------------------MEPP---
A0A286XXB0_BMF-03      --------------------------------------VFPREMEPP---
A0A286XXB0_BMF-02      -------WHHDSE--ADSLS-----------------WSHPGEMEPP---
A0A2K5RN49_BMF-01      -------------------------------------------MEPS---
A0A2K5RN49_BMF-02      -------------------------------------------MEPS---
A0A2K5MJW4_BMF-01      -------------------------------------------MEPS---
A0A2K5MJW4_BMF-02      -------------------------------------------MEPS---
A0A8C0GH19_BMF-01      -------------------------------------------MDPP---
A0A8C3XI05_BMF-01      -------------------------------------------MDPP---
A0A0D9R4R5_BMF-01      -------------------------------------------MEPS---
A0A8C3P5Z9_BMF-02      -------------------------------------------MDPP---
A0A8C3LTE5_BMF-01      -------------------------------------------MDRP---
A0A8C3EY31_BMF-02      -------------------------------------------MDRP---
A0A8C3EY31_BMF-01      -------------------------------------------MDRP---
A0A8C2MZN7_BMF-02      --------------------------------------LFPGEMEPP---
A0A8C2MZN7_BMF-01      -------WHHDSE--AETLS-----------------WSHPGEMEPP---
A0A7M4FPU2_BMF-01      -------------------------------------------MDPS---
A0A8C3QVS1_BMF-01      -------------------------------------------MDRP---
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      -------------------------------------------M------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      -------------------------------------------MDHP---
A0A8C4J3Z9_BMF-01      -------------------------------------------MDHP---
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      -------------------------------------------MESP---
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      -------------------------------------------MEPP---
U3JS06_BMF-01          -------------------------------------------MDRP---
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          -------------------------------------------MDRP---
A9XRH0_BMF-01          -------------------------------------------MDRP---
A0A452H3N6_BMF-01      -------------------------------------------MDPP---
A0A2I2Z168_BMF-01      -------------------------------------------MEPS---
A0A2I2Z168_BMF-02      -------------------------------------------MEPS---
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------VFLGEMEPP---
A0A0N8EUV8_BMF-04      -------------------------------------------MEPP---
Q96LC9_BMF-03          -------------------------------------------MEPS---
Q96LC9_BMF-06          -------------------------------------------MEPS---
Q96LC9_BMF-09          -------------------------------------------MEPS---
Q96LC9_BMF-08          -------------------------------------------MEPS---
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------VFPEEMEPP---
A0A8C5K765_BMF-01      -------------------------------------------MEPP---
A0A8C5K765_BMF-02      --------------------------------------IFPGEMEPP---
A0A8C5IIR3_BMF-01      -------------------------------------------MDRP---
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      -----------------------------------------MEQESF---
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      -------------------------------------------MEPS---
A0A2K5VLA3_BMF-02      -------------------------------------------MEPS---
A0A5F7ZML1_BMF-02      -------------------------------------------MEPS---
A0A5F7ZML1_BMF-01      -------------------------------------------MEPS---
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      -------------------------------------------MDRP---
A0A8C6JG54_BMF-01      -------------------------------------------MDRP---
A0A8C5UXV9_BMF-03      -------------------------------------------MEPS---
A0A8C5UXV9_BMF-02      -------------------------------------------MEPS---
A0A5F8GKJ8_BMF-01      -------------------------------------------MEPP---
A0A8C6B0J8_BMF-01      -------------------------------------------MEPP---
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      -------------------------------------------MEPP---
Q91ZE9_BMF-06          -------------------------------------------MEPP---
Q91ZE9_BMF-01          -------WHHNSE--AETLS-----------------WSHPGEMEPP---
Q91ZE9_BMF-02          --------------------------------------MSPGEMEPP---
M3YAD5_BMF-01          -------------------------------------------MEPP---
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      -------------------------------------------MDPP---
A0A8C6VCH5_BMF-02      -------------------------------------------MDPP---
A0A8C6R2L6_BMF-02      --------------------------------------IFPGEMEPP---
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          -------------------------------------------MEPP---
A0A2I3HD83_BMF-01      -------------------------------------------MEPS---
A0A8C6Z034_BMF-01      -------------------------------------------MDRP---
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          -------------------------------------------MEPP---
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          -------------------------------------------MEPS---
W5QFV1_BMF-01          ---------------------------------------LTGEMEPP---
A0A8C8WD49_BMF-02      -------------------------------------------MTRT---
A0A8C9IYS3_BMF-02      -------------------------------------------MEPP---
A0A096NTE9_BMF-01      -------------------------------------------MEPS---
K7FRX2_BMF-01          -------------------------------------------MDPP---
A0A8C8RL12_BMF-01      -------------------------------------------MDPP---
A0A6I9LHF8_BMF-01      -------WHHDSE--AETLS-----------------WSHPGEMEPP---
A0A8C9LTX9_BMF-01      -------------------------------------------MEPS---
A0AA35JSQ3_BMF-04      -----------------VAM-----------------DLFPGEMDSP---
A0A670JUU6_BMF-05      -------------------------------------------MDSP---
A0A670JUU6_BMF-03      -------------------------------------------MDSP---
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      -------------------------------------------MEPS---
A0A8C8ZAV1_BMF-01      -------------------------------------------MEPS---
A0A2K6FFN3_BMF-02      -------------------------------------------MEPS---
A0A2K6FFN3_BMF-01      -------------------------------------------MEPS---
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------IFPGDMEPP---
A0A8I6GLK7_BMF-01      -------WHHDSE--AETLS-----------------WSHPGDMEPP---
Q8K589_BMF-01          -------------------------------------------MEPP---
A0A671DWL6_BMF-01      -------------------------------------------MEPP---
A0A2K6RAW1_BMF-02      -------------------------------------------MEPS---
A0A2K6TW78_BMF-02      -------------------------------------------MEPS---
A0A2K6TW78_BMF-03      -------------------------------------------MEPS---
A0A8D0CFD0_BMF-01      -------------------------------------------M-DP---
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      -------------------------------------------MESP---
A0A8D2AYP3_BMF-01      -------------------------------------------MEPP---
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      -------------------------------------------MDRP---
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------VFPEEMEPP---
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      -------------------------------------------MDPP---
A0A672V891_BMF-01      -------------------------------------------MDRP---
A0A287BML0_BMF-01      -------------------------------------------MEPP---
A0A287BML0_BMF-02      -------------------------------------------MEPP---
A0A8D0WCZ8_BMF-03      ----------------------------------------VREMEPP---
A0A674GIP8_BMF-02      -------------------------------------------MDRP---
A0A674GIP8_BMF-01      -------------------------------------------MDRP---
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      -------------------------------------------MDPP---
A0A452SED0_BMF-01      -------------------------------------------MEPP---
A0A4X2KLG2_BMF-01      -------------------------------------------MEPP---
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      -------------------------------------------MDRP---
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      -------------------------------------------MDRP---
A0A8C3KIN9_BMF-01      -------------------------------------------MDRP---
A0A8C4XVG9_BMF-01      -------------------------------------------MDRP---
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      -------------------------------------------MDRP---
A0A8B9BPF5_BMF-01      -------------------------------------------MDRP---
A0A8B9EVW2_BMF-01      -------------------------------------------MDRP---
A0A8C3GPS7_BMF-01      -------------------------------------------MDRP---
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      -------------------------------------------MDRP---
A0A8D0FU29_BMF-01      -------------------------------------------MDRP---
A0A8C0JZ72_BMF-01      -------------------------------------------MEPP---
A0A8C0RSS3_BMF-03      -------------------------------------------MEPP---
A0A8C0TVZ9_BMF-02      -------------------------------------------MEPP---
A0A8I3PRV2_BMF-03      -------------------------------------------MEPP---
A0A8C0TVZ9_BMF-01      -------------------------------------------MEPP---
A0A8I3PRV2_BMF-02      -------------------------------------------MEPP---
A0A8I3PRV2_BMF-01      -------------------------------------------MEPP---
A0A452F2E0_BMF-01      -------------------------------------------MEPP---
A0A2K6B5F6_BMF-03      -------------------------------------------MEPS---
A0A2K5Z4A9_BMF-02      -------------------------------------------MEPS---
A0A2K5KGP2_BMF-02      -------------------------------------------MEPS---
A0A2K6B5F6_BMF-01      -------------------------------------------MEPS---
A0A2K6B5F6_BMF-04      -------------------------------------------MEPS---
A0A2K6B5F6_BMF-02      -------------------------------------------MEPS---
A0A2K5Z4A9_BMF-01      -------------------------------------------MEPS---
A0A2K6L919_BMF-01      -------------------------------------------MEPS---
A0A2K6L919_BMF-03      -------------------------------------------MEPS---
A0A2K6RAW1_BMF-01      -------------------------------------------MEPS---
A0A8D2E2Z1_BMF-01      -------------------------------------------MEPS---
A0A8C3P5Z9_BMF-01      -------------------------------------------MDPP---
A0A669PL85_BMF-01      -------------------------------------------MDRP---
A0A8C5THT3_BMF-01      -------------------------------------------MDRP---
A0A8C2TYD3_BMF-02      -------------------------------------------MDRP---
A0A8C3N153_BMF-01      -------------------------------------------MDRP---
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      -------------------------------------------MDRP---
A0A8C4W1J6_BMF-01      -------------------------------------------MDPP---
A0A2R9BS98_BMF-01      -------------------------------------------MEPS---
A0A2J8QDD5_BMF-02      -------------------------------------------MEPS---
Q96LC9_BMF-05          -------------------------------------------MEPS---
Q96LC9_BMF-07          -------------------------------------------MEPS---
A0A2R9BS98_BMF-02      -------------------------------------------MEPS---
A0A2J8QDD5_BMF-01      -------------------------------------------MEPS---
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          -------------------------------------------MEPS---
Q96LC9_BMF-02          -------------------------------------------MEPS---
Q96LC9_BMF-04          -------------------------------------------MEPS---
A0A8C6A5T3_BMF-01      --------------------------------------VFPEEMEPP---
A0A8D2HTN1_BMF-03      --------------------------------------VFPEEMEPP---
A0A8C5IIR3_BMF-02      -------------------------------------------MDRP---
A0A8D2MHD7_BMF-01      -------------------------------------------MDRP---
A0A8D2MHD7_BMF-02      -------------------------------------------MDRP---
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      -------------------------------------------MEPS---
A0A8C5UXV9_BMF-01      -------------------------------------------MEPS---
A0A8C9BKQ1_BMF-01      -------------------------------------------MEPP---
A0A2U4BC98_BMF-01      -------------------------------------------MEPP---
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      -------------------------------------------MEPP---
A0A8C6GZK8_BMF-03      -------------------------------------------MEPP---
A0A670XMZ5_BMF-01      -------------------------------------------MDPP---
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      -------------------------------------------MEPS---
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      -------------------------------------------MEPP---
A0A8D0WCZ8_BMF-01      -------------------------------------------MEPP---
A0A384D070_BMF-01      -------------------------------------------MEPP---
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      Q-------------------------------------------------
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      G-------------------------------------------------
A0AA35JSQ3_BMF-05      D-------------------------------------------------
A0A8B9NX34_BMF-02      S-------------------------------------------------
A0A670JUU6_BMF-02      D-------------------------------------------------
A0A493T7X1_BMF-01      S-------------------------------------------------
A0A670JUU6_BMF-01      D-------------------------------------------------
A0A8C2TYD3_BMF-03      S-------------------------------------------------
A0A8B9VI07_BMF-02      S-------------------------------------------------
A0A670JUU6_BMF-04      D-------------------------------------------------
A0A8C0U4T1_BMF-01      S-------------------------------------------------
A0A8C5ST95_BMF-01      V-------------------------------------------------
A0A803SZ00_BMF-02      G-------------------------------------------------
A0A8C9F3R5_BMF-01      S-------------------------------------------------
A0A337ST43_BMF-02      Q-------------------------------------------------
A0A337ST43_BMF-04      SPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVIS
A0A8B9NX34_BMF-01      S-------------------------------------------------
A0A803JQ26_BMF-01      S-------------------------------------------------
A0A674GIP8_BMF-03      S-------------------------------------------------
A0A8B9VI07_BMF-03      S-------------------------------------------------
A0A8C4J3Z9_BMF-02      S-------------------------------------------------
A0A8C6JG54_BMF-02      S-------------------------------------------------
A0A8B9MY06_BMF-01      S-------------------------------------------------
A0A663MPI8_BMF-01      S-------------------------------------------------
A0A8C9F3R5_BMF-02      S-------------------------------------------------
A0A8C4J3Z9_BMF-04      S-------------------------------------------------
A0A8C2TYD3_BMF-04      S-------------------------------------------------
A0AA35JSQ3_BMF-01      D-------------------------------------------------
A0A8C6VCH5_BMF-01      V-------------------------------------------------
A0A6I8NF73_BMF-01      Q-------------------------------------------------
A0A8D2L6A0_BMF-01      S-------------------------------------------------
A0A669PL85_BMF-02      S-------------------------------------------------
A0A8C2TYD3_BMF-05      S-------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      S-------------------------------------------------
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      Q-------------------------------------------------
A0A3Q2HR24_BMF-03      Q-------------------------------------------------
G1PAU1_BMF-01          Q-------------------------------------------------
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      Q-------------------------------------------------
A0A8I3W4Q3_BMF-03      Q-------------------------------------------------
A0A8C0RSS3_BMF-02      Q-------------------------------------------------
A0A8C2SHH9_BMF-01      Q-------------------------------------------------
A0A8C0PT40_BMF-03      Q-------------------------------------------------
A0A2K6L919_BMF-02      R-------------------------------------------------
A0A096NTE9_BMF-02      R-------------------------------------------------
A0A337ST43_BMF-05      Q-------------------------------------------------
A0A7N5JI49_BMF-01      Q-------------------------------------------------
A0A0N8EUV8_BMF-02      Q-------------------------------------------------
A0A8C2VBL6_BMF-01      Q-------------------------------------------------
A0A8I3W4Q3_BMF-01      Q-------------------------------------------------
A0A803JQ26_BMF-02      L-------------------------------------------------
A0A8D2HTN1_BMF-01      Q-------------------------------------------------
A0A287CXH0_BMF-01      Q-------------------------------------------------
A0A8C0XK68_BMF-01      Q-------------------------------------------------
A0A3Q2HR24_BMF-02      Q-------------------------------------------------
G3T7Z4_BMF-01          Q-------------------------------------------------
A0A671DWL6_BMF-02      Q-------------------------------------------------
A0A8C6GZK8_BMF-01      Q-------------------------------------------------
A0A3Q2HR24_BMF-05      Q-------------------------------------------------
A0A8C5R6G2_BMF-01      L-------------------------------------------------
A0A7N5JI49_BMF-03      Q-------------------------------------------------
A0A8C0TVZ9_BMF-03      Q-------------------------------------------------
A0A3Q2HR24_BMF-01      Q-------------------------------------------------
A0A8C0RSS3_BMF-01      Q-------------------------------------------------
A0A3Q2HR24_BMF-06      Q-------------------------------------------------
A0A7N5JI49_BMF-02      Q-------------------------------------------------
A0A8C6R2L6_BMF-01      Q-------------------------------------------------
A0A2K5KGP2_BMF-01      R-------------------------------------------------
A0A337ST43_BMF-01      Q-------------------------------------------------
A0A0N8EUV8_BMF-03      P-------------------------------------------------
A0A8C0TVZ9_BMF-04      Q-------------------------------------------------
A0A4W3JXA1_BMF-01      D-------------------------------------------------
A0A3Q2HR24_BMF-04      Q-------------------------------------------------
A0A2K5VLA3_BMF-03      R-------------------------------------------------
A0A673TA87_BMF-01      A-------------------------------------------------
A0A8D2HTN1_BMF-02      Q-------------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      E-------------------------------------------------
A0A8C9VER0_BMF-01      E-------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      Q-------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      G-------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      H-------------------------------------------------
A0A8C7JEQ7_BMF-02      V-------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      S-------------------------------------------------
A0A8B9FZ48_BMF-01      S-------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      S-------------------------------------------------
A0A803SZ00_BMF-03      G-------------------------------------------------
A0A2K5E1Q4_BMF-02      Q-------------------------------------------------
A0A2K5E1Q4_BMF-01      Q-------------------------------------------------
A0A663DZQ4_BMF-01      S-------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      Q-------------------------------------------------
L8IXF5_BMF-01          Q-------------------------------------------------
A0A8C0EML4_BMF-01      S-------------------------------------------------
A0A8C3KIN9_BMF-02      S-------------------------------------------------
A0A8C0JZ72_BMF-02      Q-------------------------------------------------
A0A8C0PT40_BMF-01      Q-------------------------------------------------
A0A8C0TVZ9_BMF-05      Q-------------------------------------------------
A0A452F2E0_BMF-02      Q-------------------------------------------------
A0A8C0XK68_BMF-02      Q-------------------------------------------------
A0A8C3WX89_BMF-01      Q-------------------------------------------------
A0A8C3VHE5_BMF-01      S-------------------------------------------------
A0A286XXB0_BMF-01      Q-------------------------------------------------
A0A286XXB0_BMF-03      Q-------------------------------------------------
A0A286XXB0_BMF-02      Q-------------------------------------------------
A0A2K5RN49_BMF-01      Q-------------------------------------------------
A0A2K5RN49_BMF-02      Q-------------------------------------------------
A0A2K5MJW4_BMF-01      R-------------------------------------------------
A0A2K5MJW4_BMF-02      R-------------------------------------------------
A0A8C0GH19_BMF-01      S-------------------------------------------------
A0A8C3XI05_BMF-01      S-------------------------------------------------
A0A0D9R4R5_BMF-01      R-------------------------------------------------
A0A8C3P5Z9_BMF-02      S-------------------------------------------------
A0A8C3LTE5_BMF-01      S-------------------------------------------------
A0A8C3EY31_BMF-02      S-------------------------------------------------
A0A8C3EY31_BMF-01      S-------------------------------------------------
A0A8C2MZN7_BMF-02      Q-------------------------------------------------
A0A8C2MZN7_BMF-01      Q-------------------------------------------------
A0A7M4FPU2_BMF-01      S-------------------------------------------------
A0A8C3QVS1_BMF-01      S-------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      S-------------------------------------------------
A0A8C4J3Z9_BMF-01      S-------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      Q-------------------------------------------------
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      Q-------------------------------------------------
U3JS06_BMF-01          S-------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          S-------------------------------------------------
A9XRH0_BMF-01          S-------------------------------------------------
A0A452H3N6_BMF-01      N-------------------------------------------------
A0A2I2Z168_BMF-01      Q-------------------------------------------------
A0A2I2Z168_BMF-02      Q-------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      Q-------------------------------------------------
A0A0N8EUV8_BMF-04      Q-------------------------------------------------
Q96LC9_BMF-03          Q-------------------------------------------------
Q96LC9_BMF-06          Q-------------------------------------------------
Q96LC9_BMF-09          Q-------------------------------------------------
Q96LC9_BMF-08          Q-------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      Q-------------------------------------------------
A0A8C5K765_BMF-01      Q-------------------------------------------------
A0A8C5K765_BMF-02      Q-------------------------------------------------
A0A8C5IIR3_BMF-01      S-------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      L-------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      R-------------------------------------------------
A0A2K5VLA3_BMF-02      R-------------------------------------------------
A0A5F7ZML1_BMF-02      R-------------------------------------------------
A0A5F7ZML1_BMF-01      R-------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      S-------------------------------------------------
A0A8C6JG54_BMF-01      S-------------------------------------------------
A0A8C5UXV9_BMF-03      Q-------------------------------------------------
A0A8C5UXV9_BMF-02      Q-------------------------------------------------
A0A5F8GKJ8_BMF-01      H-------------------------------------------------
A0A8C6B0J8_BMF-01      Q-------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      Q-------------------------------------------------
Q91ZE9_BMF-06          Q-------------------------------------------------
Q91ZE9_BMF-01          Q-------------------------------------------------
Q91ZE9_BMF-02          Q-------------------------------------------------
M3YAD5_BMF-01          Q-------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      V-------------------------------------------------
A0A8C6VCH5_BMF-02      V-------------------------------------------------
A0A8C6R2L6_BMF-02      Q-------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          Q-------------------------------------------------
A0A2I3HD83_BMF-01      Q-------------------------------------------------
A0A8C6Z034_BMF-01      S-------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          Q-------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          Q-------------------------------------------------
W5QFV1_BMF-01          Q-------------------------------------------------
A0A8C8WD49_BMF-02      SPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRSFVIS
A0A8C9IYS3_BMF-02      Q-------------------------------------------------
A0A096NTE9_BMF-01      R-------------------------------------------------
K7FRX2_BMF-01          S-------------------------------------------------
A0A8C8RL12_BMF-01      S-------------------------------------------------
A0A6I9LHF8_BMF-01      Q-------------------------------------------------
A0A8C9LTX9_BMF-01      R-------------------------------------------------
A0AA35JSQ3_BMF-04      D-------------------------------------------------
A0A670JUU6_BMF-05      D-------------------------------------------------
A0A670JUU6_BMF-03      D-------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      Q-------------------------------------------------
A0A8C8ZAV1_BMF-01      Q-------------------------------------------------
A0A2K6FFN3_BMF-02      H-------------------------------------------------
A0A2K6FFN3_BMF-01      H-------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      Q-------------------------------------------------
A0A8I6GLK7_BMF-01      Q-------------------------------------------------
Q8K589_BMF-01          Q-------------------------------------------------
A0A671DWL6_BMF-01      Q-------------------------------------------------
A0A2K6RAW1_BMF-02      R-------------------------------------------------
A0A2K6TW78_BMF-02      Q-------------------------------------------------
A0A2K6TW78_BMF-03      Q-------------------------------------------------
A0A8D0CFD0_BMF-01      D-------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      H-------------------------------------------------
A0A8D2AYP3_BMF-01      Q-------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      S-------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      Q-------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      S-------------------------------------------------
A0A672V891_BMF-01      S-------------------------------------------------
A0A287BML0_BMF-01      Q-------------------------------------------------
A0A287BML0_BMF-02      Q-------------------------------------------------
A0A8D0WCZ8_BMF-03      Q-------------------------------------------------
A0A674GIP8_BMF-02      S-------------------------------------------------
A0A674GIP8_BMF-01      S-------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      S-------------------------------------------------
A0A452SED0_BMF-01      Q-------------------------------------------------
A0A4X2KLG2_BMF-01      H-------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      S-------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      S-------------------------------------------------
A0A8C3KIN9_BMF-01      S-------------------------------------------------
A0A8C4XVG9_BMF-01      S-------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      S-------------------------------------------------
A0A8B9BPF5_BMF-01      S-------------------------------------------------
A0A8B9EVW2_BMF-01      S-------------------------------------------------
A0A8C3GPS7_BMF-01      S-------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      S-------------------------------------------------
A0A8D0FU29_BMF-01      S-------------------------------------------------
A0A8C0JZ72_BMF-01      Q-------------------------------------------------
A0A8C0RSS3_BMF-03      Q-------------------------------------------------
A0A8C0TVZ9_BMF-02      Q-------------------------------------------------
A0A8I3PRV2_BMF-03      Q-------------------------------------------------
A0A8C0TVZ9_BMF-01      Q-------------------------------------------------
A0A8I3PRV2_BMF-02      Q-------------------------------------------------
A0A8I3PRV2_BMF-01      Q-------------------------------------------------
A0A452F2E0_BMF-01      Q-------------------------------------------------
A0A2K6B5F6_BMF-03      R-------------------------------------------------
A0A2K5Z4A9_BMF-02      R-------------------------------------------------
A0A2K5KGP2_BMF-02      R-------------------------------------------------
A0A2K6B5F6_BMF-01      R-------------------------------------------------
A0A2K6B5F6_BMF-04      R-------------------------------------------------
A0A2K6B5F6_BMF-02      R-------------------------------------------------
A0A2K5Z4A9_BMF-01      R-------------------------------------------------
A0A2K6L919_BMF-01      R-------------------------------------------------
A0A2K6L919_BMF-03      R-------------------------------------------------
A0A2K6RAW1_BMF-01      R-------------------------------------------------
A0A8D2E2Z1_BMF-01      R-------------------------------------------------
A0A8C3P5Z9_BMF-01      S-------------------------------------------------
A0A669PL85_BMF-01      S-------------------------------------------------
A0A8C5THT3_BMF-01      S-------------------------------------------------
A0A8C2TYD3_BMF-02      S-------------------------------------------------
A0A8C3N153_BMF-01      S-------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      S-------------------------------------------------
A0A8C4W1J6_BMF-01      N-------------------------------------------------
A0A2R9BS98_BMF-01      Q-------------------------------------------------
A0A2J8QDD5_BMF-02      Q-------------------------------------------------
Q96LC9_BMF-05          Q-------------------------------------------------
Q96LC9_BMF-07          Q-------------------------------------------------
A0A2R9BS98_BMF-02      Q-------------------------------------------------
A0A2J8QDD5_BMF-01      Q-------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          Q-------------------------------------------------
Q96LC9_BMF-02          Q-------------------------------------------------
Q96LC9_BMF-04          Q-------------------------------------------------
A0A8C6A5T3_BMF-01      Q-------------------------------------------------
A0A8D2HTN1_BMF-03      Q-------------------------------------------------
A0A8C5IIR3_BMF-02      S-------------------------------------------------
A0A8D2MHD7_BMF-01      S-------------------------------------------------
A0A8D2MHD7_BMF-02      S-------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      R-------------------------------------------------
A0A8C5UXV9_BMF-01      Q-------------------------------------------------
A0A8C9BKQ1_BMF-01      Q-------------------------------------------------
A0A2U4BC98_BMF-01      Q-------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      Q-------------------------------------------------
A0A8C6GZK8_BMF-03      Q-------------------------------------------------
A0A670XMZ5_BMF-01      V-------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      Q-------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      Q-------------------------------------------------
A0A8D0WCZ8_BMF-01      Q-------------------------------------------------
A0A384D070_BMF-01      Q-------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      ------------------------------------------------C-
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      ------------------------------------------------YL
A0AA35JSQ3_BMF-05      ------------------------------------------------YL
A0A8B9NX34_BMF-02      ------------------------------------------------YL
A0A670JUU6_BMF-02      ------------------------------------------------YL
A0A493T7X1_BMF-01      ------------------------------------------------YL
A0A670JUU6_BMF-01      ------------------------------------------------YL
A0A8C2TYD3_BMF-03      ------------------------------------------------YL
A0A8B9VI07_BMF-02      ------------------------------------------------YL
A0A670JUU6_BMF-04      ------------------------------------------------YL
A0A8C0U4T1_BMF-01      ------------------------------------------------YL
A0A8C5ST95_BMF-01      ------------------------------------------------FL
A0A803SZ00_BMF-02      ------------------------------------------------YL
A0A8C9F3R5_BMF-01      ------------------------------------------------YL
A0A337ST43_BMF-02      ------------------------------------------------CV
A0A337ST43_BMF-04      VGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLH----CTPA------GE
A0A8B9NX34_BMF-01      ------------------------------------------------YL
A0A803JQ26_BMF-01      ------------------------------------------------YL
A0A674GIP8_BMF-03      ------------------------------------------------YL
A0A8B9VI07_BMF-03      ------------------------------------------------YL
A0A8C4J3Z9_BMF-02      ------------------------------------------------YL
A0A8C6JG54_BMF-02      ------------------------------------------------YL
A0A8B9MY06_BMF-01      ------------------------------------------------YL
A0A663MPI8_BMF-01      ------------------------------------------------YL
A0A8C9F3R5_BMF-02      ------------------------------------------------YL
A0A8C4J3Z9_BMF-04      ------------------------------------------------YL
A0A8C2TYD3_BMF-04      ------------------------------------------------YL
A0AA35JSQ3_BMF-01      ------------------------------------------------YL
A0A8C6VCH5_BMF-01      ------------------------------------------------YL
A0A6I8NF73_BMF-01      ------------------------------------------------YE
A0A8D2L6A0_BMF-01      ------------------------------------------------YL
A0A669PL85_BMF-02      ------------------------------------------------YL
A0A8C2TYD3_BMF-05      ------------------------------------------------YL
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      ------------------------------------------------YL
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      ------------------------------------------------C-
A0A3Q2HR24_BMF-03      ------------------------------------------------C-
G1PAU1_BMF-01          ------------------------------------------------C-
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      ------------------------------------------------C-
A0A8I3W4Q3_BMF-03      ------------------------------------------------C-
A0A8C0RSS3_BMF-02      ------------------------------------------------C-
A0A8C2SHH9_BMF-01      ------------------------------------------------C-
A0A8C0PT40_BMF-03      ------------------------------------------------C-
A0A2K6L919_BMF-02      ------------------------------------------------C-
A0A096NTE9_BMF-02      ------------------------------------------------C-
A0A337ST43_BMF-05      ------------------------------------------------C-
A0A7N5JI49_BMF-01      ------------------------------------------------C-
A0A0N8EUV8_BMF-02      ------------------------------------------------C-
A0A8C2VBL6_BMF-01      ------------------------------------------------C-
A0A8I3W4Q3_BMF-01      ------------------------------------------------C-
A0A803JQ26_BMF-02      ------------------------------------------------N-
A0A8D2HTN1_BMF-01      ------------------------------------------------C-
A0A287CXH0_BMF-01      ------------------------------------------------C-
A0A8C0XK68_BMF-01      ------------------------------------------------C-
A0A3Q2HR24_BMF-02      ------------------------------------------------C-
G3T7Z4_BMF-01          ------------------------------------------------C-
A0A671DWL6_BMF-02      ------------------------------------------------C-
A0A8C6GZK8_BMF-01      ------------------------------------------------C-
A0A3Q2HR24_BMF-05      ------------------------------------------------C-
A0A8C5R6G2_BMF-01      ------------------------------------------------S-
A0A7N5JI49_BMF-03      ------------------------------------------------C-
A0A8C0TVZ9_BMF-03      ------------------------------------------------C-
A0A3Q2HR24_BMF-01      ------------------------------------------------C-
A0A8C0RSS3_BMF-01      ------------------------------------------------C-
A0A3Q2HR24_BMF-06      ------------------------------------------------C-
A0A7N5JI49_BMF-02      ------------------------------------------------C-
A0A8C6R2L6_BMF-01      ------------------------------------------------C-
A0A2K5KGP2_BMF-01      ------------------------------------------------C-
A0A337ST43_BMF-01      ------------------------------------------------C-
A0A0N8EUV8_BMF-03      ------------------------------------------------A-
A0A8C0TVZ9_BMF-04      ------------------------------------------------C-
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      ------------------------------------------------C-
A0A2K5VLA3_BMF-03      ------------------------------------------------C-
A0A673TA87_BMF-01      ------------------------------------------------A-
A0A8D2HTN1_BMF-02      ------------------------------------------------C-
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      -----------------------------VEVTLNIDPFVLFDRLPLRSR
A0A8C9VER0_BMF-01      -----------------------------AH--RGRSSLCRQTSETCRLT
A0A8C4C2E0_BMF-02      ------------------------------------------EGVFMRQP
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      -------------------------------LSK--------------QD
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      -------------------------------ISGH-------------SS
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      -------------------------------IDL--------------KV
A0A8C7JEQ7_BMF-02      ---------------------SLSNRLTHTSVSHHFSCLSPV------GR
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      ------------------------------------------------YL
A0A8B9FZ48_BMF-01      ------------------------------------------------YL
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      ------------------------------------------------YL
A0A803SZ00_BMF-03      ------------------------------------------------YL
A0A2K5E1Q4_BMF-02      ------------------------------------------------C-
A0A2K5E1Q4_BMF-01      ------------------------------------------------C-
A0A663DZQ4_BMF-01      ------------------------------------------------YL
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      ------------------------------------------------CV
L8IXF5_BMF-01          ------------------------------------------------C-
A0A8C0EML4_BMF-01      ------------------------------------------------YL
A0A8C3KIN9_BMF-02      ------------------------------------------------YL
A0A8C0JZ72_BMF-02      ------------------------------------------------C-
A0A8C0PT40_BMF-01      ------------------------------------------------C-
A0A8C0TVZ9_BMF-05      ------------------------------------------------C-
A0A452F2E0_BMF-02      ------------------------------------------------C-
A0A8C0XK68_BMF-02      ------------------------------------------------C-
A0A8C3WX89_BMF-01      ------------------------------------------------C-
A0A8C3VHE5_BMF-01      ------------------------------------------------YL
A0A286XXB0_BMF-01      ------------------------------------------------C-
A0A286XXB0_BMF-03      ------------------------------------------------C-
A0A286XXB0_BMF-02      ------------------------------------------------C-
A0A2K5RN49_BMF-01      ------------------------------------------------C-
A0A2K5RN49_BMF-02      ------------------------------------------------C-
A0A2K5MJW4_BMF-01      ------------------------------------------------C-
A0A2K5MJW4_BMF-02      ------------------------------------------------C-
A0A8C0GH19_BMF-01      ------------------------------------------------YL
A0A8C3XI05_BMF-01      ------------------------------------------------YL
A0A0D9R4R5_BMF-01      ------------------------------------------------C-
A0A8C3P5Z9_BMF-02      ------------------------------------------------YL
A0A8C3LTE5_BMF-01      ------------------------------------------------YL
A0A8C3EY31_BMF-02      ------------------------------------------------YL
A0A8C3EY31_BMF-01      ------------------------------------------------YL
A0A8C2MZN7_BMF-02      ------------------------------------------------C-
A0A8C2MZN7_BMF-01      ------------------------------------------------C-
A0A7M4FPU2_BMF-01      ------------------------------------------------YL
A0A8C3QVS1_BMF-01      ------------------------------------------------YL
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      ------------------------------------------------YL
A0A8C4J3Z9_BMF-01      ------------------------------------------------YL
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      ------------------------------------------------C-
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      ------------------------------------------------C-
U3JS06_BMF-01          ------------------------------------------------YL
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          ------------------------------------------------YL
A9XRH0_BMF-01          ------------------------------------------------YL
A0A452H3N6_BMF-01      ------------------------------------------------YL
A0A2I2Z168_BMF-01      ------------------------------------------------C-
A0A2I2Z168_BMF-02      ------------------------------------------------C-
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      ------------------------------------------------C-
A0A0N8EUV8_BMF-04      ------------------------------------------------C-
Q96LC9_BMF-03          ------------------------------------------------C-
Q96LC9_BMF-06          ------------------------------------------------C-
Q96LC9_BMF-09          ------------------------------------------------C-
Q96LC9_BMF-08          ------------------------------------------------C-
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      ------------------------------------------------C-
A0A8C5K765_BMF-01      ------------------------------------------------C-
A0A8C5K765_BMF-02      ------------------------------------------------C-
A0A8C5IIR3_BMF-01      ------------------------------------------------YL
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      ------------------------------------------------S-
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      ------------------------------------------------C-
A0A2K5VLA3_BMF-02      ------------------------------------------------C-
A0A5F7ZML1_BMF-02      ------------------------------------------------C-
A0A5F7ZML1_BMF-01      ------------------------------------------------C-
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      ------------------------------------------------YL
A0A8C6JG54_BMF-01      ------------------------------------------------YL
A0A8C5UXV9_BMF-03      ------------------------------------------------C-
A0A8C5UXV9_BMF-02      ------------------------------------------------C-
A0A5F8GKJ8_BMF-01      ------------------------------------------------Y-
A0A8C6B0J8_BMF-01      ------------------------------------------------C-
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      ------------------------------------------------C-
Q91ZE9_BMF-06          ------------------------------------------------C-
Q91ZE9_BMF-01          ------------------------------------------------C-
Q91ZE9_BMF-02          ------------------------------------------------C-
M3YAD5_BMF-01          ------------------------------------------------C-
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      ------------------------------------------------YL
A0A8C6VCH5_BMF-02      ------------------------------------------------YL
A0A8C6R2L6_BMF-02      ------------------------------------------------C-
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          ------------------------------------------------C-
A0A2I3HD83_BMF-01      ------------------------------------------------C-
A0A8C6Z034_BMF-01      ------------------------------------------------YM
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          ------------------------------------------------C-
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          ------------------------------------------------C-
W5QFV1_BMF-01          ------------------------------------------------C-
A0A8C8WD49_BMF-02      IGPHFPQVEGKGERKGGVLQVRPWGRGQHPRCLH----CTPA------GE
A0A8C9IYS3_BMF-02      ------------------------------------------------CV
A0A096NTE9_BMF-01      ------------------------------------------------C-
K7FRX2_BMF-01          ------------------------------------------------YL
A0A8C8RL12_BMF-01      ------------------------------------------------YL
A0A6I9LHF8_BMF-01      ------------------------------------------------C-
A0A8C9LTX9_BMF-01      ------------------------------------------------C-
A0AA35JSQ3_BMF-04      ------------------------------------------------YL
A0A670JUU6_BMF-05      ------------------------------------------------YL
A0A670JUU6_BMF-03      ------------------------------------------------YL
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      ------------------------------------------------C-
A0A8C8ZAV1_BMF-01      ------------------------------------------------C-
A0A2K6FFN3_BMF-02      ------------------------------------------------C-
A0A2K6FFN3_BMF-01      ------------------------------------------------C-
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      ------------------------------------------------C-
A0A8I6GLK7_BMF-01      ------------------------------------------------C-
Q8K589_BMF-01          ------------------------------------------------C-
A0A671DWL6_BMF-01      ------------------------------------------------C-
A0A2K6RAW1_BMF-02      ------------------------------------------------C-
A0A2K6TW78_BMF-02      ------------------------------------------------C-
A0A2K6TW78_BMF-03      ------------------------------------------------C-
A0A8D0CFD0_BMF-01      ------------------------------------------------YP
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      ------------------------------------------------Y-
A0A8D2AYP3_BMF-01      ------------------------------------------------C-
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      ------------------------------------------------YL
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      ------------------------------------------------C-
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      ------------------------------------------------YL
A0A672V891_BMF-01      ------------------------------------------------YL
A0A287BML0_BMF-01      ------------------------------------------------C-
A0A287BML0_BMF-02      ------------------------------------------------C-
A0A8D0WCZ8_BMF-03      ------------------------------------------------C-
A0A674GIP8_BMF-02      ------------------------------------------------YL
A0A674GIP8_BMF-01      ------------------------------------------------YL
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      ------------------------------------------------YL
A0A452SED0_BMF-01      ------------------------------------------------C-
A0A4X2KLG2_BMF-01      ------------------------------------------------Y-
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      ------------------------------------------------YL
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      ------------------------------------------------YL
A0A8C3KIN9_BMF-01      ------------------------------------------------YL
A0A8C4XVG9_BMF-01      ------------------------------------------------YL
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      ------------------------------------------------YL
A0A8B9BPF5_BMF-01      ------------------------------------------------YL
A0A8B9EVW2_BMF-01      ------------------------------------------------YL
A0A8C3GPS7_BMF-01      ------------------------------------------------YL
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      ------------------------------------------------YL
A0A8D0FU29_BMF-01      ------------------------------------------------YL
A0A8C0JZ72_BMF-01      ------------------------------------------------C-
A0A8C0RSS3_BMF-03      ------------------------------------------------C-
A0A8C0TVZ9_BMF-02      ------------------------------------------------C-
A0A8I3PRV2_BMF-03      ------------------------------------------------C-
A0A8C0TVZ9_BMF-01      ------------------------------------------------C-
A0A8I3PRV2_BMF-02      ------------------------------------------------C-
A0A8I3PRV2_BMF-01      ------------------------------------------------C-
A0A452F2E0_BMF-01      ------------------------------------------------C-
A0A2K6B5F6_BMF-03      ------------------------------------------------C-
A0A2K5Z4A9_BMF-02      ------------------------------------------------C-
A0A2K5KGP2_BMF-02      ------------------------------------------------C-
A0A2K6B5F6_BMF-01      ------------------------------------------------C-
A0A2K6B5F6_BMF-04      ------------------------------------------------C-
A0A2K6B5F6_BMF-02      ------------------------------------------------C-
A0A2K5Z4A9_BMF-01      ------------------------------------------------C-
A0A2K6L919_BMF-01      ------------------------------------------------C-
A0A2K6L919_BMF-03      ------------------------------------------------C-
A0A2K6RAW1_BMF-01      ------------------------------------------------C-
A0A8D2E2Z1_BMF-01      ------------------------------------------------C-
A0A8C3P5Z9_BMF-01      ------------------------------------------------YL
A0A669PL85_BMF-01      ------------------------------------------------YL
A0A8C5THT3_BMF-01      ------------------------------------------------YL
A0A8C2TYD3_BMF-02      ------------------------------------------------YL
A0A8C3N153_BMF-01      ------------------------------------------------YL
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      ------------------------------------------------YL
A0A8C4W1J6_BMF-01      ------------------------------------------------YL
A0A2R9BS98_BMF-01      ------------------------------------------------C-
A0A2J8QDD5_BMF-02      ------------------------------------------------C-
Q96LC9_BMF-05          ------------------------------------------------C-
Q96LC9_BMF-07          ------------------------------------------------C-
A0A2R9BS98_BMF-02      ------------------------------------------------C-
A0A2J8QDD5_BMF-01      ------------------------------------------------C-
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          ------------------------------------------------C-
Q96LC9_BMF-02          ------------------------------------------------C-
Q96LC9_BMF-04          ------------------------------------------------C-
A0A8C6A5T3_BMF-01      ------------------------------------------------C-
A0A8D2HTN1_BMF-03      ------------------------------------------------C-
A0A8C5IIR3_BMF-02      ------------------------------------------------YL
A0A8D2MHD7_BMF-01      ------------------------------------------------YL
A0A8D2MHD7_BMF-02      ------------------------------------------------YL
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      ------------------------------------------------C-
A0A8C5UXV9_BMF-01      ------------------------------------------------C-
A0A8C9BKQ1_BMF-01      ------------------------------------------------C-
A0A2U4BC98_BMF-01      ------------------------------------------------C-
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      ------------------------------------------------C-
A0A8C6GZK8_BMF-03      ------------------------------------------------C-
A0A670XMZ5_BMF-01      ------------------------------------------------YL
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      ------------------------------------------------C-
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      ------------------------------------------------C-
A0A8D0WCZ8_BMF-01      ------------------------------------------------C-
A0A384D070_BMF-01      ------------------------------------------------C-
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A673JJ10_BMF-01      --------MDDE-------EDEQ---------------------------
A0A803SZ00_BMF-01      D--DDFSTLDGL-------EDDVF--HAED------------C-------
A0AA35JSQ3_BMF-05      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A8B9NX34_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A670JUU6_BMF-02      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A493T7X1_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A670JUU6_BMF-01      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A8C2TYD3_BMF-03      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8B9VI07_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A670JUU6_BMF-04      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A8C0U4T1_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C5ST95_BMF-01      E--DDFSHLDGL-------DDDVF--HSDD------------C-------
A0A803SZ00_BMF-02      D--DDFSTLDGL-------EDDVF--HAED------------C-------
A0A8C9F3R5_BMF-01      E--EDYSGLDGL-------DDDVF--HSDD------------F-------
A0A337ST43_BMF-02      E---------EL-------EDDVF--QPED------------V-------
A0A337ST43_BMF-04      M--EPPQCVEEL-------EDDVF--QPED------------V-------
A0A8B9NX34_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A803JQ26_BMF-01      -------NMDEL-------DDDVF--YPDE------------F-------
A0A674GIP8_BMF-03      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8B9VI07_BMF-03      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C4J3Z9_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C6JG54_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8B9MY06_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A663MPI8_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C9F3R5_BMF-02      E--EDYSGLDGL-------DDDVF--HSDD------------F-------
A0A8C4J3Z9_BMF-04      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C2TYD3_BMF-04      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0AA35JSQ3_BMF-01      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A8C6VCH5_BMF-01      E--DDFSHLDGL-------DDDVF--HSDD------------C-------
A0A6I8NF73_BMF-01      EELEELTGLEEL-------EDDVF--HPET------------P-------
A0A8D2L6A0_BMF-01      E--DDFSNLDGL-------DDDVF--HSED------------C-------
A0A669PL85_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C2TYD3_BMF-05      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A3KND0_BMF-01          --------MDEL-------DDDVF--YPDA------------F-------
A0A8C2TYD3_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C1UAR1_BMF-01      ---------DED-------EDDVH--RK----------------------
A0A8I3W4Q3_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q2HR24_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
G1PAU1_BMF-01          --------VEEL-------EDDVF--QPED--------------------
A0A8C2DDJ7_BMF-01      --------MDED-------EDDVH--R-----------------------
A0A8C0PT40_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8I3W4Q3_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0RSS3_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C2SHH9_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0PT40_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6L919_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A096NTE9_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A337ST43_BMF-05      --------VEEL-------EDDVF--QPED------------V-------
A0A7N5JI49_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A0N8EUV8_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C2VBL6_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8I3W4Q3_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A803JQ26_BMF-02      --------MDEL-------DDDVF--YPDE--------------------
A0A8D2HTN1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A287CXH0_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0XK68_BMF-01      --------VEEL-------EDDVF--QAED------------G-------
A0A3Q2HR24_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
G3T7Z4_BMF-01          --------VEEL-------EDDVF--QPEE------------G-------
A0A671DWL6_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C6GZK8_BMF-01      --------VEEL-------EDDVF--QSED------------G-------
A0A3Q2HR24_BMF-05      --------VEEL-------EDDVF--QPED------------G-------
A0A8C5R6G2_BMF-01      --------SDEL-------DDDVF--YPDD------------F-------
A0A7N5JI49_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0TVZ9_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q2HR24_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0RSS3_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q2HR24_BMF-06      --------VEEL-------EDDVF--QPED------------G-------
A0A7N5JI49_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C6R2L6_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5KGP2_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A337ST43_BMF-01      --------VEEL-------EDDVF--QPED------------V-------
A0A0N8EUV8_BMF-03      --------AARW-------AFPSF--I-DS------------G-------
A0A8C0TVZ9_BMF-04      --------VEEL-------EDDVF--QPED------------G-------
A0A4W3JXA1_BMF-01      --------TEELDSDDEVFAQDLT--APDS------------G-------
A0A3Q2HR24_BMF-04      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5VLA3_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A673TA87_BMF-01      --------AAAP-------ASASR--HPPQPAGLFPSFPIESGRQAPECS
A0A8D2HTN1_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A668TQU8_BMF-01      --------MDDE-------EDDVF--EPK---------------------
A0A8B9LSW6_BMF-01      --------MDDE-------EDDVF--VTD---------------------
A0A671M0H4_BMF-02      --------MDED-------EDDVR--RKG---------------------
A0A3Q2CXC4_BMF-02      --------MEEE-------EDDVF--EPD---------------------
A0A672JWL9_BMF-02      --------MDED-------EDDVR--RKG---------------------
A0A3P8NFE2_BMF-02      --------MDDE-------EDDVF--EPK---------------------
A0A673HDR4_BMF-01      --------MDED-------EDDVR--RKG---------------------
A0A8C7G467_BMF-02      --------MDDE-------EDDVF--EPD---------------------
W5N4P7_BMF-01          --------MEED-------EDDVF--HPSH--------------------
A0A8C4SHZ6_BMF-02      I--RMDP-EEDI-------EDDVF--HPPE------------L-------
A0A8C9VER0_BMF-01      I--SEGPLMEDE-------EDDVF--RPN---------------------
A0A8C4C2E0_BMF-02      V--YVDPLMEDE-------DEDVF--SGH---------------------
A0A3B3RH63_BMF-01      --------MDDD-------DDDVF--HTD---------------------
W5UAU7_BMF-01          --------MDED-------EDEVF--GPI---------------------
Q0GKC7_BMF-01          --------MDED-------EDDVF--RKG---------------------
A0A8C7XJP0_BMF-02      --------MDDE-------EDDVF--ELD---------------------
A0A3Q2PJX9_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A9J7Y9L1_BMF-01      --------MDED-------EDDVH--RKG---------------------
A0A3Q2YCX7_BMF-02      --------MEDE-------EDDVF--EPD---------------------
A0A673YQV3_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A9J7Y9L1_BMF-03      --------MDED-------EDDVH--RKG---------------------
A0A3P8UA78_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A3Q2CXC4_BMF-01      --------MEEE-------EDDVF--EPD---------------------
A0A4W4DZH9_BMF-01      --------MDDE-------EDDVF--RIA---------------------
A0A6F9BGV6_BMF-01      L--ADFCRMDDE-------EDDVF--VPD---------------------
A0A3P9K487_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A2U9CJH3_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C2DDJ7_BMF-02      --------MDED-------EDDVH--RKG---------------------
A0A8C7XJP0_BMF-01      --------MDDE-------EDDVF--ELD---------------------
A0A9J7Y9L1_BMF-02      --------MDED-------EDDVH--RKG---------------------
A0A3P9ICE1_BMF-01      Y--SAPPRMDDE-------EDDVF--EPD---------------------
A0A3Q3RVI2_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C4C2E0_BMF-01      --------MEDE-------DEDVF--SGH---------------------
A0A3Q3VLX6_BMF-01      --------MDDD-------EDDVF--EPE---------------------
A0A3B5B8F6_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C6U3U8_BMF-01      --------MEDE-------EDDVF--EPE---------------------
A0A8C1XUF5_BMF-01      --------MN------------IS--TVX---------------------
A0A8C6PNJ4_BMF-01      --------MDDE-------EDDVF--EPV---------------------
A0A8K9UY13_BMF-01      --------MDDE-------EDDVF--VPD---------------------
A0A674EF64_BMF-01      --------MDDE-------EDDVF--VPD---------------------
A0A3B4B6Y3_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A8C4DD37_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A672HG10_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A6F9B4C5_BMF-01      L--ADRRRMDDE-------EDDVF--EPD---------------------
A0A8C7JEQ7_BMF-02      L--PLRLPMDDE-------EEDMSLQRPV---------------------
A0A3B4UNJ0_BMF-01      --------MDDE-------EEDMS--QPI---------------------
A0A672RK14_BMF-01      --------MDDE-------EDEQ-----L---------------------
A0A3Q1FVH7_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A8B9MY06_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8B9FZ48_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3Q1D1K3_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A3Q1IPR4_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A493T7X1_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A803SZ00_BMF-03      D--DDFSTLDGL-------EDDVF--HAED------------C-------
A0A2K5E1Q4_BMF-02      --------VEEL-------EDDVF--QSED------------G-------
A0A2K5E1Q4_BMF-01      --------VEEL-------EDDVF--QSED------------G-------
A0A663DZQ4_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3P8NFE2_BMF-01      --------MDDE-------EDDVF--EPK---------------------
A0A3B1K1X5_BMF-01      --------MDDE-------EDDVF--VTD---------------------
A0A8C0CL26_BMF-01      E---------EL-------EDDVF--QPED------------G-------
L8IXF5_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
A0A8C0EML4_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3KIN9_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C0JZ72_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0PT40_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0TVZ9_BMF-05      --------VEEL-------EDDVF--QPED------------G-------
A0A452F2E0_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0XK68_BMF-02      --------VEEL-------EDDVF--QAED------------G-------
A0A8C3WX89_BMF-01      --------VEEL-------EDDVF--QPEE------------G-------
A0A8C3VHE5_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A286XXB0_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A286XXB0_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A286XXB0_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5RN49_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5RN49_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5MJW4_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5MJW4_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0GH19_BMF-01      E--DDYSSLDGL-------DDDVF--HS-D------------F-------
A0A8C3XI05_BMF-01      E--EDYSSLDGL-------DDDVF--HS-D------------F-------
A0A0D9R4R5_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C3P5Z9_BMF-02      E--EDYSSLDGL-------DDDVF--HS-D------------F-------
A0A8C3LTE5_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3EY31_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3EY31_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C2MZN7_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C2MZN7_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A7M4FPU2_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3QVS1_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A9J7Z5T7_BMF-01      --------MDED-------EDDVH--RKG---------------------
A0A9J7Z5T7_BMF-02      --------MDED-------EDDVH--R-----------------------
A0A9J7Z5T7_BMF-03      ---------DED-------EDDVH--RK----------------------
A0A8C1P2N8_BMF-02      --------MDED-------EDDVH--RKG---------------------
A0A8C1UAR1_BMF-02      --------MDED-------EDDVH--RKG---------------------
A0A8C4DD37_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C4J3Z9_BMF-03      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C4J3Z9_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A665VG08_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C4MCB2_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C4SHZ6_BMF-01      ----MDP-EEDI-------EDDVF--HPPE------------L-------
A0A3P8ZIE7_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A337ST43_BMF-03      --------VEEL-------EDDVF--QPED------------V-------
U3JS06_BMF-01          E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3Q2PJX9_BMF-03      --------MEDE-------EDDVF--EPD---------------------
A9XRG9_BMF-01          E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A9XRH0_BMF-01          E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A452H3N6_BMF-01      E--DDYSSLDGL-------DDDVF--HS-D------------F-------
A0A2I2Z168_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2I2Z168_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C5HAH2_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A0N8EUV8_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A0N8EUV8_BMF-04      --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-03          --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-06          --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-09          --------VEEL-------EDD----------------------------
Q96LC9_BMF-08          --------VEEL-------EDDVF--QPED------------G-------
A0A4W5N3A7_BMF-01      --------MDDE-------EDDVF--VPD---------------------
A0A4W5N721_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A287CXH0_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8C5K765_BMF-01      --------VEEL-------EDDVF--QPED------------E-------
A0A8C5K765_BMF-02      --------VEEL-------EDDVF--QPED------------E-------
A0A8C5IIR3_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3Q2ZA20_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A3Q3GUU5_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A4W6DUL1_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C5R6G2_BMF-02      --------SDEL-------DDDVF--YPDD------------F-------
A0A667H967_BMF-01      M--EPPQCVEEL-------EDDVF--QPED------------G-------
A0A2K5VLA3_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5VLA3_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A5F7ZML1_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A5F7ZML1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q3RVI2_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A803YBD7_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C6JG54_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C5UXV9_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C5UXV9_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A5F8GKJ8_BMF-01      --------VEEL-------EDDVF--HPED------------S-------
A0A8C6B0J8_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q3QZ16_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A8C6CWP8_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
Q91ZE9_BMF-06          --------VEEL-------EDDVF--QSED------------G-------
Q91ZE9_BMF-01          --------VEEL-------EDDVF--QSED------------G-------
Q91ZE9_BMF-02          --------VEEL-------EDDVF--QSED------------G-------
M3YAD5_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
A0A667YNR9_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C6VCH5_BMF-03      E--DDFSHLDGL-------DDDVF--HSDD------------C-------
A0A8C6VCH5_BMF-02      E--DDFSHLDGL-------DDDVF--HSDD------------C-------
A0A8C6R2L6_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q4G1I4_BMF-01      --------MDDE-------EDDVF--EPK---------------------
U6CSY8_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
A0A2I3HD83_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C6Z034_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C7FH91_BMF-01      --------MDDE-------EDDVF--VPD---------------------
A0A8C7G467_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C7JEQ7_BMF-01      --------MDDE-------EEDMSLQRPV---------------------
A0A8C7RCY3_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C7SCN2_BMF-01      --------MDDE-------EEDMSLQRPV---------------------
A0A8K9UY13_BMF-02      --------MDDE-------EDDVF--VPD---------------------
A0A8C8CQZ6_BMF-01      --------MDDE-------EDDVF--VPD---------------------
A0A8C8F9Y2_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A8C8F9Y2_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C8FNK5_BMF-01      --------MDDE-------EEDMSLQRPV---------------------
I3K2D6_BMF-01          --------MDDE-------EDDVF--EPK---------------------
G1SR62_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
A0A3B3HAU1_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A3B3HAU1_BMF-04      --------MDDE-------EDDVF--EPD---------------------
A0A3P9ICE1_BMF-04      --------MDDE-------EDDVF--EPD---------------------
A0A3P9K487_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A3B3CGR9_BMF-01      --------MDDE-------EDDVF--EPD---------------------
H0WYH6_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
W5QFV1_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
A0A8C8WD49_BMF-02      M--EPPQCVEEL-------EDDVF--QPED------------G-------
A0A8C9IYS3_BMF-02      E---------EL-------EDDVF--QPED------------G-------
A0A096NTE9_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
K7FRX2_BMF-01          E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C8RL12_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A6I9LHF8_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C9LTX9_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0AA35JSQ3_BMF-04      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A670JUU6_BMF-05      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A670JUU6_BMF-03      E--EDFSNLDGL-------EDDVF--HSED------------C-------
A0A096LRV0_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A3P9Q8E2_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A6D2XBX1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C8ZAV1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6FFN3_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6FFN3_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3B4CNJ8_BMF-01      --------MDED-------EDDVF--VMD---------------------
A0A8I6GLK7_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8I6GLK7_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
Q8K589_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
A0A671DWL6_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6RAW1_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6TW78_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6TW78_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8D0CFD0_BMF-01      E--DDFSNVDGL-------DDDVF--HSED------------C-------
A0A8C9XRX5_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A7N4PJP2_BMF-01      --------VEEL-------EDDVF--HPED------------S-------
A0A8D2AYP3_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8D3CAL2_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C9NB87_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3B4U5H8_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A3B4WM88_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A671MNR9_BMF-01      --------MDED-------EDDVR--RKG---------------------
A0A672JWL9_BMF-01      --------MDED-------EDDVR--RKG---------------------
A0A671X848_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C9UST6_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A673C8N3_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A8D0LCG8_BMF-01      E--DDYSSLDGL-------DDDVF--HPDD------------F-------
A0A672V891_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A287BML0_BMF-01      --------VEEL-------EDDVF--QPEE------------G-------
A0A287BML0_BMF-02      --------VEEL-------EDDVF--QPEE------------G-------
A0A8D0WCZ8_BMF-03      --------VEEL-------EDDVF--QPEE------------G-------
A0A674GIP8_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A674GIP8_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3B5KWG6_BMF-02      --------MDDE-------EDDVF--QPD---------------------
A0A3B5KWG6_BMF-01      --------MDDE-------EDDVF--QPD---------------------
A0A3B5KWG6_BMF-03      --------MDDE-------EDDVF--QPD---------------------
A0A674IPL3_BMF-01      E--EDYSSLDGL-------DDDVF--HS-D------------F-------
A0A452SED0_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A4X2KLG2_BMF-01      --------VEEL-------EDDVF--HPED------------S-------
A0A3B5QK08_BMF-02      --------MEDE-------EDDVF--EPD---------------------
A0A8D2PG36_BMF-01      E--DDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3Q1FVH7_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C0AW70_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3KIN9_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C4XVG9_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3P8RKY9_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8B9VI07_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8B9BPF5_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8B9EVW2_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3GPS7_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3Q3C5V2_BMF-01      --------MDDE-------EDDVF--EPK---------------------
A0A3P9DPJ5_BMF-01      --------MDDE-------EDDVF--EPK---------------------
A0A3P9DPJ5_BMF-02      --------MDDE-------EDDVF--EPK---------------------
A0A3B4ETH0_BMF-01      --------MDDE-------EDDVF--EPK---------------------
A0A8B9LSW6_BMF-02      --------MDDE-------EDDVF--VTD---------------------
A0A8C8B299_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8D0FU29_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C0JZ72_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0RSS3_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0TVZ9_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8I3PRV2_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C0TVZ9_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8I3PRV2_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A8I3PRV2_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A452F2E0_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6B5F6_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5Z4A9_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5KGP2_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6B5F6_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6B5F6_BMF-04      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6B5F6_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2K5Z4A9_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6L919_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6L919_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A2K6RAW1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8D2E2Z1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C3P5Z9_BMF-01      E--EDYSSLDGL-------DDDVF--HS-D------------F-------
A0A669PL85_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C5THT3_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C2TYD3_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C3N153_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A3P8UA78_BMF-03      --------MDDE-------EDDVF--EPD---------------------
A0A3P8UA78_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A8C1P2N8_BMF-03      --------MDED-------EDDVH--RKG---------------------
A0A8C1P2N8_BMF-01      --------MDED-------EDDVH--RKG---------------------
A0A3Q2PJX9_BMF-02      --------MEDE-------EDDVF--EPD---------------------
A0A803YBD7_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C4W1J6_BMF-01      E--DDYSSLDGL-------DDDVF--HS-D------------F-------
A0A2R9BS98_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2J8QDD5_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-05          --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-07          --------VEEL-------EDDVF--QPED------------G-------
A0A2R9BS98_BMF-02      --------VEEL-------EDDVF--QPED------------G-------
A0A2J8QDD5_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q2YCX7_BMF-01      --------MEDE-------EDDVF--EPD---------------------
Q96LC9_BMF-01          --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-02          --------VEEL-------EDDVF--QPED------------G-------
Q96LC9_BMF-04          --------VEEL-------EDDVF--QPED------------G-------
A0A8C6A5T3_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8D2HTN1_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C5IIR3_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8D2MHD7_BMF-01      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8D2MHD7_BMF-02      E--EDYSSLDGL-------DDDVF--HSDD------------F-------
A0A8C8WD49_BMF-01      M--EPPQCVEEL-------EDDVF--QPED------------G-------
A0A8C9IYS3_BMF-01      M--EPPQCVEEL-------EDDVF--QPED------------G-------
A0A5F7ZML1_BMF-03      --------VEEL-------EDDVF--QPED------------G-------
A0A8C5UXV9_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A8C9BKQ1_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A2U4BC98_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3Q3QZ16_BMF-01      --------MDDE-------EDDVF--EPD---------------------
A0A8C6GZK8_BMF-02      --------VEEL-------EDDVF--QSED------------G-------
A0A8C6GZK8_BMF-03      --------VEEL-------EDDVF--QSED------------G-------
A0A670XMZ5_BMF-01      E--DDFSHLDGL-------DDDVF--HSDD------------C-------
A0A3B3HAU1_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A3B3HAU1_BMF-03      --------MDDE-------EDDVF--EPD---------------------
A0A3P9ICE1_BMF-03      --------MDDE-------EDDVF--EPD---------------------
A0A3P9ICE1_BMF-05      --------MDDE-------EDDVF--EPD---------------------
A0A3P9ICE1_BMF-02      --------MDDE-------EDDVF--EPD---------------------
A0A3B3WU80_BMF-01      --------MEDE-------EDDVF--EPD---------------------
A0A2K6TW78_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A671M0H4_BMF-01      --------MDED-------EDDVR--RKG---------------------
A0A8D0WCZ8_BMF-02      --------VEEL-------EDDVF--QPEE------------G-------
A0A8D0WCZ8_BMF-01      --------VEEL-------EDDVF--QPEE------------G-------
A0A384D070_BMF-01      --------VEEL-------EDDVF--QPED------------G-------
A0A3B5QK08_BMF-01      --------MEDE-------EDDVF--EPD---------------------
                                                                         

A0A8C9QDA0_BMF-01      -------------------------E--P---------------GTQPGS
A0A673JJ10_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-01      -------------------------G--L---------------ASQPSE
A0AA35JSQ3_BMF-05      -------------------------G--L---------------ASQPNE
A0A8B9NX34_BMF-02      -------------------------G--L---------------AGQPGE
A0A670JUU6_BMF-02      -------------------------G--L---------------ASQPNE
A0A493T7X1_BMF-01      -------------------------G--L---------------AGQPGE
A0A670JUU6_BMF-01      -------------------------G--L---------------ASQPNE
A0A8C2TYD3_BMF-03      -------------------------G--L---------------AGQPGE
A0A8B9VI07_BMF-02      -------------------------G--L---------------AGQPGE
A0A670JUU6_BMF-04      -------------------------G--L---------------ASQPNE
A0A8C0U4T1_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C5ST95_BMF-01      -------------------------E--L---------------VSQSSK
A0A803SZ00_BMF-02      -------------------------G--L---------------ASQPSE
A0A8C9F3R5_BMF-01      -------------------------G--L---------------A-----
A0A337ST43_BMF-02      -------------------------E--P---------------GTQPGS
A0A337ST43_BMF-04      -------------------------E--P---------------GTQPGS
A0A8B9NX34_BMF-01      -------------------------G--L---------------AGQPGE
A0A803JQ26_BMF-01      -------------------------G--Y---------------PDQ--T
A0A674GIP8_BMF-03      -------------------------G--L---------------AGQPGE
A0A8B9VI07_BMF-03      -------------------------G--L---------------A-----
A0A8C4J3Z9_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C6JG54_BMF-02      -------------------------G--L---------------AGQPGE
A0A8B9MY06_BMF-01      -------------------------G--L---------------AGQPGE
A0A663MPI8_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C9F3R5_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C4J3Z9_BMF-04      -------------------------G--L---------------AGQPGE
A0A8C2TYD3_BMF-04      -------------------------G--L---------------AGQPGE
A0AA35JSQ3_BMF-01      -------------------------G--L---------------ASQPNE
A0A8C6VCH5_BMF-01      -------------------------E--L---------------VSQSSK
A0A6I8NF73_BMF-01      -------------------------VAES---------------LAQPGG
A0A8D2L6A0_BMF-01      -------------------------G--L---------------AGQPSE
A0A669PL85_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C2TYD3_BMF-05      -------------------------G--L---------------AGQPGE
A3KND0_BMF-01          -------------------------G--Y---------------PDQ--T
A0A8C2TYD3_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C1UAR1_BMF-01      -------------------------G--L---------------QHWP--
A0A8I3W4Q3_BMF-02      -------------------------E--P---------------GTQPGS
A0A3Q2HR24_BMF-03      -------------------------E--P---------------GTQPRS
G1PAU1_BMF-01          -------------------------E--L---------------GTQPGS
A0A8C2DDJ7_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-02      -------------------------E--P---------------GTQPGS
A0A8I3W4Q3_BMF-03      -------------------------E--P---------------GTQPGS
A0A8C0RSS3_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C2SHH9_BMF-01      -------------------------E--P---------------GAQPRR
A0A8C0PT40_BMF-03      -------------------------E--P---------------GTQPGS
A0A2K6L919_BMF-02      -------------------------E--P---------------GAQPGS
A0A096NTE9_BMF-02      -------------------------E--P---------------GAQPGS
A0A337ST43_BMF-05      -------------------------E--P---------------GTQPGS
A0A7N5JI49_BMF-01      -------------------------E--P---------------GTQPGS
A0A0N8EUV8_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C2VBL6_BMF-01      -------------------------E--P---------------GTQPGS
A0A8I3W4Q3_BMF-01      -------------------------E--P---------------GTQPGS
A0A803JQ26_BMF-02      ----------------------------F---------------GYPDQT
A0A8D2HTN1_BMF-01      -------------------------E--P---------------GTQPGS
A0A287CXH0_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C0XK68_BMF-01      -------------------------E--P---------------GTQPGR
A0A3Q2HR24_BMF-02      -------------------------E--P---------------GTQPRS
G3T7Z4_BMF-01          -------------------------E--P---------------GTQPGG
A0A671DWL6_BMF-02      -------------------------D--L---------------GTQPGS
A0A8C6GZK8_BMF-01      -------------------------E--P---------------GTQPGG
A0A3Q2HR24_BMF-05      -------------------------E--P---------------GTQPRS
A0A8C5R6G2_BMF-01      -------------------------E--F---------------SLPPLT
A0A7N5JI49_BMF-03      -------------------------E--P---------------GTQPGS
A0A8C0TVZ9_BMF-03      -------------------------E--P---------------GTQPGS
A0A3Q2HR24_BMF-01      -------------------------E--P---------------GTQPRS
A0A8C0RSS3_BMF-01      -------------------------E--P---------------GTQPGS
A0A3Q2HR24_BMF-06      -------------------------E--P---------------GTQPRS
A0A7N5JI49_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C6R2L6_BMF-01      -------------------------E--P---------------GTQSGS
A0A2K5KGP2_BMF-01      -------------------------E--P---------------GAQPGS
A0A337ST43_BMF-01      -------------------------E--P---------------GTQPGS
A0A0N8EUV8_BMF-03      -------------------------R--PAPECWSRWTLAQSLGATTRRP
A0A8C0TVZ9_BMF-04      -------------------------E--P---------------GTQPGS
A0A4W3JXA1_BMF-01      -------------------------Y--S---------------DNTSGT
A0A3Q2HR24_BMF-04      -------------------------E--P---------------GTQPRS
A0A2K5VLA3_BMF-03      -------------------------E--P---------------GSQPGS
A0A673TA87_BMF-01      SRWTLARSPGITTRRRRLSPGVTQQG--R---------------WSQPGS
A0A8D2HTN1_BMF-02      -------------------------E--P---------------GTQPGS
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      -------------------------DRYP---------------HTISGT
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      -------------------------G--L---------------AGQPGE
A0A8B9FZ48_BMF-01      -------------------------G--L---------------AGQPGE
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      -------------------------G--L---------------AGQPGE
A0A803SZ00_BMF-03      -------------------------G--L---------------ASQPSE
A0A2K5E1Q4_BMF-02      -------------------------E--P---------------GTQPGS
A0A2K5E1Q4_BMF-01      -------------------------E--P---------------GTQPGS
A0A663DZQ4_BMF-01      -------------------------G--L---------------AGQPGE
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      -------------------------E--P---------------GTQPGS
L8IXF5_BMF-01          -------------------------E--P---------------GTQPRS
A0A8C0EML4_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C3KIN9_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C0JZ72_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C0PT40_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C0TVZ9_BMF-05      -------------------------E--P---------------GTQPGS
A0A452F2E0_BMF-02      -------------------------E--P---------------GAQPRR
A0A8C0XK68_BMF-02      -------------------------E--P---------------GTQPGR
A0A8C3WX89_BMF-01      -------------------------E--P---------------GTQPRR
A0A8C3VHE5_BMF-01      -------------------------G--L---------------AGQPGE
A0A286XXB0_BMF-01      -------------------------E--P---------------GTQPGS
A0A286XXB0_BMF-03      -------------------------E--P---------------GTQPGS
A0A286XXB0_BMF-02      -------------------------E--P---------------GTQPGS
A0A2K5RN49_BMF-01      -------------------------E--P---------------GTQPGS
A0A2K5RN49_BMF-02      -------------------------E--P---------------GTQPGS
A0A2K5MJW4_BMF-01      -------------------------E--P---------------GAQPGS
A0A2K5MJW4_BMF-02      -------------------------E--P---------------GAQPGS
A0A8C0GH19_BMF-01      -------------------------G--L---------------TGQPGE
A0A8C3XI05_BMF-01      -------------------------G--L---------------TGQPGE
A0A0D9R4R5_BMF-01      -------------------------E--P---------------GAQPGS
A0A8C3P5Z9_BMF-02      -------------------------G--L---------------TGQPGE
A0A8C3LTE5_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C3EY31_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C3EY31_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C2MZN7_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C2MZN7_BMF-01      -------------------------E--P---------------GTQPGS
A0A7M4FPU2_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C3QVS1_BMF-01      -------------------------G--L---------------AGQPGE
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      --------------------------------------------------
A0A9J7Z5T7_BMF-03      -------------------------G--L---------------QHWP--
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      -------------------------G--L---------------AGQPGE
A0A8C4J3Z9_BMF-01      -------------------------G--L---------------AGQPGE
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      -------------------------E--P---------------GTQPRS
A0A8C4SHZ6_BMF-01      -------------------------DRYP---------------HTISGT
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      -------------------------E--P---------------GTQPGS
U3JS06_BMF-01          -------------------------G--L---------------AGQPGE
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          -------------------------G--L---------------AGQPGE
A9XRH0_BMF-01          -------------------------G--L---------------AG----
A0A452H3N6_BMF-01      -------------------------G--L---------------TGQPGE
A0A2I2Z168_BMF-01      -------------------------E--P---------------VTQPGS
A0A2I2Z168_BMF-02      -------------------------E--P---------------VTQPGS
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      -------------------------E--P---------------GTQPGS
A0A0N8EUV8_BMF-04      -------------------------E--P---------------GTQPGS
Q96LC9_BMF-03          -------------------------E--P---------------VTQPGS
Q96LC9_BMF-06          -------------------------E--P---------------VTQPGS
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          -------------------------E--P---------------VTQPGS
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C5K765_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C5K765_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C5IIR3_BMF-01      -------------------------G--L---------------AGQPGE
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      -------------------------E--F---------------SLPPLT
A0A667H967_BMF-01      -------------------------E--P---------------GTQPGS
A0A2K5VLA3_BMF-01      -------------------------E--P---------------GSQPGS
A0A2K5VLA3_BMF-02      -------------------------E--P---------------GSQPGS
A0A5F7ZML1_BMF-02      -------------------------E--P---------------GAQPGS
A0A5F7ZML1_BMF-01      -------------------------E--P---------------GAQPGS
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C6JG54_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C5UXV9_BMF-03      -------------------------E--S---------------GTQPGS
A0A8C5UXV9_BMF-02      -------------------------E--S---------------GTQPGS
A0A5F8GKJ8_BMF-01      -------------------------E--P---------------GAQPGG
A0A8C6B0J8_BMF-01      -------------------------E--P---------------GTQPGS
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      -------------------------E--P---------------GTQPRS
Q91ZE9_BMF-06          -------------------------E--P---------------GTQPGG
Q91ZE9_BMF-01          -------------------------E--P---------------GTQPGG
Q91ZE9_BMF-02          -------------------------E--P---------------GTQPGG
M3YAD5_BMF-01          -------------------------E--P---------------GTQPGS
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      -------------------------E--L---------------VSQSSK
A0A8C6VCH5_BMF-02      -------------------------E--L---------------VSQSSK
A0A8C6R2L6_BMF-02      -------------------------E--P---------------GTQSGS
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          -------------------------E--P---------------GTQPGS
A0A2I3HD83_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C6Z034_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          -------------------------E--P---------------GTQPQS
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          -------------------------E--L---------------GT--GN
W5QFV1_BMF-01          -------------------------E--P---------------GAQPRR
A0A8C8WD49_BMF-02      -------------------------E--P---------------GTQPGS
A0A8C9IYS3_BMF-02      -------------------------E--P---------------GTQPGS
A0A096NTE9_BMF-01      -------------------------E--P---------------GAQPGS
K7FRX2_BMF-01          -------------------------G--L---------------TGQPGE
A0A8C8RL12_BMF-01      -------------------------G--L---------------TGQPGE
A0A6I9LHF8_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C9LTX9_BMF-01      -------------------------E--P---------------GAQPGS
A0AA35JSQ3_BMF-04      -------------------------G--L---------------ASQPNE
A0A670JUU6_BMF-05      -------------------------G--L---------------ASQPNE
A0A670JUU6_BMF-03      -------------------------G--L---------------ASQPNE
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      -------------------------E--P---------------GTQSGS
A0A8C8ZAV1_BMF-01      -------------------------E--S---------------GTQPGS
A0A2K6FFN3_BMF-02      -------------------------E--S---------------GTQPGS
A0A2K6FFN3_BMF-01      -------------------------E--S---------------GTQPGS
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      -------------------------E--P---------------GTQPGS
A0A8I6GLK7_BMF-01      -------------------------E--P---------------GTQPGS
Q8K589_BMF-01          -------------------------E--P---------------GTQPGS
A0A671DWL6_BMF-01      -------------------------D--L---------------GTQPGS
A0A2K6RAW1_BMF-02      -------------------------E--P---------------GAQPGS
A0A2K6TW78_BMF-02      -------------------------E--P---------------GTQPGS
A0A2K6TW78_BMF-03      -------------------------E--P---------------GTQPGS
A0A8D0CFD0_BMF-01      ----------------------------------------------QPSE
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      -------------------------E--P---------------GAQPGG
A0A8D2AYP3_BMF-01      -------------------------E--P---------------GTQPGS
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      -------------------------G--L---------------AGQPGE
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      -------------------------E--P---------------GTQPGS
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      -------------------------G--L---------------TGQAGP
A0A672V891_BMF-01      -------------------------G--L---------------AGQPGE
A0A287BML0_BMF-01      -------------------------E--P---------------GTQPRR
A0A287BML0_BMF-02      -------------------------E--P---------------GTQPRR
A0A8D0WCZ8_BMF-03      -------------------------E--P---------------GTQPRR
A0A674GIP8_BMF-02      -------------------------G--L---------------AGQPGE
A0A674GIP8_BMF-01      -------------------------G--L---------------AGQPGE
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      -------------------------G--L---------------TGQPGE
A0A452SED0_BMF-01      -------------------------E--P---------------GTQPGS
A0A4X2KLG2_BMF-01      -------------------------E--P---------------GAQPGG
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      -------------------------G--L---------------AGQPGE
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C3KIN9_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C4XVG9_BMF-01      -------------------------G--L---------------AGQPGE
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      -------------------------G--L---------------AGQPGE
A0A8B9BPF5_BMF-01      -------------------------G--L---------------AGQPGE
A0A8B9EVW2_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C3GPS7_BMF-01      -------------------------G--L---------------AGQPGE
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      -------------------------G--L---------------AGQPGE
A0A8D0FU29_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C0JZ72_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C0RSS3_BMF-03      -------------------------E--P---------------GTQPGS
A0A8C0TVZ9_BMF-02      -------------------------E--P---------------GTQPGS
A0A8I3PRV2_BMF-03      -------------------------E--P---------------GTQPGS
A0A8C0TVZ9_BMF-01      -------------------------E--P---------------GTQPGS
A0A8I3PRV2_BMF-02      -------------------------E--P---------------GTQPGS
A0A8I3PRV2_BMF-01      -------------------------E--P---------------GTQPGS
A0A452F2E0_BMF-01      -------------------------E--P---------------GAQPRR
A0A2K6B5F6_BMF-03      -------------------------E--P---------------GAQPGS
A0A2K5Z4A9_BMF-02      -------------------------E--P---------------GAQPGS
A0A2K5KGP2_BMF-02      -------------------------E--P---------------GAQPGS
A0A2K6B5F6_BMF-01      -------------------------E--P---------------GAQPGS
A0A2K6B5F6_BMF-04      -------------------------E--P---------------GAQPGS
A0A2K6B5F6_BMF-02      -------------------------E--P---------------GAQPGS
A0A2K5Z4A9_BMF-01      -------------------------E--P---------------GAQPGS
A0A2K6L919_BMF-01      -------------------------E--P---------------GAQPGS
A0A2K6L919_BMF-03      -------------------------E--P---------------GAQPGS
A0A2K6RAW1_BMF-01      -------------------------E--P---------------GAQPGS
A0A8D2E2Z1_BMF-01      -------------------------E--P---------------GAQPGS
A0A8C3P5Z9_BMF-01      -------------------------G--L---------------TGQPGE
A0A669PL85_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C5THT3_BMF-01      -------------------------G--L---------------AGQPGE
A0A8C2TYD3_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C3N153_BMF-01      -------------------------G--L---------------AGQPGE
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      -------------------------G--L---------------AG----
A0A8C4W1J6_BMF-01      -------------------------G--L---------------TGQPGE
A0A2R9BS98_BMF-01      -------------------------E--P---------------VTQPGS
A0A2J8QDD5_BMF-02      -------------------------E--P---------------VTQPGS
Q96LC9_BMF-05          -------------------------E--P---------------VTQPGS
Q96LC9_BMF-07          -------------------------E--P---------------VTQPGS
A0A2R9BS98_BMF-02      -------------------------E--P---------------VTQPGS
A0A2J8QDD5_BMF-01      -------------------------E--P---------------VTQPGS
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          -------------------------E--P---------------VTQPGS
Q96LC9_BMF-02          -------------------------E--P---------------VTQPGS
Q96LC9_BMF-04          -------------------------E--P---------------VTQPGS
A0A8C6A5T3_BMF-01      -------------------------E--P---------------GTQPGS
A0A8D2HTN1_BMF-03      -------------------------E--P---------------GTQPGS
A0A8C5IIR3_BMF-02      -------------------------G--L---------------AGQPGE
A0A8D2MHD7_BMF-01      -------------------------G--L---------------AGQPGE
A0A8D2MHD7_BMF-02      -------------------------G--L---------------AGQPGE
A0A8C8WD49_BMF-01      -------------------------E--P---------------GTQPGS
A0A8C9IYS3_BMF-01      -------------------------E--P---------------GTQPGS
A0A5F7ZML1_BMF-03      -------------------------E--P---------------GAQPGS
A0A8C5UXV9_BMF-01      -------------------------E--S---------------GTQPGS
A0A8C9BKQ1_BMF-01      -------------------------E--P---------------GTQPGS
A0A2U4BC98_BMF-01      -------------------------E--P---------------GTQPGS
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      -------------------------E--P---------------GTQPGG
A0A8C6GZK8_BMF-03      -------------------------E--P---------------GTQPGG
A0A670XMZ5_BMF-01      -------------------------E--L---------------VSQSSK
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      -------------------------E--P---------------GTQPGS
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      -------------------------E--P---------------GTQPRR
A0A8D0WCZ8_BMF-01      -------------------------E--P---------------GTQPRR
A0A384D070_BMF-01      -------------------------E--P---------------GTQPGS
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A673JJ10_BMF-01      -------------------------LP-HCCETPLRNKSSENRDGPRGEV
A0A803SZ00_BMF-01      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0AA35JSQ3_BMF-05      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A8B9NX34_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A670JUU6_BMF-02      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A493T7X1_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A670JUU6_BMF-01      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A8C2TYD3_BMF-03      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8B9VI07_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A670JUU6_BMF-04      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A8C0U4T1_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C5ST95_BMF-01      MAFRGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A803SZ00_BMF-02      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C9F3R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-02      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A337ST43_BMF-04      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A8B9NX34_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A803JQ26_BMF-01      MTSSTVFN-QSQSYTCLLSRFHLFPLS-HCCGPGCR--------------
A0A674GIP8_BMF-03      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C6JG54_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8B9MY06_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A663MPI8_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C9F3R5_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C4J3Z9_BMF-04      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C2TYD3_BMF-04      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0AA35JSQ3_BMF-01      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A8C6VCH5_BMF-01      MAFRGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A6I8NF73_BMF-01      PAPAAPLT-PGQPYSYLVGQLPLFPLA-PCCGPGLR--------------
A0A8D2L6A0_BMF-01      MTFPGIFT-QSKPYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A669PL85_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C2TYD3_BMF-05      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A3KND0_BMF-01          ITSSSLFN-QSQSYTCLLGRFHLFPFS-HCCGPGCR--------------
A0A8C2TYD3_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q2HR24_BMF-03      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
G1PAU1_BMF-01          LPSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C2DDJ7_BMF-01      ------------------------------KGLQHW--------------
A0A8C0PT40_BMF-02      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8I3W4Q3_BMF-03      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C0RSS3_BMF-02      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C2SHH9_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C0PT40_BMF-03      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A2K6L919_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A096NTE9_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A337ST43_BMF-05      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A7N5JI49_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A0N8EUV8_BMF-02      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A8C2VBL6_BMF-01      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A8I3W4Q3_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A803JQ26_BMF-02      MTSSTVFN-QSQSYTCLLSRFHLFPLS-HCCGPGCR--------------
A0A8D2HTN1_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A287CXH0_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C0XK68_BMF-01      LLSADLFA-QSQ-LDCPLGRLQLFPLT-HCCGPGLR--------------
A0A3Q2HR24_BMF-02      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
G3T7Z4_BMF-01          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A671DWL6_BMF-02      LPSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C6GZK8_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q2HR24_BMF-05      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
A0A8C5R6G2_BMF-01      --PPSPFI-QK--YTSFFGRFHLFPLS-HCCGPGCR--------------
A0A7N5JI49_BMF-03      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C0TVZ9_BMF-03      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A3Q2HR24_BMF-01      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
A0A8C0RSS3_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A3Q2HR24_BMF-06      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
A0A7N5JI49_BMF-02      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C6R2L6_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5KGP2_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A337ST43_BMF-01      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A0N8EUV8_BMF-03      ILSPG-VT-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A8C0TVZ9_BMF-04      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A4W3JXA1_BMF-01      HESLTWRATRSR-LRSPINS------V-HFCGPGCG--------------
A0A3Q2HR24_BMF-04      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
A0A2K5VLA3_BMF-03      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A673TA87_BMF-01      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A8D2HTN1_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A668TQU8_BMF-01      --------------------------A-NCWRTTFR--------------
A0A8B9LSW6_BMF-01      --------------------------P-EPWRSPIS--------------
A0A671M0H4_BMF-02      --------------------------L-QRWPSSRV--------------
A0A3Q2CXC4_BMF-02      --------------------------P-NSWHTPFR--------------
A0A672JWL9_BMF-02      --------------------------L-QHWPSSRV--------------
A0A3P8NFE2_BMF-02      --------------------------A-NCWRTTFR--------------
A0A673HDR4_BMF-01      --------------------------L-QRWPSSRV--------------
A0A8C7G467_BMF-02      --------------------------S-RCWRTAFR--------------
W5N4P7_BMF-01          F-------------------------S-HCWGTQFR--------------
A0A8C4SHZ6_BMF-02      FRHCS--T-SP----------RAN--P-FFICQRFR--------------
A0A8C9VER0_BMF-01      --------------------------A-RSWETTFR--------------
A0A8C4C2E0_BMF-02      --------------------------P-HLWHTHFR--------------
A0A3B3RH63_BMF-01      --------------------------P-LTYQPPFR--------------
W5UAU7_BMF-01          --------------------------S-QCWPSSNR--------------
Q0GKC7_BMF-01          --------------------------L-QHWPPPHL--------------
A0A8C7XJP0_BMF-02      --------------------------P-NKWRTTAR--------------
A0A3Q2PJX9_BMF-01      --------------------------P-NCWRTPFR--------------
A0A9J7Y9L1_BMF-01      --------------------------L-QHWPSSRV--------------
A0A3Q2YCX7_BMF-02      --------------------------P-HCWRTTFK--------------
A0A673YQV3_BMF-01      --------------------------S-HCWRTAFR--------------
A0A9J7Y9L1_BMF-03      --------------------------L-QHWPSSRV--------------
A0A3P8UA78_BMF-01      --------------------------P-HSWHTTFR--------------
A0A3Q2CXC4_BMF-01      --------------------------P-NSWHTPFR--------------
A0A4W4DZH9_BMF-01      --------------------------A-QYWPHSLR--------------
A0A6F9BGV6_BMF-01      --------------------------SSHCWRTAFR--------------
A0A3P9K487_BMF-02      --------------------------P-NKWRTTAR--------------
A0A2U9CJH3_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8C2DDJ7_BMF-02      --------------------------L-QHWPSSQV--------------
A0A8C7XJP0_BMF-01      --------------------------P-NKWRTTAR--------------
A0A9J7Y9L1_BMF-02      --------------------------L-QHWPSSRV--------------
A0A3P9ICE1_BMF-01      --------------------------P-NKWRTTAR--------------
A0A3Q3RVI2_BMF-01      --------------------------P-HFWRTTFR--------------
A0A8C4C2E0_BMF-01      --------------------------P-HLWHTHFR--------------
A0A3Q3VLX6_BMF-01      --------------------------A-HCWRTTFR--------------
A0A3B5B8F6_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8C6U3U8_BMF-01      --------------------------L-QCWHSTFR--------------
A0A8C1XUF5_BMF-01      --------------------------L-QRWPSSHV--------------
A0A8C6PNJ4_BMF-01      --------------------------S-SCWRKTFR--------------
A0A8K9UY13_BMF-01      --------------------------SSHCWRTAFR--------------
A0A674EF64_BMF-01      --------------------------SSHCWRTAFR--------------
A0A3B4B6Y3_BMF-01      --------------------------L-HCWHTTFR--------------
A0A8C4DD37_BMF-02      --------------------------P-HCWRTAFR--------------
A0A672HG10_BMF-01      --------------------------P-RCWRTAFR--------------
A0A6F9B4C5_BMF-01      --------------------------F-HCWRTAFR--------------
A0A8C7JEQ7_BMF-02      --------------------------S-QCWGTPFR--------------
A0A3B4UNJ0_BMF-01      --------------------------S-HLWGTSFR--------------
A0A672RK14_BMF-01      --------------------------P-HCCETPLR--------------
A0A3Q1FVH7_BMF-02      --------------------------T-HCWRTTFR--------------
A0A8B9MY06_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8B9FZ48_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3Q1D1K3_BMF-01      --------------------------P-HCWRTTFR--------------
A0A3Q1IPR4_BMF-01      --------------------------P-HCWRTTFR--------------
A0A493T7X1_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A803SZ00_BMF-03      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A2K5E1Q4_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5E1Q4_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A663DZQ4_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3P8NFE2_BMF-01      --------------------------A-NCWRTTFR--------------
A0A3B1K1X5_BMF-01      --------------------------P-EPWRSPIS--------------
A0A8C0CL26_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
L8IXF5_BMF-01          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C0EML4_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C3KIN9_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C0JZ72_BMF-02      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C0PT40_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C0TVZ9_BMF-05      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A452F2E0_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C0XK68_BMF-02      LLSADLFA-QSQ-LDCPLGRLQLFPLT-HCCGPGLR--------------
A0A8C3WX89_BMF-01      -VSADPFV-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C3VHE5_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A286XXB0_BMF-01      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A286XXB0_BMF-03      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A286XXB0_BMF-02      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A2K5RN49_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5RN49_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5MJW4_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5MJW4_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C0GH19_BMF-01      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C3XI05_BMF-01      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A0D9R4R5_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C3P5Z9_BMF-02      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C3LTE5_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C3EY31_BMF-02      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C3EY31_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C2MZN7_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C2MZN7_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A7M4FPU2_BMF-01      MTSTGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C3QVS1_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A9J7Z5T7_BMF-01      --------------------------L-QHWPSSQV--------------
A0A9J7Z5T7_BMF-02      ------------------------------KGLQHW--------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------L-QHWPSSRV--------------
A0A8C1UAR1_BMF-02      --------------------------L-QHWPSSQV--------------
A0A8C4DD37_BMF-01      --------------------------P-HCWRTAFR--------------
A0A8C4J3Z9_BMF-03      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C4J3Z9_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGSR--------------
A0A665VG08_BMF-01      --------------------------P-HFWRTTFR--------------
A0A8C4MCB2_BMF-01      LLSADLFA-PSQ-LDCPLSHLRLFPLT-HCCGPGLR--------------
A0A8C4SHZ6_BMF-01      FRHCS--T-SP----------RAN--P-FFICQRFR--------------
A0A3P8ZIE7_BMF-01      --------------------------S-YCWHTASR--------------
A0A337ST43_BMF-03      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
U3JS06_BMF-01          MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3Q2PJX9_BMF-03      --------------------------P-NCWRTPFR--------------
A9XRG9_BMF-01          MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A2I2Z168_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2I2Z168_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5HAH2_BMF-01      --------------------------P-LCWRTAFK--------------
A0A0N8EUV8_BMF-01      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A0N8EUV8_BMF-04      LLSADLFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
Q96LC9_BMF-03          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q96LC9_BMF-06          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A4W5N3A7_BMF-01      --------------------------SSHCWRTAFR--------------
A0A4W5N721_BMF-01      --------------------------S-HCWRTAFR--------------
A0A287CXH0_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5K765_BMF-01      LLSADLFA-QSQ-MDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5K765_BMF-02      LLSADLFA-QSQ-MDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5IIR3_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3Q2ZA20_BMF-01      --------------------------P-SCWRTTFR--------------
A0A3Q3GUU5_BMF-01      --------------------------P-HSWRTYFQ--------------
A0A4W6DUL1_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8C5R6G2_BMF-02      --PPSPFI-QK--YTSFFGRFHLFPLS-HCCGPGCR--------------
A0A667H967_BMF-01      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A2K5VLA3_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5VLA3_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A5F7ZML1_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A5F7ZML1_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q3RVI2_BMF-02      --------------------------P-HFWRTTFR--------------
A0A803YBD7_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C6JG54_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C5UXV9_BMF-03      VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5UXV9_BMF-02      VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A5F8GKJ8_BMF-01      LTSAALFA-QSQ-PDYMLDGLQLFPLT-HCCGPGLR--------------
A0A8C6B0J8_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q3QZ16_BMF-02      --------------------------P-HCWRTAFR--------------
A0A8C6CWP8_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q91ZE9_BMF-06          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q91ZE9_BMF-01          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q91ZE9_BMF-02          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
M3YAD5_BMF-01          LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A667YNR9_BMF-01      --------------------------L-HCWRTTFR--------------
A0A8C6VCH5_BMF-03      MAFRGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C6VCH5_BMF-02      MAFRGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A8C6R2L6_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q4G1I4_BMF-01      --------------------------A-NCWRTTFR--------------
U6CSY8_BMF-01          LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A2I3HD83_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C6Z034_BMF-01      MTATGFFT-QNQT--C-LRRFQLFPLT-HCCGPGSR--------------
A0A8C7FH91_BMF-01      --------------------------SSHCWRTAFR--------------
A0A8C7G467_BMF-01      --------------------------S-RCWRTAFR--------------
A0A8C7JEQ7_BMF-01      --------------------------S-QCWGTPFR--------------
A0A8C7RCY3_BMF-01      --------------------------S-HCWRTAFR--------------
A0A8C7SCN2_BMF-01      --------------------------S-QCWGTPFR--------------
A0A8K9UY13_BMF-02      --------------------------SSHCWRTAFR--------------
A0A8C8CQZ6_BMF-01      --------------------------SSHCWRTAFR--------------
A0A8C8F9Y2_BMF-02      --------------------------S-HCWLTAFR--------------
A0A8C8F9Y2_BMF-01      --------------------------S-HCWLTAFR--------------
A0A8C8FNK5_BMF-01      --------------------------S-QCWGTPFR--------------
I3K2D6_BMF-01          --------------------------A-NCWRTTFR--------------
G1SR62_BMF-01          LLSADPFA-QSQ-LDCPLGRLHLFPLT-HCCGPGLR--------------
A0A3B3HAU1_BMF-01      --------------------------P-NKWRTTAR--------------
A0A3B3HAU1_BMF-04      --------------------------P-NKWRTTAR--------------
A0A3P9ICE1_BMF-04      --------------------------P-NKWRTTAR--------------
A0A3P9K487_BMF-01      --------------------------P-NKWRTTAR--------------
A0A3B3CGR9_BMF-01      --------------------------P-NNWRTAVR--------------
H0WYH6_BMF-01          VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
W5QFV1_BMF-01          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C8WD49_BMF-02      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A8C9IYS3_BMF-02      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A096NTE9_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
K7FRX2_BMF-01          MTPTGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C8RL12_BMF-01      MTPTGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A6I9LHF8_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C9LTX9_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0AA35JSQ3_BMF-04      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A670JUU6_BMF-05      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A670JUU6_BMF-03      MTFPGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGTR--------------
A0A096LRV0_BMF-01      --------------------------P-NCWRTPFR--------------
A0A3P9Q8E2_BMF-01      --------------------------P-NCWRTPFR--------------
A0A6D2XBX1_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C8ZAV1_BMF-01      VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6FFN3_BMF-02      VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6FFN3_BMF-01      VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3B4CNJ8_BMF-01      --------------------------T-QYWRSSIR--------------
A0A8I6GLK7_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8I6GLK7_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q8K589_BMF-01          LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A671DWL6_BMF-01      LPSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6RAW1_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6TW78_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6TW78_BMF-03      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8D0CFD0_BMF-01      MTFPGIFT-QSKSYNCLLRRFHLFPLT-HCCGPGTR--------------
A0A8C9XRX5_BMF-01      --------------------------P-HCWRTTFR--------------
A0A7N4PJP2_BMF-01      LTSPALFA-QSQ-PDYMLDGLQLFPLT-HCCGPGLR--------------
A0A8D2AYP3_BMF-01      LLSADPFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8D3CAL2_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8C9NB87_BMF-01      MTATGFFT-QNQSCSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3B4U5H8_BMF-01      --------------------------P-HCWRTTFR--------------
A0A3B4WM88_BMF-01      --------------------------P-HCWRTTFR--------------
A0A671MNR9_BMF-01      --------------------------L-QHWPSSRV--------------
A0A672JWL9_BMF-01      --------------------------L-QHWPSSRV--------------
A0A671X848_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8C9UST6_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A673C8N3_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8D0LCG8_BMF-01      MTSPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A672V891_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A287BML0_BMF-01      -VSADPFV-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A287BML0_BMF-02      -VSADPFV-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8D0WCZ8_BMF-03      -VSADPFV-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A674GIP8_BMF-02      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A674GIP8_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3B5KWG6_BMF-02      --------------------------P-YSWRTTFQ--------------
A0A3B5KWG6_BMF-01      --------------------------P-YSWRTTFQ--------------
A0A3B5KWG6_BMF-03      --------------------------P-YSWRTTFQ--------------
A0A674IPL3_BMF-01      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A452SED0_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A4X2KLG2_BMF-01      LTSAALFA-QSQ-PDYMLDGLQLFPLT-HCCGPGLR--------------
A0A3B5QK08_BMF-02      --------------------------P-NCWRTPFR--------------
A0A8D2PG36_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3Q1FVH7_BMF-01      --------------------------T-HCWRTTFR--------------
A0A8C0AW70_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C3KIN9_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C4XVG9_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3P8RKY9_BMF-01      --------------------------P-HCWRTTFR--------------
A0A8B9VI07_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8B9BPF5_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8B9EVW2_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C3GPS7_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A3Q3C5V2_BMF-01      --------------------------A-NCWRTTFR--------------
A0A3P9DPJ5_BMF-01      --------------------------A-NCWRTTFR--------------
A0A3P9DPJ5_BMF-02      --------------------------A-NCWRTTFR--------------
A0A3B4ETH0_BMF-01      --------------------------A-NCWRTTFR--------------
A0A8B9LSW6_BMF-02      --------------------------P-EPWRSPIS--------------
A0A8C8B299_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8D0FU29_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C0JZ72_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C0RSS3_BMF-03      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C0TVZ9_BMF-02      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8I3PRV2_BMF-03      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8C0TVZ9_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8I3PRV2_BMF-02      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A8I3PRV2_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A452F2E0_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6B5F6_BMF-03      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5Z4A9_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5KGP2_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6B5F6_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6B5F6_BMF-04      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6B5F6_BMF-02      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K5Z4A9_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6L919_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6L919_BMF-03      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2K6RAW1_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8D2E2Z1_BMF-01      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C3P5Z9_BMF-01      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A669PL85_BMF-01      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C5THT3_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C2TYD3_BMF-02      MTATGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGVR--------------
A0A8C3N153_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A3P8UA78_BMF-03      --------------------------P-HSWHTTFR--------------
A0A3P8UA78_BMF-02      --------------------------P-HSWHTTFR--------------
A0A8C1P2N8_BMF-03      --------------------------L-QHWPSSRV--------------
A0A8C1P2N8_BMF-01      --------------------------L-QHWPSSRV--------------
A0A3Q2PJX9_BMF-02      --------------------------P-NCWRTPFR--------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      MTPPGIFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A2R9BS98_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2J8QDD5_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q96LC9_BMF-05          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q96LC9_BMF-07          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2R9BS98_BMF-02      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2J8QDD5_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q2YCX7_BMF-01      --------------------------P-HCWRTTFK--------------
Q96LC9_BMF-01          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q96LC9_BMF-02          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
Q96LC9_BMF-04          LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C6A5T3_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8D2HTN1_BMF-03      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5IIR3_BMF-02      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8D2MHD7_BMF-01      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8D2MHD7_BMF-02      MTATGFFT-QNQSYSCLLGRFQLFPLT-HCCGPGIR--------------
A0A8C8WD49_BMF-01      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A8C9IYS3_BMF-01      LLSANLFA-QSQ-LDCPLSHLQLFPLT-HCCGPGLR--------------
A0A5F7ZML1_BMF-03      SLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C5UXV9_BMF-01      VLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C9BKQ1_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A2U4BC98_BMF-01      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A3Q3QZ16_BMF-01      --------------------------P-HCWRTAFR--------------
A0A8C6GZK8_BMF-02      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8C6GZK8_BMF-03      LLSADLFA-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A670XMZ5_BMF-01      MAFRGIFT-QSKSYNCLLGRFQLFPLT-HCCGPGSR--------------
A0A3B3HAU1_BMF-02      --------------------------P-NKWRTTAR--------------
A0A3B3HAU1_BMF-03      --------------------------P-NKWRTTAR--------------
A0A3P9ICE1_BMF-03      --------------------------P-NKWRTTAR--------------
A0A3P9ICE1_BMF-05      --------------------------P-NKWRTTAR--------------
A0A3P9ICE1_BMF-02      --------------------------P-NKWRTTAR--------------
A0A3B3WU80_BMF-01      --------------------------P-NCWRTPFR--------------
A0A2K6TW78_BMF-01      LLSADLFA-QSL-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A671M0H4_BMF-01      --------------------------L-QRWPSSRV--------------
A0A8D0WCZ8_BMF-02      -VSADPFV-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A8D0WCZ8_BMF-01      -VSADPFV-QSQ-LDCPLSRLQLFPLT-HCCGPGLR--------------
A0A384D070_BMF-01      LLSADLFA-QSQ-LDCPLSRLHLFPLT-HCCGPGLR--------------
A0A3B5QK08_BMF-01      --------------------------P-NCWRTPFR--------------
                                                                         

A0A8C9QDA0_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A673JJ10_BMF-01      GQTANRHGRF-ED--------------------RSTQTAR--T----VLN
A0A803SZ00_BMF-01      ------QARQ-QD--------------------KATQTLN--P----SSS
A0AA35JSQ3_BMF-05      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A8B9NX34_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A670JUU6_BMF-02      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A493T7X1_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A670JUU6_BMF-01      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A8C2TYD3_BMF-03      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8B9VI07_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A670JUU6_BMF-04      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A8C0U4T1_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C5ST95_BMF-01      ------HAKQ-QD--------------------KATQTLN--A----SSS
A0A803SZ00_BMF-02      ------QARQ-QD--------------------KATQTLN--P----SSS
A0A8C9F3R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A337ST43_BMF-04      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8B9NX34_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A803JQ26_BMF-01      ------GADY-ED--------------------KATQTLG--S----PSI
A0A674GIP8_BMF-03      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      ------HPEQ-QD--------------------KATQTLS--Q----SSS
A0A8C6JG54_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8B9MY06_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A663MPI8_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C9F3R5_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C4J3Z9_BMF-04      ------HPEQ-QD--------------------KATQTLS--Q----SSS
A0A8C2TYD3_BMF-04      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0AA35JSQ3_BMF-01      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A8C6VCH5_BMF-01      ------HAKQ-QD--------------------KATQTLN--A----SSS
A0A6I8NF73_BMF-01      ------TLSQ-ED--------------------KTTQTLS--P----AAP
A0A8D2L6A0_BMF-01      ------PAKQ-QD--------------------KATQTLS--P----SSS
A0A669PL85_BMF-02      ------QPEQ-QD--------------------KATQTLS--P----SSS
A0A8C2TYD3_BMF-05      ------HPEQ-QD--------------------KATQTLS--P----SSS
A3KND0_BMF-01          ------GTDN-ED--------------------KATQTLG--------SP
A0A8C2TYD3_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C1UAR1_BMF-01      ------SSQV-QI--------------------KQTDTAG--R----APV
A0A8I3W4Q3_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q2HR24_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
G1PAU1_BMF-01          ------PISQ-ED--------------------KATQTLS--P----ASP
A0A8C2DDJ7_BMF-01      ------PSSQVQI--------------------KQTETAG--R----APV
A0A8C0PT40_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8I3W4Q3_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0RSS3_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C2SHH9_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0PT40_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K6L919_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A096NTE9_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A337ST43_BMF-05      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A7N5JI49_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A0N8EUV8_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A8C2VBL6_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A8I3W4Q3_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A803JQ26_BMF-02      ------GADY-ED--------------------KATQTLG--S----PSI
A0A8D2HTN1_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A287CXH0_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0XK68_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q2HR24_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
G3T7Z4_BMF-01          ------HTSQ-ED--------------------KATQTLS--P----ASP
A0A671DWL6_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C6GZK8_BMF-01      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A3Q2HR24_BMF-05      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5R6G2_BMF-01      ------SADS-ED--------------------KATQTLG--S----PSV
A0A7N5JI49_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0TVZ9_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q2HR24_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0RSS3_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q2HR24_BMF-06      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A7N5JI49_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C6R2L6_BMF-01      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A2K5KGP2_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A337ST43_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A0N8EUV8_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A8C0TVZ9_BMF-04      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A4W3JXA1_BMF-01      ------RQVQ-CD--------------------KATQTPTSIP----GSD
A0A3Q2HR24_BMF-04      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K5VLA3_BMF-03      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A673TA87_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8D2HTN1_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A668TQU8_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A8B9LSW6_BMF-01      ------VIKQ-EE--------------------RGTQTPG--R----PPA
A0A671M0H4_BMF-02      ------QIKQ-------------------------TETAG--T----PPV
A0A3Q2CXC4_BMF-02      ------EIKF-ED--------------------RGTQTPG--P----GVA
A0A672JWL9_BMF-02      ------QIKQ-------------------------TETAG--I----PPL
A0A3P8NFE2_BMF-02      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A673HDR4_BMF-01      ------QIKQ-------------------------TETAG--R----PPL
A0A8C7G467_BMF-02      ------EIKY-ED--------------------RGTQTPS--P----VLP
W5N4P7_BMF-01          ------EIKY-ED--------------------KGTQTPS--P----ALV
A0A8C4SHZ6_BMF-02      ------EVKY-VD--------------------QSTQTTS--N----HVP
A0A8C9VER0_BMF-01      ------EIKH-ED--------------------RSTQTPG--P----ALV
A0A8C4C2E0_BMF-02      ------EIKY-KD--------------------RGTQTPG--P----ALS
A0A3B3RH63_BMF-01      ------DIKC-EN--------------------RGTQTPG--P----ALV
W5UAU7_BMF-01          ------EIKQ-ED--------------------HSTQTPG--S----PAV
Q0GKC7_BMF-01          ------QIKQ-------------------------TELAG--R----PAG
A0A8C7XJP0_BMF-02      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3Q2PJX9_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A9J7Y9L1_BMF-01      ------QLKQ-------------------------TETAG--R----APV
A0A3Q2YCX7_BMF-02      ------EIKC-EE--------------------RATQTPG--P----VPA
A0A673YQV3_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----VLP
A0A9J7Y9L1_BMF-03      ------QLK-------------------------QTETAG--R----APV
A0A3P8UA78_BMF-01      ------EIRC-ED--------------------RGTQTPG--P----DLA
A0A3Q2CXC4_BMF-01      ------EIKF-ED--------------------RGTQTPG--P----GVA
A0A4W4DZH9_BMF-01      ------EIKQ-EE--------------------RGTQTAG--R----PLA
A0A6F9BGV6_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----ALA
A0A3P9K487_BMF-02      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A2U9CJH3_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A8C2DDJ7_BMF-02      ------QIKQ-------------------------TETAG--R----APV
A0A8C7XJP0_BMF-01      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A9J7Y9L1_BMF-02      ------QLK-------------------------QTETAG--R----APV
A0A3P9ICE1_BMF-01      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3Q3RVI2_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A8C4C2E0_BMF-01      ------EIKY-KD--------------------RGTQTPG--P----ALS
A0A3Q3VLX6_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A3B5B8F6_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALQ
A0A8C6U3U8_BMF-01      ------QIKC-ED--------------------RATQTPG--P----ALA
A0A8C1XUF5_BMF-01      ------QLKQ-------------------------TETAG--R----APV
A0A8C6PNJ4_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALL
A0A8K9UY13_BMF-01      ------EIKY-ED--------------------RGTQTPC--P----ALA
A0A674EF64_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----ALA
A0A3B4B6Y3_BMF-01      ------QIKC-ED--------------------RATQTPG--P----ALA
A0A8C4DD37_BMF-02      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A672HG10_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----VLV
A0A6F9B4C5_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----VLA
A0A8C7JEQ7_BMF-02      ------EIKF-HDRESRDREDT---------QDRSTQTST--GPNAIVPR
A0A3B4UNJ0_BMF-01      ------DVKY-ED--------------------RATPIAA--GQ---ALT
A0A672RK14_BMF-01      ------NKSS-ENRDGRGGEVGQTANRHGRFEDRSTQTAS--S----VLN
A0A3Q1FVH7_BMF-02      ------EIKC-ED--------------------RGTQTPG--P----ALQ
A0A8B9MY06_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8B9FZ48_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3Q1D1K3_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALQ
A0A3Q1IPR4_BMF-01      ------EIKC-QD--------------------RGTQTPG--P----ALP
A0A493T7X1_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A803SZ00_BMF-03      ------QARQ-QD--------------------KATQTLN--P----SSS
A0A2K5E1Q4_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K5E1Q4_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A663DZQ4_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3P8NFE2_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A3B1K1X5_BMF-01      ------VIKQ-EE--------------------RGTQTPG--R----PPA
A0A8C0CL26_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
L8IXF5_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0EML4_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C3KIN9_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C0JZ72_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0PT40_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0TVZ9_BMF-05      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A452F2E0_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0XK68_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C3WX89_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C3VHE5_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A286XXB0_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A286XXB0_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A286XXB0_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A2K5RN49_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K5RN49_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K5MJW4_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K5MJW4_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A8C0GH19_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A8C3XI05_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A0D9R4R5_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A8C3P5Z9_BMF-02      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A8C3LTE5_BMF-01      ------QPEQ-QD--------------------KATQTLS--P----SSS
A0A8C3EY31_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C3EY31_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C2MZN7_BMF-02      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A8C2MZN7_BMF-01      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A7M4FPU2_BMF-01      ------HTEQ-QD--------------------KATQTLN--P----SSS
A0A8C3QVS1_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A9J7Z5T7_BMF-01      ------QIKQ-------------------------TDTAG--R----APV
A0A9J7Z5T7_BMF-02      ------PSSQVQI--------------------KQTDTAG--R----APV
A0A9J7Z5T7_BMF-03      ------SSQV-QI--------------------KQTDTAG--R----APV
A0A8C1P2N8_BMF-02      ------QLK-------------------------QTETAG--R----APV
A0A8C1UAR1_BMF-02      ------QIKQ-------------------------TDTAG--R----APV
A0A8C4DD37_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A8C4J3Z9_BMF-03      ------HPEQ-QD--------------------KATQTLS--Q----SSS
A0A8C4J3Z9_BMF-01      ------HPEQ-QD--------------------KATQTLS--Q----SSS
A0A665VG08_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALG
A0A8C4MCB2_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C4SHZ6_BMF-01      ------EVKY-VD--------------------QSTQTTS--N----HVP
A0A3P8ZIE7_BMF-01      ------EIKY-ED--------------------RGTQTPT--T----ALA
A0A337ST43_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
U3JS06_BMF-01          ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3Q2PJX9_BMF-03      ------EIKC-ED--------------------RGTQTPG--P----ALA
A9XRG9_BMF-01          ------HPEQ-QD--------------------KATQTLS--P----SSS
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A2I2Z168_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2I2Z168_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5HAH2_BMF-01      ------EIKC-ED--------------------RVTQTPG--P----ALV
A0A0N8EUV8_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----SSP
A0A0N8EUV8_BMF-04      ------PTSQ-ED--------------------KATQTLS--P----SSP
Q96LC9_BMF-03          ------PTSQ-ED--------------------KATQTLS--P----ASP
Q96LC9_BMF-06          ------PTSQ-ED--------------------KATQTLS--P----ASP
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----ALA
A0A4W5N721_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----VLP
A0A287CXH0_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5K765_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5K765_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5IIR3_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3Q2ZA20_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALV
A0A3Q3GUU5_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A4W6DUL1_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A8C5R6G2_BMF-02      ------SADS-ED--------------------KATQTLG--S----PSV
A0A667H967_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K5VLA3_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K5VLA3_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A5F7ZML1_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A5F7ZML1_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A3Q3RVI2_BMF-02      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A803YBD7_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C6JG54_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C5UXV9_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5UXV9_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A5F8GKJ8_BMF-01      ------SVGQ-ED--------------------KATQTLS--P----ASP
A0A8C6B0J8_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q3QZ16_BMF-02      ------EIKC-ED--------------------RGTQTAG--P----TLA
A0A8C6CWP8_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
Q91ZE9_BMF-06          ------PISQ-ED--------------------KATQTLS--P----ASP
Q91ZE9_BMF-01          ------PISQ-ED--------------------KATQTLS--P----ASP
Q91ZE9_BMF-02          ------PISQ-ED--------------------KATQTLS--P----ASP
M3YAD5_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A667YNR9_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALT
A0A8C6VCH5_BMF-03      ------HAKQ-QD--------------------KATQTLN--A----SSS
A0A8C6VCH5_BMF-02      ------HAKQ-QD--------------------KATQTLN--A----SSS
A0A8C6R2L6_BMF-02      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A3Q4G1I4_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALV
U6CSY8_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2I3HD83_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C6Z034_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C7FH91_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----ALA
A0A8C7G467_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----VLP
A0A8C7JEQ7_BMF-01      ------EIKF-HDRESRDREDT---------QDRSTQTST--GPNAIVPR
A0A8C7RCY3_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----VLP
A0A8C7SCN2_BMF-01      ------EIKF-HDRESRDREDT---------QDRSTQTST--GPNAVVPR
A0A8K9UY13_BMF-02      ------EIKY-ED--------------------RGTQTPC--P----ALA
A0A8C8CQZ6_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----ALA
A0A8C8F9Y2_BMF-02      ------EIKY-ED--------------------RGTQTPS--P----VLP
A0A8C8F9Y2_BMF-01      ------EIKY-ED--------------------RGTQTPS--P----VLP
A0A8C8FNK5_BMF-01      ------EIKF-HDRESRDREDT---------QDRSTQTST--GPNAIVPR
I3K2D6_BMF-01          ------EIKC-EH--------------------RGTQTPG--P----ALV
G1SR62_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3B3HAU1_BMF-01      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3B3HAU1_BMF-04      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3P9ICE1_BMF-04      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3P9K487_BMF-01      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3B3CGR9_BMF-01      ------KIKC-ED--------------------RGTQTPG--P----ALV
H0WYH6_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
W5QFV1_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C8WD49_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C9IYS3_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A096NTE9_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
K7FRX2_BMF-01          ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A8C8RL12_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A6I9LHF8_BMF-01      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A8C9LTX9_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0AA35JSQ3_BMF-04      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A670JUU6_BMF-05      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A670JUU6_BMF-03      ------HAKQ-QD--------------------KATQTLN--P----SSS
A0A096LRV0_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----GQA
A0A3P9Q8E2_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----GQA
A0A6D2XBX1_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C8ZAV1_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K6FFN3_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K6FFN3_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3B4CNJ8_BMF-01      ------EIKQ-EE--------------------RGTQTPG--R----PPA
A0A8I6GLK7_BMF-02      ------PVSQ-ED--------------------KATQTLS--P----ASP
A0A8I6GLK7_BMF-01      ------PVSQ-ED--------------------KATQTLS--P----ASP
Q8K589_BMF-01          ------PVSQ-ED--------------------KATQTLS--P----ASP
A0A671DWL6_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K6RAW1_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6TW78_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K6TW78_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8D0CFD0_BMF-01      ------HAEQ-QD--------------------KATQTLN--P----SSC
A0A8C9XRX5_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A7N4PJP2_BMF-01      ------SVGQ-ED--------------------KATQTLS--P----ASP
A0A8D2AYP3_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8D3CAL2_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A8C9NB87_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3B4U5H8_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A3B4WM88_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A671MNR9_BMF-01      ------QIKQ-------------------------TETAG--R----PPL
A0A672JWL9_BMF-01      ------QIKQ-------------------------TETAG--I----PPL
A0A671X848_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A8C9UST6_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A673C8N3_BMF-01      ------EIKC-ED--------------------RGTQTPG--L----ALA
A0A8D0LCG8_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A672V891_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A287BML0_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A287BML0_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8D0WCZ8_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A674GIP8_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A674GIP8_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3B5KWG6_BMF-02      ------EIKC-ED--------------------RGTQTPG--P----TLA
A0A3B5KWG6_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----TLA
A0A3B5KWG6_BMF-03      ------EIKC-ED--------------------RGTQTPG--P----TLA
A0A674IPL3_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A452SED0_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A4X2KLG2_BMF-01      ------SVGQ-ED--------------------KATQTLS--P----ASP
A0A3B5QK08_BMF-02      ------EIKC-ED--------------------RGTQTPG--P----GQA
A0A8D2PG36_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3Q1FVH7_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALQ
A0A8C0AW70_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C3KIN9_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C4XVG9_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3P8RKY9_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----ALQ
A0A8B9VI07_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8B9BPF5_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8B9EVW2_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C3GPS7_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3Q3C5V2_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A3P9DPJ5_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A3P9DPJ5_BMF-02      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A3B4ETH0_BMF-01      ------EIKC-EH--------------------RGTQTPG--P----ALV
A0A8B9LSW6_BMF-02      ------VIKQ-EE--------------------RGTQTPG--R----PPA
A0A8C8B299_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8D0FU29_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C0JZ72_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0RSS3_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0TVZ9_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8I3PRV2_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C0TVZ9_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8I3PRV2_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8I3PRV2_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A452F2E0_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2K6B5F6_BMF-03      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K5Z4A9_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K5KGP2_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6B5F6_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6B5F6_BMF-04      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6B5F6_BMF-02      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K5Z4A9_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6L919_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6L919_BMF-03      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A2K6RAW1_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A8D2E2Z1_BMF-01      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A8C3P5Z9_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A669PL85_BMF-01      ------QPEQ-QD--------------------KATQTLS--P----SSS
A0A8C5THT3_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C2TYD3_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C3N153_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A3P8UA78_BMF-03      ------EIRC-ED--------------------RGTQTPG--P----DLA
A0A3P8UA78_BMF-02      ------EIRC-ED--------------------RGTQTPG--P----DLA
A0A8C1P2N8_BMF-03      ------QLKQ-------------------------TETAG--R----APV
A0A8C1P2N8_BMF-01      ------QLK-------------------------QTETAG--R----APV
A0A3Q2PJX9_BMF-02      ------EIKC-ED--------------------RGTQTPG--P----ALA
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      ------HAEQ-QD--------------------KATQTLS--P----SSS
A0A2R9BS98_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2J8QDD5_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
Q96LC9_BMF-05          ------PTSQ-ED--------------------KATQTLS--P----ASP
Q96LC9_BMF-07          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2R9BS98_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2J8QDD5_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q2YCX7_BMF-01      ------EIKC-EE--------------------RATQTPG--P----VPA
Q96LC9_BMF-01          ------PTSQ-ED--------------------KATQTLS--P----ASP
Q96LC9_BMF-02          ------PTSQ-ED--------------------KATQTLS--P----ASP
Q96LC9_BMF-04          ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C6A5T3_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8D2HTN1_BMF-03      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C5IIR3_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8D2MHD7_BMF-01      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8D2MHD7_BMF-02      ------HPEQ-QD--------------------KATQTLS--P----SSS
A0A8C8WD49_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C9IYS3_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A5F7ZML1_BMF-03      ------PTSQ-ED--------------------KATQTLG--P----ASP
A0A8C5UXV9_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8C9BKQ1_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A2U4BC98_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3Q3QZ16_BMF-01      ------EIKC-ED--------------------RGTQTAG--P----TLA
A0A8C6GZK8_BMF-02      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A8C6GZK8_BMF-03      ------PISQ-ED--------------------KATQTLS--P----ASP
A0A670XMZ5_BMF-01      ------HAKQ-QD--------------------KATQTLN--A----SSS
A0A3B3HAU1_BMF-02      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3B3HAU1_BMF-03      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3P9ICE1_BMF-03      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3P9ICE1_BMF-05      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3P9ICE1_BMF-02      ------KIKC-ED--------------------RGTQTPG--P----ALV
A0A3B3WU80_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----GQA
A0A2K6TW78_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A671M0H4_BMF-01      ------QIKQ-------------------------TETAG--T----PPV
A0A8D0WCZ8_BMF-02      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A8D0WCZ8_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A384D070_BMF-01      ------PTSQ-ED--------------------KATQTLS--P----ASP
A0A3B5QK08_BMF-01      ------EIKC-ED--------------------RGTQTPG--P----GQA
                                                                         

A0A8C9QDA0_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A673JJ10_BMF-01      SAR-----------DGDMAP--F-------------------------QE
A0A803SZ00_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0AA35JSQ3_BMF-05      S-------------QDVMLPCGV-------------------------TE
A0A8B9NX34_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A670JUU6_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A493T7X1_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A670JUU6_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C2TYD3_BMF-03      S-------------QDVMLPCGV-------------------------TE
A0A8B9VI07_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A670JUU6_BMF-04      S-------------QDVMLPCGV-------------------------TE
A0A8C0U4T1_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C5ST95_BMF-01      S-------------QDIMLPCGV-------------------------TE
A0A803SZ00_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C9F3R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A337ST43_BMF-04      S-------------QGVMLPCGV-------------------------TE
A0A8B9NX34_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A803JQ26_BMF-01      S-------------QDIMLPCGV-------------------------SE
A0A674GIP8_BMF-03      S-------------QDVMLPCGV-------------------------TE
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C6JG54_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8B9MY06_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A663MPI8_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C9F3R5_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C4J3Z9_BMF-04      S-------------QDVMLPCGV-------------------------TE
A0A8C2TYD3_BMF-04      S-------------QDVMLPCGV-------------------------TE
A0AA35JSQ3_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C6VCH5_BMF-01      S-------------QDIMLPCGV-------------------------TE
A0A6I8NF73_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8D2L6A0_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A669PL85_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C2TYD3_BMF-05      S-------------QDVMLPCGV-------------------------TE
A3KND0_BMF-01          S-------------QDIMLPCGV-------------------------SE
A0A8C2TYD3_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C1UAR1_BMF-01      S-------------PDSMLPCRV-------------------------HV
A0A8I3W4Q3_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A3Q2HR24_BMF-03      S-------------QGVMLPCGV-------------------------TE
G1PAU1_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A8C2DDJ7_BMF-01      S-------------PNSMLPCRV-------------------------HV
A0A8C0PT40_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8I3W4Q3_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C0RSS3_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C2SHH9_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C0PT40_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A2K6L919_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A096NTE9_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A337ST43_BMF-05      S-------------QGVMLPCGV-------------------------TE
A0A7N5JI49_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A0N8EUV8_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C2VBL6_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8I3W4Q3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A803JQ26_BMF-02      S-------------QDIMLPCGV-------------------------SE
A0A8D2HTN1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A287CXH0_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C0XK68_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q2HR24_BMF-02      S-------------QGVMLPCGV-------------------------TE
G3T7Z4_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A671DWL6_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C6GZK8_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q2HR24_BMF-05      S-------------QGVMLPCGV-------------------------TE
A0A8C5R6G2_BMF-01      S-------------MNAMLPCGV-------------------------TE
A0A7N5JI49_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C0TVZ9_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A3Q2HR24_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C0RSS3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q2HR24_BMF-06      S-------------QGVMLPCGV-------------------------TE
A0A7N5JI49_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C6R2L6_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K5KGP2_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A337ST43_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A0N8EUV8_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C0TVZ9_BMF-04      S-------------QGVMLPCGV-------------------------TE
A0A4W3JXA1_BMF-01      L-------------AEPSLPGGV-------------------------GA
A0A3Q2HR24_BMF-04      S-------------QGVMLPCGV-------------------------TE
A0A2K5VLA3_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A673TA87_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8D2HTN1_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A668TQU8_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A8B9LSW6_BMF-01      R-------------TNGMLPCGI-------------------------SE
A0A671M0H4_BMF-02      S-------------PSGMLPCRV-------------------------HV
A0A3Q2CXC4_BMF-02      P-------------HNVMLPCGV-------------------------VE
A0A672JWL9_BMF-02      C-------------PSGMLPCRV-------------------------HV
A0A3P8NFE2_BMF-02      P-------------NNGMLPCGV-------------------------AE
A0A673HDR4_BMF-01      S-------------PSGMLPCRV-------------------------HV
A0A8C7G467_BMF-02      L-------------PNNMLPCGV-------------------------AQ
W5N4P7_BMF-01          H-------------GDNMLPCGV-------------------------GA
A0A8C4SHZ6_BMF-02      S-------------YSSMLPYGV-------------------------QE
A0A8C9VER0_BMF-01      H-------------RFSMLPCGV-------------------------AH
A0A8C4C2E0_BMF-02      L-------------GNGMLPFGL-------------------------AE
A0A3B3RH63_BMF-01      Q-------------GLNMLPCGV-------------------------GQ
W5UAU7_BMF-01          R-------------LNGMLPCGV-------------------------AE
Q0GKC7_BMF-01          S-------------RNGMLLCRH-------------------------LQ
A0A8C7XJP0_BMF-02      P-------------NNGMLLCGL-------------------------AE
A0A3Q2PJX9_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A9J7Y9L1_BMF-01      S-------------PSVMLPCRV---------------------------
A0A3Q2YCX7_BMF-02      S-------------NNGMLPCGV-------------------------AE
A0A673YQV3_BMF-01      L-------------PNNMLPCGV-------------------------AQ
A0A9J7Y9L1_BMF-03      S-------------PSVMLPCRV---------------------------
A0A3P8UA78_BMF-01      L-------------NNGMLPCGV-------------------------GE
A0A3Q2CXC4_BMF-01      P-------------HNVMLPCGV-------------------------VE
A0A4W4DZH9_BMF-01      R-------------PNGMLPCGV-------------------------SE
A0A6F9BGV6_BMF-01      L-------------PNDMLPCGV-------------------------AQ
A0A3P9K487_BMF-02      P-------------NNGMLLCGL-------------------------SE
A0A2U9CJH3_BMF-01      L-------------NNGMLPCGV-------------------------AE
A0A8C2DDJ7_BMF-02      S-------------PNSMLPCRV-------------------------HV
A0A8C7XJP0_BMF-01      P-------------NNGMLLCGL-------------------------AE
A0A9J7Y9L1_BMF-02      S-------------PSVMLPCRV---------------------------
A0A3P9ICE1_BMF-01      P-------------NNGMLLCGL-------------------------AE
A0A3Q3RVI2_BMF-01      L-------------NNGMLPCGV-------------------------AE
A0A8C4C2E0_BMF-01      L-------------GNGMLPFGL-------------------------AE
A0A3Q3VLX6_BMF-01      P-------------YSGMLPCGV-------------------------AE
A0A3B5B8F6_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A8C6U3U8_BMF-01      P-------------SKGMLPFGV-------------------------AE
A0A8C1XUF5_BMF-01      S-------------PSVMLPCRV---------------------------
A0A8C6PNJ4_BMF-01      P-------------HSGMLPCGV-------------------------LQ
A0A8K9UY13_BMF-01      L-------------PNDMLPCGV-------------------------AQ
A0A674EF64_BMF-01      L-------------PNDMLPCGV-------------------------AQ
A0A3B4B6Y3_BMF-01      P-------------NKGMLPCGV-------------------------AE
A0A8C4DD37_BMF-02      P-------------YNGMLPCGV-------------------------AE
A0A672HG10_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A6F9B4C5_BMF-01      L-------------PNSMVPCGV-------------------------AQ
A0A8C7JEQ7_BMF-02      SEGHGIMVP-QGHNNNNNFPCGVQDNHQ----------------------
A0A3B4UNJ0_BMF-01      AVTAA---------------------------------------------
A0A672RK14_BMF-01      SVRNGDMAPFQGLEGDASSPCRAVDARTAFGVNCGTGGLASLTMAPGASE
A0A3Q1FVH7_BMF-02      P-------------NNGMLPCGV-------------------------AE
A0A8B9MY06_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8B9FZ48_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3Q1D1K3_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A3Q1IPR4_BMF-01      Q-------------NNGMLPCGV-------------------------AE
A0A493T7X1_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A803SZ00_BMF-03      S-------------QDVMLPCGV-------------------------TE
A0A2K5E1Q4_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K5E1Q4_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A663DZQ4_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3P8NFE2_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A3B1K1X5_BMF-01      R-------------TNGMLPCGI-------------------------SE
A0A8C0CL26_BMF-01      S-------------QGVMLPCGV-------------------------TE
L8IXF5_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A8C0EML4_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C3KIN9_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C0JZ72_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C0PT40_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C0TVZ9_BMF-05      S-------------QGVMLPCGV-------------------------TE
A0A452F2E0_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C0XK68_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C3WX89_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C3VHE5_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A286XXB0_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A286XXB0_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A286XXB0_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K5RN49_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K5RN49_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K5MJW4_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K5MJW4_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C0GH19_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A8C3XI05_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A0D9R4R5_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C3P5Z9_BMF-02      T-------------QDVMLPCGV-------------------------TE
A0A8C3LTE5_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C3EY31_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C3EY31_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C2MZN7_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C2MZN7_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A7M4FPU2_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C3QVS1_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A9J7Z5T7_BMF-01      S-------------PDSMLPCRV-------------------------HV
A0A9J7Z5T7_BMF-02      S-------------PDSMLPCRV-------------------------HV
A0A9J7Z5T7_BMF-03      S-------------PDSMLPCRV-------------------------HV
A0A8C1P2N8_BMF-02      S-------------PSVMLPCRV---------------------------
A0A8C1UAR1_BMF-02      S-------------PDSMLPCRV-------------------------HV
A0A8C4DD37_BMF-01      P-------------YNGMLPCGV-------------------------AE
A0A8C4J3Z9_BMF-03      S-------------QDVMLPCGV-------------------------TE
A0A8C4J3Z9_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A665VG08_BMF-01      P-------------NNGMLPCGI-------------------------AK
A0A8C4MCB2_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C4SHZ6_BMF-01      S-------------YSSMLPYGV-------------------------QE
A0A3P8ZIE7_BMF-01      L-------------LNDMLPCRL-------------------------DQ
A0A337ST43_BMF-03      S-------------QGVMLPCGV-------------------------TE
U3JS06_BMF-01          S-------------QDVMLPCGV-------------------------TE
A0A3Q2PJX9_BMF-03      P-------------NNGMLPCGV-------------------------AE
A9XRG9_BMF-01          S-------------QDVMLPCGV-------------------------TE
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A2I2Z168_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2I2Z168_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C5HAH2_BMF-01      --------------HSGMLPCGV-------------------------AE
A0A0N8EUV8_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A0N8EUV8_BMF-04      S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-03          S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-06          S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      L-------------RNNMLPCG----------------------------
A0A4W5N721_BMF-01      L-------------PNNMLPCGV-------------------------AQ
A0A287CXH0_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C5K765_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C5K765_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C5IIR3_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3Q2ZA20_BMF-01      P-------------HSGMLPCGV-------------------------AE
A0A3Q3GUU5_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A4W6DUL1_BMF-01      L-------------NNGMLPCGV-------------------------EE
A0A8C5R6G2_BMF-02      S-------------MNAMLPCGV-------------------------TE
A0A667H967_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K5VLA3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K5VLA3_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A5F7ZML1_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A5F7ZML1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q3RVI2_BMF-02      L-------------NNGMLPCGV-------------------------AE
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C5UXV9_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C5UXV9_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A5F8GKJ8_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C6B0J8_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q3QZ16_BMF-02      P-------------NNSMLPCGV-------------------------AE
A0A8C6CWP8_BMF-01      S-------------QGVMLPCGV-------------------------TE
Q91ZE9_BMF-06          S-------------QGVMLPCGV-------------------------TE
Q91ZE9_BMF-01          S-------------QGVMLPCGV-------------------------TE
Q91ZE9_BMF-02          S-------------QGVMLPCGV-------------------------TE
M3YAD5_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A667YNR9_BMF-01      L-------------ANGMLPCGV-------------------------AE
A0A8C6VCH5_BMF-03      S-------------QDIMLPCGV-------------------------TE
A0A8C6VCH5_BMF-02      S-------------QDIMLPCGV-------------------------TE
A0A8C6R2L6_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A3Q4G1I4_BMF-01      P-------------NNGMLPCGV-------------------------AE
U6CSY8_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A2I3HD83_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C6Z034_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C7FH91_BMF-01      L-------------PNDMLPCGV-------------------------AQ
A0A8C7G467_BMF-01      L-------------PNNMLPCGV-------------------------AQ
A0A8C7JEQ7_BMF-01      SEGHGIMVP-QGHNNNNNFPCGVQDNHQ----------------------
A0A8C7RCY3_BMF-01      L-------------PNNMLPCGV-------------------------AQ
A0A8C7SCN2_BMF-01      SEGHDIMVP-QGHSN-NNFPCGVEDNHQ----------------------
A0A8K9UY13_BMF-02      L-------------PNDMLPCGV-------------------------AQ
A0A8C8CQZ6_BMF-01      L-------------PNDMLPCGV-------------------------AQ
A0A8C8F9Y2_BMF-02      L-------------PNNMLPCGV-------------------------AQ
A0A8C8F9Y2_BMF-01      L-------------PNNMLPCGV-------------------------AQ
A0A8C8FNK5_BMF-01      SEGHDIMVP-QGHNNNNNFPCGVQDNHQ----------------------
I3K2D6_BMF-01          P-------------NNGMLPCGV-------------------------AE
G1SR62_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A3B3HAU1_BMF-01      P-------------NNGMLLCGL-------------------------AE
A0A3B3HAU1_BMF-04      P-------------NNGMLLCGL-------------------------AE
A0A3P9ICE1_BMF-04      P-------------NNGMLLCGL-------------------------AE
A0A3P9K487_BMF-01      P-------------NNGMLLCGL-------------------------SE
A0A3B3CGR9_BMF-01      P-------------NNGMLLCGL-------------------------AE
H0WYH6_BMF-01          S-------------QGVMLPCGV-------------------------TE
W5QFV1_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A8C8WD49_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C9IYS3_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A096NTE9_BMF-01      S-------------QGVMLPCGV-------------------------TE
K7FRX2_BMF-01          T-------------QDVMLPCGV-------------------------TE
A0A8C8RL12_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A6I9LHF8_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C9LTX9_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0AA35JSQ3_BMF-04      S-------------QDVMLPCGV-------------------------TE
A0A670JUU6_BMF-05      S-------------QDVMLPCGV-------------------------TE
A0A670JUU6_BMF-03      S-------------QDVMLPCGV-------------------------TE
A0A096LRV0_BMF-01      L-------------HNGMLPCGV-------------------------AE
A0A3P9Q8E2_BMF-01      L-------------HNGMLPCGV-------------------------AE
A0A6D2XBX1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C8ZAV1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K6FFN3_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K6FFN3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3B4CNJ8_BMF-01      R-------------PNGMLPCGV-------------------------SE
A0A8I6GLK7_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8I6GLK7_BMF-01      S-------------QGVMLPCGV-------------------------TE
Q8K589_BMF-01          S-------------QGVMLPCGV-------------------------TE
A0A671DWL6_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K6RAW1_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K6TW78_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K6TW78_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8D0CFD0_BMF-01      R-------------QDVMLPCGV-------------------------TE
A0A8C9XRX5_BMF-01      L-------------NNGMLPCGV-------------------------AE
A0A7N4PJP2_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8D2AYP3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8D3CAL2_BMF-01      L-------------NNGMLPCGV-------------------------AE
A0A8C9NB87_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3B4U5H8_BMF-01      L-------------NNGMLPCGV-------------------------AK
A0A3B4WM88_BMF-01      L-------------NNGMLPCGV-------------------------AK
A0A671MNR9_BMF-01      S-------------PSGMLPCRV-------------------------NV
A0A672JWL9_BMF-01      C-------------PSGMLPCRV-------------------------HV
A0A671X848_BMF-01      L-------------YNGMLPCGV-------------------------AE
A0A8C9UST6_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A673C8N3_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A8D0LCG8_BMF-01      I-------------QDVMLPYGV-------------------------ME
A0A672V891_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A287BML0_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A287BML0_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8D0WCZ8_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A674GIP8_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A674GIP8_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3B5KWG6_BMF-02      P-------------HSGMLPCGV-------------------------AE
A0A3B5KWG6_BMF-01      P-------------HSGMLPCGV-------------------------AE
A0A3B5KWG6_BMF-03      P-------------HSGMLPCGV-------------------------AE
A0A674IPL3_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A452SED0_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A4X2KLG2_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3B5QK08_BMF-02      L-------------HNGMLPCGV-------------------------VE
A0A8D2PG36_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3Q1FVH7_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A8C0AW70_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C3KIN9_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C4XVG9_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3P8RKY9_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A8B9VI07_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8B9BPF5_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8B9EVW2_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C3GPS7_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3Q3C5V2_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A3P9DPJ5_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A3P9DPJ5_BMF-02      P-------------NNGMLPCGV-------------------------AE
A0A3B4ETH0_BMF-01      P-------------NNGMLPCGV-------------------------AE
A0A8B9LSW6_BMF-02      R-------------TNGMLPCGI-------------------------SE
A0A8C8B299_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8D0FU29_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C0JZ72_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C0RSS3_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C0TVZ9_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8I3PRV2_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C0TVZ9_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8I3PRV2_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8I3PRV2_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A452F2E0_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K6B5F6_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A2K5Z4A9_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K5KGP2_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K6B5F6_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K6B5F6_BMF-04      S-------------QGVMLPCGV-------------------------TE
A0A2K6B5F6_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2K5Z4A9_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K6L919_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2K6L919_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A2K6RAW1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8D2E2Z1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C3P5Z9_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A669PL85_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C5THT3_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8C2TYD3_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C3N153_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A3P8UA78_BMF-03      L-------------NNGMLPCGV-------------------------GE
A0A3P8UA78_BMF-02      L-------------NNGMLPCGV-------------------------GE
A0A8C1P2N8_BMF-03      S-------------PSVMLPCRV---------------------------
A0A8C1P2N8_BMF-01      S-------------PSVMLPCRV---------------------------
A0A3Q2PJX9_BMF-02      P-------------NNGMLPCGV-------------------------AE
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      T-------------QDVMLPCGV-------------------------TE
A0A2R9BS98_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2J8QDD5_BMF-02      S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-05          S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-07          S-------------QGVMLPCGV-------------------------TE
A0A2R9BS98_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A2J8QDD5_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q2YCX7_BMF-01      S-------------NNGMLPCGV-------------------------AE
Q96LC9_BMF-01          S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-02          S-------------QGVMLPCGV-------------------------TE
Q96LC9_BMF-04          S-------------QGVMLPCGV-------------------------TE
A0A8C6A5T3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8D2HTN1_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C5IIR3_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8D2MHD7_BMF-01      S-------------QDVMLPCGV-------------------------TE
A0A8D2MHD7_BMF-02      S-------------QDVMLPCGV-------------------------TE
A0A8C8WD49_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C9IYS3_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A5F7ZML1_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A8C5UXV9_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A8C9BKQ1_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A2U4BC98_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3Q3QZ16_BMF-01      P-------------NNSMLPCGV-------------------------AE
A0A8C6GZK8_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8C6GZK8_BMF-03      S-------------QGVMLPCGV-------------------------TE
A0A670XMZ5_BMF-01      S-------------QDIMLPCGV-------------------------TE
A0A3B3HAU1_BMF-02      P-------------NNGMLLCGL-------------------------AE
A0A3B3HAU1_BMF-03      P-------------NNGMLLCGL-------------------------AE
A0A3P9ICE1_BMF-03      P-------------NNGMLLCGL-------------------------AE
A0A3P9ICE1_BMF-05      P-------------NNGMLLCGL-------------------------AE
A0A3P9ICE1_BMF-02      P-------------NNGMLLCGL-------------------------AE
A0A3B3WU80_BMF-01      L-------------HNGMLPCGV-------------------------AE
A0A2K6TW78_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A671M0H4_BMF-01      S-------------PSGMLPCRV-------------------------HV
A0A8D0WCZ8_BMF-02      S-------------QGVMLPCGV-------------------------TE
A0A8D0WCZ8_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A384D070_BMF-01      S-------------QGVMLPCGV-------------------------TE
A0A3B5QK08_BMF-01      L-------------HNGMLPCGV-------------------------VE
                                                                         

A0A8C9QDA0_BMF-01      EPQRLFY-------------GRCSYLG--AKP-PSV-H-H----AGPW--
A0A673JJ10_BMF-01      GPRALFH-------------GNAGFRS--HFP-ALF-E-P----VPDS--
A0A803SZ00_BMF-01      EPQRLFY-------------GNAGYRL--HVSPIGF-S-L----NPH---
A0AA35JSQ3_BMF-05      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A8B9NX34_BMF-02      EPRRLFY-------------GNAGYRL--HAPPVGF-A-L----DPH---
A0A670JUU6_BMF-02      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A493T7X1_BMF-01      EPRRLFY-------------ASAEQKS--SVV-AAF-S-L----STQ---
A0A670JUU6_BMF-01      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A8C2TYD3_BMF-03      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8B9VI07_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A670JUU6_BMF-04      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A8C0U4T1_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A8C5ST95_BMF-01      EPQRLFY-------------GNAGYRL--HVQPIGF-T-L----NPH---
A0A803SZ00_BMF-02      EPQRLFY-------------GNAGYRL--HVSPIGF-S-L----NPH---
A0A8C9F3R5_BMF-01      --------------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A337ST43_BMF-02      EPQRLFY-------------APAK-------PPSSV-V-A----DSP---
A0A337ST43_BMF-04      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8B9NX34_BMF-01      EPRRLFY-------------GNAGYRL--HAPPVGF-A-L----DPH---
A0A803JQ26_BMF-01      TPQRLFY-------------ASTEPKS--V-LVSDL-N-L----LPQ---
A0A674GIP8_BMF-03      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A8B9VI07_BMF-03      --------------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C4J3Z9_BMF-02      EPRRLFY-------------GNAGYRL--HVPSVGF-A-L----DPH---
A0A8C6JG54_BMF-02      EPRRLFY-------------GNAGYRL--HIPPADF-A-L----DPH---
A0A8B9MY06_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A663MPI8_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C9F3R5_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C4J3Z9_BMF-04      EPRRLFY-------------GNAGYRL--HVPSVGF-A-L----DPH---
A0A8C2TYD3_BMF-04      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0AA35JSQ3_BMF-01      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A8C6VCH5_BMF-01      EPQRLFY-------------GNAGYRL--HVQPIGF-T-L----NPH---
A0A6I8NF73_BMF-01      EPRRLFY-------------GHAGYRL--SS-LTSF-P-G----DPS---
A0A8D2L6A0_BMF-01      EPQRLFY-------------GNAGYRL--HVNPIGF-S-L----NPH---
A0A669PL85_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C2TYD3_BMF-05      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A3KND0_BMF-01          TPQRLFY-------------GKEA--------------------------
A0A8C2TYD3_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C1UAR1_BMF-01      EPRRFLY-------------GNAGLLL---LASLGR-S-R----PPHV--
A0A8I3W4Q3_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A3Q2HR24_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
G1PAU1_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
A0A8C2DDJ7_BMF-01      EPRRFLY-------------GNAGLLLLASLG-RSR-P-P----HVV---
A0A8C0PT40_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8I3W4Q3_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C0RSS3_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C2SHH9_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0PT40_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K6L919_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A096NTE9_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A337ST43_BMF-05      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A7N5JI49_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A0N8EUV8_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C2VBL6_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8I3W4Q3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A803JQ26_BMF-02      TPQRLFY-------------GHAGYLL--YLP-QNS-P-A----R-----
A0A8D2HTN1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A287CXH0_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0XK68_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLV---
A0A3Q2HR24_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
G3T7Z4_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A671DWL6_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C6GZK8_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
A0A3Q2HR24_BMF-05      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C5R6G2_BMF-01      SPQRLFY-------------GNAGYML--QHP-ARS-P-S----L-----
A0A7N5JI49_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0TVZ9_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A3Q2HR24_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0RSS3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A3Q2HR24_BMF-06      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A7N5JI49_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C6R2L6_BMF-01      EPQRLFY-------------GNAGYRL--PLP-TSF-P-A----GLP---
A0A2K5KGP2_BMF-01      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A337ST43_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A0N8EUV8_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0TVZ9_BMF-04      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A4W3JXA1_BMF-01      HPRRLFY-------------GNAGYRL--GSP-EVF-E-VPRSSGLP---
A0A3Q2HR24_BMF-04      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K5VLA3_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A673TA87_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8D2HTN1_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A668TQU8_BMF-01      EPRPLFY-------------GECYCTD--LTP-ARR-Q-E----IAE---
A0A8B9LSW6_BMF-01      EPRRLFY-------------GSAGLLL--LAP-SARSE-R----VGDA--
A0A671M0H4_BMF-02      EPTRFLY-------------GNAGLLL--LAS-PSR-S-Q----PPDV--
A0A3Q2CXC4_BMF-02      EPRPLFY-------------RNAGFRL--HFP-AHF-E-L----VGDF--
A0A672JWL9_BMF-02      EPRRFLY-------------GNTGLLL--LAP-PSR-S-R----PPDV--
A0A3P8NFE2_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDHRA
A0A673HDR4_BMF-01      EPRRFLY-------------GNTGLLL--LAP-PSR-S-R----PPDV--
A0A8C7G467_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
W5N4P7_BMF-01          EPRRLFY-------------GNAAFRL--HFP-AHF-E-Q----GGD---
A0A8C4SHZ6_BMF-02      EPSYLFY-------------GTAAHRL--HFP-AHF-E-V----DRDG--
A0A8C9VER0_BMF-01      EPRRLFY-------------GNAGFRL--HFP-AHF-E-R----ARN---
A0A8C4C2E0_BMF-02      EPRRLFH-------------GNAAFRL--HFP-AHF-E-R----VGEA--
A0A3B3RH63_BMF-01      EPRRLFY-------------GSAGLRL--HFP-ALS---V----PGGH--
W5UAU7_BMF-01          EPRRLFY-------------GSAGLLL--LTP-SAR-TNR----VEDA--
Q0GKC7_BMF-01          QHGHFLY-------------GNAELLV--LAA-SSR-A-Q----PPDV--
A0A8C7XJP0_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3Q2PJX9_BMF-01      EPRQLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
A0A9J7Y9L1_BMF-01      -PTRLFY-------------GSAGLLL--LAP-PSR-S-Q----PPDV--
A0A3Q2YCX7_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGEQ--
A0A673YQV3_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A9J7Y9L1_BMF-03      -PTRLFY-------------GSAGLLL--LAP-PSR-S-Q----PPDV--
A0A3P8UA78_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----IGDR--
A0A3Q2CXC4_BMF-01      EPRPLFY-------------RNAGFRL--HFP-AHF-E-L----VGDF--
A0A4W4DZH9_BMF-01      EPRRLFY-------------GSAGLLL--LAP-PAR-PNS----ADDA--
A0A6F9BGV6_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-Q----VGDQ--
A0A3P9K487_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A2U9CJH3_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----FGDQ--
A0A8C2DDJ7_BMF-02      EPRRFLY-------------GNAGLLL--LAS-LGR-S-R----PPHV--
A0A8C7XJP0_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A9J7Y9L1_BMF-02      -PTRLFY-------------GSAGLLL--LAP-PSR-S-Q----PPDV--
A0A3P9ICE1_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3Q3RVI2_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A8C4C2E0_BMF-01      EPRRLFH-------------GNAAFRL--HFP-AHF-E-R----VGEA--
A0A3Q3VLX6_BMF-01      EPRHLFY-------------VTSSLA-----P-D----------------
A0A3B5B8F6_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----IGDH--
A0A8C6U3U8_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VEDQ--
A0A8C1XUF5_BMF-01      -PTRLFY-------------GNAGLLL--LAP-PSR-S-Q----PPDV--
A0A8C6PNJ4_BMF-01      HS----T-------------GNAGFRL--HFP-ARF-E-I----VGDF--
A0A8K9UY13_BMF-01      EPRPLFYVMPSLSWHTTDNAGNAGFRL--HFP-ARF-E-Q----VGDQ--
A0A674EF64_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-Q----VGDQ--
A0A3B4B6Y3_BMF-01      EPRPLFY-------------A-------------HF-E-L----GEDQ--
A0A8C4DD37_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A672HG10_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDH--
A0A6F9B4C5_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A8C7JEQ7_BMF-02      -GRILFH-------------GNAGFRL--HFP-ARF-E-P----MDDR--
A0A3B4UNJ0_BMF-01      -PLILF---------------------------VWW-V-P----HWEL--
A0A672RK14_BMF-01      GPRALFH-------------GNAGFRA--HFP-ALF-E-P----LLDG--
A0A3Q1FVH7_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----IA----
A0A8B9MY06_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8B9FZ48_BMF-01      EPRRLFY-------------GNAGYRL--HIPPADF-A-L----DPH---
A0A3Q1D1K3_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----IGNH--
A0A3Q1IPR4_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDL--
A0A493T7X1_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A803SZ00_BMF-03      EPQRLFY-------------GNAGYRL--HVSPIGF-S-L----NPH---
A0A2K5E1Q4_BMF-02      EPQRLFY-------------ASAEPKS--RVV-AG----------PP---
A0A2K5E1Q4_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A663DZQ4_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A3P8NFE2_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
A0A3B1K1X5_BMF-01      EPRRLFY-------------GSAGLLL--LAP-SAR-SER----VGDA--
A0A8C0CL26_BMF-01      EPQRLFY-------------APAE-------PKSCV-V-A----DPP---
L8IXF5_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0EML4_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C3KIN9_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C0JZ72_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0PT40_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0TVZ9_BMF-05      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A452F2E0_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0XK68_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLV---
A0A8C3WX89_BMF-01      EPQRLFY-------------GNAGYRL--PLP-AGF-P-T----GLP---
A0A8C3VHE5_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A286XXB0_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A286XXB0_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A286XXB0_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K5RN49_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K5RN49_BMF-02      EPQRLFY-------------APAEPKS--RVV-AG----------PP---
A0A2K5MJW4_BMF-01      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A2K5MJW4_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C0GH19_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A8C3XI05_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A0D9R4R5_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C3P5Z9_BMF-02      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A8C3LTE5_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C3EY31_BMF-02      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A8C3EY31_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A8C2MZN7_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C2MZN7_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A7M4FPU2_BMF-01      EPQRLFY-------------GNVGYRL--RVPPVGF-A-L----SPH---
A0A8C3QVS1_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A9J7Z5T7_BMF-01      EPRRFLY-------------GNAGLLL--LAS-LSR-S-R----PPHV--
A0A9J7Z5T7_BMF-02      EPRRFLY-------------GNAGLLLLASLS-RSR-P-P----HVV---
A0A9J7Z5T7_BMF-03      EPRRFLY-------------GNAGLLL---LASLSR-S-R----PPHV--
A0A8C1P2N8_BMF-02      -PTRLFY-------------GSAGLLL--LAP-PSR-S-Q----PPDV--
A0A8C1UAR1_BMF-02      EPRRFLY-------------GNAGLLL--LAS-LGR-S-R----PPHV--
A0A8C4DD37_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A8C4J3Z9_BMF-03      EPRRLFY-------------GNAGYRL--HVPSVGF-A-L----DPH---
A0A8C4J3Z9_BMF-01      EPRRLFY-------------GNAGYRL--HVPSVGF-A-L----DPH---
A0A665VG08_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AQF-E-L----AGDQ--
A0A8C4MCB2_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C4SHZ6_BMF-01      EPSYLFY-------------GTAAHRL--HFP-AHF-E-V----DRDG--
A0A3P8ZIE7_BMF-01      DPRPLFY-------------GNAGFRL--HFP-AQF-E-C----VGDP--
A0A337ST43_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
U3JS06_BMF-01          EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A3Q2PJX9_BMF-03      EPRQLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
A9XRG9_BMF-01          EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A9XRH0_BMF-01          ---------------------NAGYRL--HVPPVGF-A-L----DPN---
A0A452H3N6_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A2I2Z168_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2I2Z168_BMF-02      EPQRLFY-------------APAEPKS--CVV-AD----------PP---
A0A8C5HAH2_BMF-01      EPRSLFH-------------GNAGFRL--HFP-AHF-E-L----VGEH--
A0A0N8EUV8_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A0N8EUV8_BMF-04      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
Q96LC9_BMF-03          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
Q96LC9_BMF-06          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-Q----VGDQ--
A0A4W5N721_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A287CXH0_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C5K765_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-T----GLP---
A0A8C5K765_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-T----GLP---
A0A8C5IIR3_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPQ---
A0A3Q2ZA20_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----IRDL--
A0A3Q3GUU5_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ANF-E-L----VGDQ--
A0A4W6DUL1_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----AGNQ--
A0A8C5R6G2_BMF-02      SPQRLFY-------------GNAGYML--QHP-ARS-P-S----L-----
A0A667H967_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K5VLA3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K5VLA3_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A5F7ZML1_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A5F7ZML1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A3Q3RVI2_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A803YBD7_BMF-01      KPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C6JG54_BMF-01      EPRRLFY-------------GNAGYRL--HIPPADF-A-L----DPH---
A0A8C5UXV9_BMF-03      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A8C5UXV9_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A5F8GKJ8_BMF-01      EPHRLFY-------------GNAGYRL--PLP-ASF-P-A----SLR---
A0A8C6B0J8_BMF-01      EPQRLFY-------------GNAGYRL--PLP-AGF-P-A----GLP---
A0A3Q3QZ16_BMF-02      DPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A8C6CWP8_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
Q91ZE9_BMF-06          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
Q91ZE9_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
Q91ZE9_BMF-02          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
M3YAD5_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A667YNR9_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A8C6VCH5_BMF-03      EPQRLFY-------------GNAGYRL--HVQPIGF-T-L----NPH---
A0A8C6VCH5_BMF-02      EPQRLFY-------------GNAGYRL--HVQPIGF-T-L----NPH---
A0A8C6R2L6_BMF-02      EPQRLFY-------------GNAGYRL--PLP-TSF-P-A----GLP---
A0A3Q4G1I4_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
U6CSY8_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2I3HD83_BMF-01      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A8C6Z034_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPR---
A0A8C7FH91_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-Q----VGDQ--
A0A8C7G467_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A8C7JEQ7_BMF-01      -GRILFH-------------GNAGFRL--HFP-ARF-E-P----MDDR--
A0A8C7RCY3_BMF-01      EPRLLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A8C7SCN2_BMF-01      -SRILFH-------------GNAGFRL--HFP-ARF-E-P----MDDR--
A0A8K9UY13_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-Q----VGDQ--
A0A8C8CQZ6_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-Q----VGDR--
A0A8C8F9Y2_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A8C8F9Y2_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AQF-E-R----VGDQ--
A0A8C8FNK5_BMF-01      -GRILFH-------------GNAGFRL--HFP-ARF-E-P----MDDR--
I3K2D6_BMF-01          EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
G1SR62_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----NFA---
A0A3B3HAU1_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3B3HAU1_BMF-04      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3P9ICE1_BMF-04      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3P9K487_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3B3CGR9_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
H0WYH6_BMF-01          EPQRLFY-------------GNVGYRL--PLP-ASF-P-A----GLP---
W5QFV1_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C8WD49_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C9IYS3_BMF-02      EPQRLFY-------------APAK-------PPSSV-V-A----DSP---
A0A096NTE9_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
K7FRX2_BMF-01          EPQRLFY-------------GNAGYRL--HEPPVGF-A-L----NPH---
A0A8C8RL12_BMF-01      EPQRLFY-------------GNAGYRL--HAPPVGF-A-L----NPH---
A0A6I9LHF8_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C9LTX9_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0AA35JSQ3_BMF-04      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A670JUU6_BMF-05      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A670JUU6_BMF-03      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----SPH---
A0A096LRV0_BMF-01      EPRRLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
A0A3P9Q8E2_BMF-01      EPRRLFY-------------GNAGFRL--HFP-AHF-E-L----VRDF--
A0A6D2XBX1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C8ZAV1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K6FFN3_BMF-02      EPQRLFY-------------APAEPKS--HVV-AD----------PP---
A0A2K6FFN3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A3B4CNJ8_BMF-01      EPRRLFY-------------GSAGLLL--LAP-SVR-PEH----VEGA--
A0A8I6GLK7_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSA---
A0A8I6GLK7_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSA---
Q8K589_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSA---
A0A671DWL6_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K6RAW1_BMF-02      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A2K6TW78_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6TW78_BMF-03      EPQRLFY-------------APAEPKS--CVV-AG----------PP---
A0A8D0CFD0_BMF-01      EPQRLFY-------------GNAGFRL--HVNPIGF-S-L----NPH---
A0A8C9XRX5_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A7N4PJP2_BMF-01      EPHRLFY-------------GNAGYRL--PLP-ANF-P-S----SLR---
A0A8D2AYP3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8D3CAL2_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----FGDQ--
A0A8C9NB87_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A3B4U5H8_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A3B4WM88_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A671MNR9_BMF-01      EPRRFLY-------------GNTGLLL--LAP-PSR-S-R----PPDV--
A0A672JWL9_BMF-01      EPRRFLY-------------GNTGLLL--LAP-PSR-S-R----PPDV--
A0A671X848_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A8C9UST6_BMF-01      EPQRLFY-------------GSAGYRL--PLP-ASF-P-A----GLP---
A0A673C8N3_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----FGDP--
A0A8D0LCG8_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVVF-A-S----NPH---
A0A672V891_BMF-01      EPRRLFY-------------GNAGYRL--HIPPVGF-A-L----DPH---
A0A287BML0_BMF-01      EPQRLFY-------------GNAGYRL--PLP-AGF-P-A----GLP---
A0A287BML0_BMF-02      EPQRLFY-------------G------------------------LP---
A0A8D0WCZ8_BMF-03      EPQRLFY-------------GNAGYRL--PLP-AGF-P-A----GLP---
A0A674GIP8_BMF-02      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A674GIP8_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A3B5KWG6_BMF-02      EPRLLFY-------------GNAGFRL--HFP-ARF-E-V----LGDR--
A0A3B5KWG6_BMF-01      EPRLLFY-------------GNAGFRL--HFP-ARF-E-V----LGDR--
A0A3B5KWG6_BMF-03      EPRLLFY-------------GNAGFRL--HFP-ARF-E-V----LGDR--
A0A674IPL3_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A452SED0_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A4X2KLG2_BMF-01      EPHRLFY-------------GNAGYRL--PLP-ANF-P-V----SLR---
A0A3B5QK08_BMF-02      EPRRLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
A0A8D2PG36_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A3Q1FVH7_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----IA----
A0A8C0AW70_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C3KIN9_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C4XVG9_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A3P8RKY9_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----IGNH--
A0A8B9VI07_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8B9BPF5_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8B9EVW2_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C3GPS7_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A3Q3C5V2_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
A0A3P9DPJ5_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
A0A3P9DPJ5_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
A0A3B4ETH0_BMF-01      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----VGDH--
A0A8B9LSW6_BMF-02      EPRRLFY-------------GSAGLLL--LAP-SAR-SER----VGDA--
A0A8C8B299_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8D0FU29_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPH---
A0A8C0JZ72_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0RSS3_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0TVZ9_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8I3PRV2_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C0TVZ9_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8I3PRV2_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8I3PRV2_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A452F2E0_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A2K6B5F6_BMF-03      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A2K5Z4A9_BMF-02      EPQRLFY-------------APAEPKS--RVV-AD----------PP---
A0A2K5KGP2_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6B5F6_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6B5F6_BMF-04      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6B5F6_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K5Z4A9_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6L919_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6L919_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2K6RAW1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8D2E2Z1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C3P5Z9_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A669PL85_BMF-01      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C5THT3_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A8C2TYD3_BMF-02      EPRRLFY-------------GNAGYRL--HVPPVGF-A-L----DPN---
A0A8C3N153_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPH---
A0A3P8UA78_BMF-03      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----IGDR--
A0A3P8UA78_BMF-02      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----IGDR--
A0A8C1P2N8_BMF-03      -PTRLFY-------------GSAGLLL--LAP-PSR-S-Q----PPDV--
A0A8C1P2N8_BMF-01      -PTRLFY-------------GSAGLLL--LAP-PSR-S-Q----PPDV--
A0A3Q2PJX9_BMF-02      EPRQLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
A0A803YBD7_BMF-02      ---------------------NAGYRL--HVPPVGF-A-L----DPN---
A0A8C4W1J6_BMF-01      EPQRLFY-------------GNAGYRL--HVPPVGF-A-L----NPH---
A0A2R9BS98_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A2J8QDD5_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
Q96LC9_BMF-05          EPQRLFY-------------APAEPKS--CVV-AD----------PP---
Q96LC9_BMF-07          EPQRLFY-------------APAEPKS--CVV-AD----------PP---
A0A2R9BS98_BMF-02      EPQRLFY-------------APAEPKS--CVV-AD----------PP---
A0A2J8QDD5_BMF-01      EPQRLFY-------------APAEPKS--CVV-AD----------PP---
A0A3Q2YCX7_BMF-01      EPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGEQ--
Q96LC9_BMF-01          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
Q96LC9_BMF-02          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
Q96LC9_BMF-04          EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C6A5T3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8D2HTN1_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C5IIR3_BMF-02      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPQ---
A0A8D2MHD7_BMF-01      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPQ---
A0A8D2MHD7_BMF-02      EPRRLFY-------------GSAGYRL--HVPPAGF-V-L----DPQ---
A0A8C8WD49_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C9IYS3_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A5F7ZML1_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A8C5UXV9_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A8C9BKQ1_BMF-01      EPQRLFY-------------GNAGYRL--PLP-AGF-P-A----GLP---
A0A2U4BC98_BMF-01      EPQRLFY-------------GNAGYRL--PLP-AGF-P-A----GLP---
A0A3Q3QZ16_BMF-01      DPRPLFY-------------GNAGFRL--HFP-AHF-E-L----VGDQ--
A0A8C6GZK8_BMF-02      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
A0A8C6GZK8_BMF-03      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GSP---
A0A670XMZ5_BMF-01      EPQRLFY-------------GNAGYRL--HVQPIGF-T-L----NPH---
A0A3B3HAU1_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3B3HAU1_BMF-03      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3P9ICE1_BMF-03      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3P9ICE1_BMF-05      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3P9ICE1_BMF-02      EPRPLFY-------------GNAGFRL--HFP-ARF-E-L----AGDL--
A0A3B3WU80_BMF-01      EPRRLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
A0A2K6TW78_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----VLP---
A0A671M0H4_BMF-01      EPTRFLY-------------GNAGLLL--LAS-PSR-S-Q----PPDV--
A0A8D0WCZ8_BMF-02      EPQRLFY-------------GNAGYRL--PLP-AGF-P-A----GLP---
A0A8D0WCZ8_BMF-01      EPQRLFY-------------G------------------------LP---
A0A384D070_BMF-01      EPQRLFY-------------GNAGYRL--PLP-ASF-P-A----GLP---
A0A3B5QK08_BMF-01      EPRRLFY-------------GNAGFRL--HFP-AHF-E-L----VGDF--
                                                                         

A0A8C9QDA0_BMF-01      ---RRALAS-RLGG-RDSLLESP----------RC-VCV--C-VCVCVC-
A0A673JJ10_BMF-01      ---TQNAE----ED-GGTPEEKE----------DE-RDV--G-ISVEIQ-
A0A803SZ00_BMF-01      ----FQ--------------EEP----------QE-SPQ--E-LRTEVQ-
A0AA35JSQ3_BMF-05      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A8B9NX34_BMF-02      ----LQ--------------EEP----------QE-GQR--E-AHVEVQ-
A0A670JUU6_BMF-02      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A493T7X1_BMF-01      ----LG--------------LKR----------GG-EQE--P-HWAEVS-
A0A670JUU6_BMF-01      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A8C2TYD3_BMF-03      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8B9VI07_BMF-02      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A670JUU6_BMF-04      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A8C0U4T1_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C5ST95_BMF-01      ----LQ--------------EEP----------QE-SLQ--E-LRTEVQ-
A0A803SZ00_BMF-02      ----FQ--------------EEP----------QE-SPQ--E-LRTEVQ-
A0A8C9F3R5_BMF-01      ----LQ--------------EEP----------QE-GQQ--E-ARTEVQ-
A0A337ST43_BMF-02      ----LP--------------TQP----------GF------E-CRREQE-
A0A337ST43_BMF-04      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A8B9NX34_BMF-01      ----LQ--------------EEP----------QE-GQR--E-AHVEVQ-
A0A803JQ26_BMF-01      ----LG--------------N-----------------------------
A0A674GIP8_BMF-03      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8B9VI07_BMF-03      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A8C4J3Z9_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C6JG54_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8B9MY06_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A663MPI8_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARAEVQ-
A0A8C9F3R5_BMF-02      ----LQ--------------EEP----------QE-GQQ--E-ARTEVQ-
A0A8C4J3Z9_BMF-04      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C2TYD3_BMF-04      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0AA35JSQ3_BMF-01      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A8C6VCH5_BMF-01      ----LQ--------------EEP----------QE-SLQ--E-LRTEVQ-
A0A6I8NF73_BMF-01      ----LG--------------EEP----------PE-APW--E-RRPEMQ-
A0A8D2L6A0_BMF-01      ----LQ--------------EET----------RE-SPQ--E-LRTEVQ-
A0A669PL85_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C2TYD3_BMF-05      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A3KND0_BMF-01          --------------------------------------------LSEI--
A0A8C2TYD3_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C1UAR1_BMF-01      ---VLR--------------QNL----------RM-MDP--E-ESVETL-
A0A8I3W4Q3_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A3Q2HR24_BMF-03      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
G1PAU1_BMF-01          ----LG--------------EQP----------PE-GQW--QHHRAEIQ-
A0A8C2DDJ7_BMF-01      ----LR--------------QNL----------RM-MDP--E-ESVETL-
A0A8C0PT40_BMF-02      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8I3W4Q3_BMF-03      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0RSS3_BMF-02      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C2SHH9_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A8C0PT40_BMF-03      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6L919_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A096NTE9_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A337ST43_BMF-05      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A7N5JI49_BMF-01      ----LG--------------EQP----------PE-GPW--Q-HRAEVQ-
A0A0N8EUV8_BMF-02      ----HG--------------ERP----------PE-GQW--Q-DRAEVQ-
A0A8C2VBL6_BMF-01      ----LE--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8I3W4Q3_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A803JQ26_BMF-02      ----FG--------------EEV----------DN-RRQ--E-QSAEHR-
A0A8D2HTN1_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A287CXH0_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0XK68_BMF-01      ----LG--------------EQP----------PE-GQW--P-HRVEVQ-
A0A3Q2HR24_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
G3T7Z4_BMF-01          ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A671DWL6_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A8C6GZK8_BMF-01      ----LG--------------EQP----------PE-GQF-LQ-HRAEVQ-
A0A3Q2HR24_BMF-05      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C5R6G2_BMF-01      ----LR--------------DHL----------TR-GRQ--E-QSAERR-
A0A7N5JI49_BMF-03      ----LG--------------EQP----------PE-GPW--Q-HRAEVQ-
A0A8C0TVZ9_BMF-03      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A3Q2HR24_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0RSS3_BMF-01      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A3Q2HR24_BMF-06      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A7N5JI49_BMF-02      ----LG--------------EQP----------PE-GPW--Q-HRAEVQ-
A0A8C6R2L6_BMF-01      ----LG--------------EQA----------PE-GQW--Q-HRAEVQ-
A0A2K5KGP2_BMF-01      ----LP--------------AQP-----------C-FEW--R-REQERGG
A0A337ST43_BMF-01      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A0N8EUV8_BMF-03      ----HG--------------ERP----------PE-GQW--Q-DRAEVQ-
A0A8C0TVZ9_BMF-04      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A4W3JXA1_BMF-01      ----HQ--G--------RGDGMP----------ME-LQP--E-DRVEVG-
A0A3Q2HR24_BMF-04      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K5VLA3_BMF-03      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A673TA87_BMF-01      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A8D2HTN1_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A668TQU8_BMF-01      -------------Q-QNSMERLP----------RQ-QPA--A-RSVEAC-
A0A8B9LSW6_BMF-01      ---MFRE------E-HRAVE--P----------RR-R-P--A-HSVEAR-
A0A671M0H4_BMF-02      ---VLRQ------D-LRMMD--P----------AV-ARP--E-RSVETL-
A0A3Q2CXC4_BMF-02      ---DVRRQ----AE-HNRMEQLP----------LQ-QPA--A-LSLEAC-
A0A672JWL9_BMF-02      ---VLRQ------N-LRM------------------MDP--A-ESVETL-
A0A3P8NFE2_BMF-02      SRQGSTE------Q-QNSMERLP----------RQ-RPA--A-RSVEAC-
A0A673HDR4_BMF-01      ---VLRQ------N-LRM------------------MDP--A-ESVETL-
A0A8C7G467_BMF-02      ---GPLG------E-RGGMERLN----------RQPQLP--A-RSIEVC-
W5N4P7_BMF-01          ----EEEET-G----------EA----------EE-QP---V-RSAEVR-
A0A8C4SHZ6_BMF-02      ---DTEEGM-A----------EE----------EQ-EP---G-LSAEAQ-
A0A8C9VER0_BMF-01      ----PEQGQ-R-----N----RP----------EH-HP---R-PSAEVR-
A0A8C4C2E0_BMF-02      ---MPEDQQ-G----------QA-------D--RH-HQ---W-PSVEAQ-
A0A3B3RH63_BMF-01      ---PPQE------------ERQP----------DD-RP---Q-PSAEVR-
W5UAU7_BMF-01          ---MFPE-------------NRP----------RR-RP---A-HSVEAQ-
Q0GKC7_BMF-01          ---VLRQNV-S------PM-ERP----------EP-RP---A-QSVETL-
A0A8C7XJP0_BMF-02      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3Q2PJX9_BMF-01      ---DARRQ----EE-QNRMEPLP----------LH-QPA--A-LSLEAC-
A0A9J7Y9L1_BMF-01      ---VLRQNL-R------MM-E-P----------AA-RP---E-RSVETL-
A0A3Q2YCX7_BMF-02      ---EERLQE-SDDGMEQQLQQQQ----------QQ-QPV--A-RSIEAC-
A0A673YQV3_BMF-01      ---GPLGE---RGE-RGGMERLN----------QQPQQP--A-RSIEIC-
A0A9J7Y9L1_BMF-03      ---VLRQNL-R------MM--EP----------AA-RP---E-RSVETL-
A0A3P8UA78_BMF-01      ---ETRRRQ-SDEE-RNRMEPRPQQQQQQQRQQQQ-QPV--Q-RSVEVR-
A0A3Q2CXC4_BMF-01      ---DVRRQ----AE-HNRMEQLP----------LQ-QPA--A-LSLEAC-
A0A4W4DZH9_BMF-01      ---MLPENQ-L------AV-EPP----------RR-RP---L-HSVEAS-
A0A6F9BGV6_BMF-01      ---GPQER--HQGE-RGRMERLQ----------QQPQQP--A-QSMEVC-
A0A3P9K487_BMF-02      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A2U9CJH3_BMF-01      ---EVRGHE-SEEE-RSGMEQLP----------RQQQPV--A-HSVEAC-
A0A8C2DDJ7_BMF-02      ---VLRQNL-R------M----------------M-DP---E-ESVETL-
A0A8C7XJP0_BMF-01      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A9J7Y9L1_BMF-02      ---VLRQNL-R------MM--EP----------AA-RP---E-RSVETL-
A0A3P9ICE1_BMF-01      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3Q3RVI2_BMF-01      ---EVRQQE-REEE-QNRMEQLP----------RQ-QPL--V-HSVEAC-
A0A8C4C2E0_BMF-01      ---MPEDQQ-G--Q----A---D----------RH-HQ---W-PSVEAQ-
A0A3Q3VLX6_BMF-01      ------SRD-NCRE-RNGMERLP----------RQ-QPV--A-HSVEAC-
A0A3B5B8F6_BMF-01      ---QARQQQGSEME-QNGMEQLP----------RQ-QPV--A-RSVEAC-
A0A8C6U3U8_BMF-01      ---ETSGPL-QDGEMQNGVDQPP----------RQ-LPA--A-HSVEAC-
A0A8C1XUF5_BMF-01      ---VLRQNL-R------MM-E-P----------AA-RP---E-RSVETL-
A0A8C6PNJ4_BMF-01      ---EARQQD-REEE-PNRMER---------------PPA--A-RSLEVC-
A0A8K9UY13_BMF-01      ---GPQEQ--HQVE-RGRMERLQ----------QQPQQP--A-RSMEVC-
A0A674EF64_BMF-01      ---GPQEQ--HQGE-RGRMERLL-------------QQP--V-QSMEVC-
A0A3B4B6Y3_BMF-01      ---EASESL-QEGEMQNGREPLP----------RH-PVA--V-RSMEAC-
A0A8C4DD37_BMF-02      ---EARRQE-SEGE-HNGMEQLP----------RQ-QPV--A-RSVEAC-
A0A672HG10_BMF-01      ---RVRRRE-SEEQ-QNGMDQLP----------RQ-RPA--A-QSVEAC-
A0A6F9B4C5_BMF-01      ---GPQ------GE-RGGMERLE----------QQPQQP--A-RSIEVY-
A0A8C7JEQ7_BMF-02      ---GERRNE-EEEE-RRRMEERP----------EE-ERV--E-DSAEAR-
A0A3B4UNJ0_BMF-01      ---S--PST-KMNM-L-RFSENR----------PE-EQA--G-VSVEAQ-
A0A672RK14_BMF-01      ---T--QNA-EEDE-G-RPEEKE----------DE-RDV--G-ISVEIQ-
A0A3Q1FVH7_BMF-02      ------RQQGSEME-QNGMEQLP----------RQ-QPM--A-HSVEAC-
A0A8B9MY06_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8B9FZ48_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A3Q1D1K3_BMF-01      ---QARQ-QGSEME-QNGMEQLP----------RQ-QPV--A-RSMEAC-
A0A3Q1IPR4_BMF-01      ---EVRQQ-DSEEE-QNGMEIPP----------RQ-QPL--M-QSVEAC-
A0A493T7X1_BMF-02      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A803SZ00_BMF-03      ----FQ--------------EEP----------QE-SPQ--E-LRTEVQ-
A0A2K5E1Q4_BMF-02      ----LS--------------AQP-----------G-FEW--R-REQEWGR
A0A2K5E1Q4_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A663DZQ4_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A3P8NFE2_BMF-01      ---RASRQG-STEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
A0A3B1K1X5_BMF-01      ---MFREEH-R------AV-EP-----------RR-RP---A-HSVEAR-
A0A8C0CL26_BMF-01      ----LS--------------AQP----------RC------E-W-REQE-
L8IXF5_BMF-01          ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A8C0EML4_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARAEVQ-
A0A8C3KIN9_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C0JZ72_BMF-02      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0PT40_BMF-01      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0TVZ9_BMF-05      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A452F2E0_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A8C0XK68_BMF-02      ----LG--------------EQP----------PE-GQW--P-HRVEVQ-
A0A8C3WX89_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C3VHE5_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A286XXB0_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A286XXB0_BMF-03      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A286XXB0_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K5RN49_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K5RN49_BMF-02      ----LP--------------AQP-----------G-FEW--R-REQEWGR
A0A2K5MJW4_BMF-01      ----LP--------------AQP-----------C-FEW--R-REQERGG
A0A2K5MJW4_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0GH19_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C3XI05_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARAEVQ-
A0A0D9R4R5_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C3P5Z9_BMF-02      ----LQ--------------EEP----------RE-GQR--E-ARTEVQ-
A0A8C3LTE5_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C3EY31_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C3EY31_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C2MZN7_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C2MZN7_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A7M4FPU2_BMF-01      ----LQ--------------EEH----------QE-GHQ--E-VRAEVQ-
A0A8C3QVS1_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A9J7Z5T7_BMF-01      ---VLRQNL-R------M----------------M-DP---E-ESVETL-
A0A9J7Z5T7_BMF-02      ----LR--------------QNL----------RM-MDP--E-ESVETL-
A0A9J7Z5T7_BMF-03      ---VLR--------------QNL----------RM-MDP--E-ESVETL-
A0A8C1P2N8_BMF-02      ---VLRQNL-R------MM--EP----------AA-RP---E-RSVETL-
A0A8C1UAR1_BMF-02      ---VLRQNL-R------M----------------M-DP---E-ESVETL-
A0A8C4DD37_BMF-01      ---EARRQE-SEGE-HNGMEQLP----------RQ-QPV--A-RSVEAC-
A0A8C4J3Z9_BMF-03      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C4J3Z9_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A665VG08_BMF-01      ---EVRG-QGSEEE-QNGMEQLP----------RQ-QPV--A-RSIEVC-
A0A8C4MCB2_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C4SHZ6_BMF-01      ---DTEEGM-A----------EE----------EQ-EP---G-LSAEAQ-
A0A3P8ZIE7_BMF-01      ---GPQQR--PQAV-RGGMEHPQ-------------QLP--Q-QPVARC-
A0A337ST43_BMF-03      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
U3JS06_BMF-01          ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A3Q2PJX9_BMF-03      ---DARRQE----E-QNRMEPLP----------LH-QPA--A-LSLEAC-
A9XRG9_BMF-01          ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A9XRH0_BMF-01          ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A452H3N6_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ALAEVQ-
A0A2I2Z168_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2I2Z168_BMF-02      ----LP--------------AQP-----------C-FEW--R-REQERGR
A0A8C5HAH2_BMF-01      ---QSSPPE-SEEQ-RNTMEHLP----------RR-PSV--A-HSVEAR-
A0A0N8EUV8_BMF-01      ----HG--------------ERP----------PE-GQW--Q-DRAEVQ-
A0A0N8EUV8_BMF-04      ----HG--------------ERP----------PE-GQW--Q-DRAEVQ-
Q96LC9_BMF-03          ----IG--------------EQP----------PE-GQW--Q-HQAEVQ-
Q96LC9_BMF-06          ----IG--------------EQP----------PE-GQW--Q-HQAE---
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      ---GPHEQ--HQGE-RGRMEWLQ----------QQPQQP--A-HSMEVC-
A0A4W5N721_BMF-01      ---GPLGE-------RGGMERLD----------QQPQLP--A-RSIEVC-
A0A287CXH0_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C5K765_BMF-01      ----LE--------------EQP----------PE-GQW--P-HRAEVQ-
A0A8C5K765_BMF-02      ----LE--------------EQP----------PE-GQW--P-HRAEVQ-
A0A8C5IIR3_BMF-01      ----LQ--------------EDP----------QE-GQR--E-ARAEVQ-
A0A3Q2ZA20_BMF-01      ---EARQQD-REEE-PNRMERLP----------RQ-LPV--A-RSLEVC-
A0A3Q3GUU5_BMF-01      ---EESGQE-SELQ-QIGMEQ-------------Q-QPV--A-HSVEAS-
A0A4W6DUL1_BMF-01      ---EARRQE-SEEE-RNGMEQLP-----------QRQPV--A-RSVEAC-
A0A8C5R6G2_BMF-02      ----LR--------------DHL----------TR-GRQ--E-QSAERR-
A0A667H967_BMF-01      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A2K5VLA3_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K5VLA3_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A5F7ZML1_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A5F7ZML1_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A3Q3RVI2_BMF-02      ---EVRQQE-REEE-QNRMEQLP----------RQ-QPL--V-HSVEAC-
A0A803YBD7_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C6JG54_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C5UXV9_BMF-03      ----LP--------------TQP-----------R-FER--R-REQERGG
A0A8C5UXV9_BMF-02      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A5F8GKJ8_BMF-01      ----LG--------------EEP----------PE-EQW--E-HRAEVQ-
A0A8C6B0J8_BMF-01      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A3Q3QZ16_BMF-02      ---EARRQE-D----QNGMEHLP----------RQ-QRV--A-RSVEAC-
A0A8C6CWP8_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
Q91ZE9_BMF-06          ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
Q91ZE9_BMF-01          ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
Q91ZE9_BMF-02          ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
M3YAD5_BMF-01          ----LG--------------DQP----------PE-GQW--Q-HRAEVQ-
A0A667YNR9_BMF-01      ---EARQQE-REEE-QNGMEQRP----------RQ-QPV--A-RSVEAR-
A0A8C6VCH5_BMF-03      ----LQ--------------EEP----------QE-SLQ--E-LRTEVQ-
A0A8C6VCH5_BMF-02      ----LQ--------------EEP----------QE-SLQ--E-LRTEVQ-
A0A8C6R2L6_BMF-02      ----LG--------------EQA----------PE-GQW--Q-HRAEVQ-
A0A3Q4G1I4_BMF-01      ---RASRQG-STEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
U6CSY8_BMF-01          ----LG--------------DQP----------PE-GQW--Q-HRAEVQ-
A0A2I3HD83_BMF-01      ----LP--------------AQP-----------C-FEW--R-REQEWGR
A0A8C6Z034_BMF-01      ----LQ--------------EQP----------QE-AQR--E-ARAEVQ-
A0A8C7FH91_BMF-01      ---GPQEQ--HQVE-RGRMERLQ----------QQPQQP--A-QSMEVC-
A0A8C7G467_BMF-01      ---GPLGE-------RGGMERLN----------RQPQLP--A-RSIEVC-
A0A8C7JEQ7_BMF-01      ---GERRNE-EEEE-RRRMEERP----------EE-ERV--E-DSAEAR-
A0A8C7RCY3_BMF-01      ---GPLGE-------RGGMERLN----------RQPQLP--A-RSIEVC-
A0A8C7SCN2_BMF-01      ---GERRRE-DEER-RRRMEERP----------EE-ERV--E-DSAEAR-
A0A8K9UY13_BMF-02      ---GPQEQ--HQVE-RGRMERLQ----------QQPQQP--A-RSMEVC-
A0A8C8CQZ6_BMF-01      ---GPQEQ--HQVE-RGRMERLQ----------QQPQQP--A-QSMEVC-
A0A8C8F9Y2_BMF-02      ---GPLG------E-RGGMERLN----------RQPQLP--A-RSIEVC-
A0A8C8F9Y2_BMF-01      ---GPLGE-------RGGMERLN----------RQPQLP--A-RSIEVC-
A0A8C8FNK5_BMF-01      ---GERRNE-E--E-RRRMEERP----------EE-ERV--E-DSAEAR-
I3K2D6_BMF-01          ---RARRQE-IAEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
G1SR62_BMF-01          ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A3B3HAU1_BMF-01      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3B3HAU1_BMF-04      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3P9ICE1_BMF-04      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3P9K487_BMF-01      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3B3CGR9_BMF-01      ---EARRHD-REAE-RGGMERLP----------RQ-QPA--A-RSTEAC-
H0WYH6_BMF-01          ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
W5QFV1_BMF-01          ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A8C8WD49_BMF-02      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A8C9IYS3_BMF-02      ----LP--------------TQP----------GF------E-CRREQE-
A0A096NTE9_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
K7FRX2_BMF-01          ----LQ--------------EEP----------RE-GHQ--E-ARAEVQ-
A0A8C8RL12_BMF-01      ----LQ--------------EEP----------QE-GQR--E-AHAEVQ-
A0A6I9LHF8_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C9LTX9_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0AA35JSQ3_BMF-04      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A670JUU6_BMF-05      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A670JUU6_BMF-03      ----LR--------------EEP----------RE-SPQ--E-LRTEVQ-
A0A096LRV0_BMF-01      ---DARQQE----E-QNRMEQLP----------LH-QPA--A-LSLEAC-
A0A3P9Q8E2_BMF-01      ---DARQQE----E-QNRMEQLP----------LH-QPA--A-LSLEAC-
A0A6D2XBX1_BMF-01      ----TG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C8ZAV1_BMF-01      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A2K6FFN3_BMF-02      ----LP--------------TQP-----------C-FER--R-REQERGR
A0A2K6FFN3_BMF-01      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A3B4CNJ8_BMF-01      ---MLQEDQ-L------AM-EP-----------RR-RP---P-HSVEAR-
A0A8I6GLK7_BMF-02      ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
A0A8I6GLK7_BMF-01      ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
Q8K589_BMF-01          ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
A0A671DWL6_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A2K6RAW1_BMF-02      ----LP--------------AQP-----------C-FEW--R-RE-----
A0A2K6TW78_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6TW78_BMF-03      ----LP--------------AQP-----------G-FEW--R-RKQEWGR
A0A8D0CFD0_BMF-01      ----LQ--------------EEP----------QE-SPQ--E-LHTEVQ-
A0A8C9XRX5_BMF-01      ---EARGQE-SEGE-QNGMEQLP----------H-QQPV--A-RSVEAC-
A0A7N4PJP2_BMF-01      ----LG--------------AEP----------PE-EQW--E-HRAEVQ-
A0A8D2AYP3_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8D3CAL2_BMF-01      ---EVRGHE-SEEE-RSGMEQLP----------RQQQPV--A-HSVEAC-
A0A8C9NB87_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARAEVQ-
A0A3B4U5H8_BMF-01      ---EARRQG-SGEE-RNGMEQLP----------RQ-QPV--A-RSVEAC-
A0A3B4WM88_BMF-01      ---EARRQG-SGEE-RNGMEQLP----------RQ-QPV--A-RSVEAC-
A0A671MNR9_BMF-01      ---VLRQNL-R------M----------------M-DP---A-ESVETL-
A0A672JWL9_BMF-01      ---VLRQNL-R------M----------------M-DP---A-ESVETL-
A0A671X848_BMF-01      ---EARRQD-SGGE-QSGMEQLP----------RP-QPV--A-RSVEAC-
A0A8C9UST6_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A673C8N3_BMF-01      ---VRRQVS-EEEE-QNGMEQLP----------RQ-QPM--A-RSVEAC-
A0A8D0LCG8_BMF-01      ----LQ--------------EEP----------RE-GHR--E-LRTEVQ-
A0A672V891_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A287BML0_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A287BML0_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8D0WCZ8_BMF-03      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A674GIP8_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A674GIP8_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A3B5KWG6_BMF-02      ---GVRRRD-TGGA-PNGMEPLP-----------QHGPV--V-RSTEAC-
A0A3B5KWG6_BMF-01      ---GVRRRD-TGGA-PNGMEPLP-----------QQGPV--V-RSTEAC-
A0A3B5KWG6_BMF-03      ---GVRRRD-TGGA-PNGMEPLP----------QQ-GPV--V-RSTEAC-
A0A674IPL3_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARTEVQ-
A0A452SED0_BMF-01      ----LG--------------EQP----------PE-GPW--Q-HRAEVQ-
A0A4X2KLG2_BMF-01      ----LG--------------EEP----------PQ-EQW--E-HRTEVQ-
A0A3B5QK08_BMF-02      ---DARQQE----E-QNRMEQLP----------LH-QPA--A-LSLEAS-
A0A8D2PG36_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARVEVQ-
A0A3Q1FVH7_BMF-01      ------RQQGSEME-QNGMEQLP----------RQ-QPM--A-HSVEAC-
A0A8C0AW70_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C3KIN9_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C4XVG9_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A3P8RKY9_BMF-01      ---QARQ-QGSEME-QNGMEQLP----------RQ-QPV--A-RSMEAC-
A0A8B9VI07_BMF-01      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A8B9BPF5_BMF-01      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A8B9EVW2_BMF-01      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A8C3GPS7_BMF-01      ----LQ--------------EEP----------QE-GQQ--E-ARAEVQ-
A0A3Q3C5V2_BMF-01      ---RASRQG-STEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
A0A3P9DPJ5_BMF-01      ---RASRQG-STEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
A0A3P9DPJ5_BMF-02      ---RASRQG-STEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
A0A3B4ETH0_BMF-01      ---RASRQG-STEQ-QNSMERLP----------RQ-RPA--A-RSVEAC-
A0A8B9LSW6_BMF-02      ---MFREEH-R------AV-EP-----------RR-RP---A-HSVEAR-
A0A8C8B299_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARAEVQ-
A0A8D0FU29_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARAEVQ-
A0A8C0JZ72_BMF-01      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0RSS3_BMF-03      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0TVZ9_BMF-02      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8I3PRV2_BMF-03      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C0TVZ9_BMF-01      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8I3PRV2_BMF-02      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8I3PRV2_BMF-01      ----LL--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A452F2E0_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEIQ-
A0A2K6B5F6_BMF-03      ----LP--------------AQP-----------C-FEW--R-REQERGG
A0A2K5Z4A9_BMF-02      ----LP--------------AQP-----------C-FEW--R-REQERGG
A0A2K5KGP2_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6B5F6_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6B5F6_BMF-04      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6B5F6_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K5Z4A9_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6L919_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6L919_BMF-03      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2K6RAW1_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8D2E2Z1_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C3P5Z9_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ARTEVQ-
A0A669PL85_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C5THT3_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A8C2TYD3_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C3N153_BMF-01      ----LQ--------------EEP----------QE-GQR--E-ARAEVQ-
A0A3P8UA78_BMF-03      ---ETRRRQ-SDEE-RNRMEPRPQQQQQQQRQQQQ-QPV--Q-RSVEVR-
A0A3P8UA78_BMF-02      ---ETRRRQ-SDEE-RNRMEPRPQQQQQQQRQQQQ-QPV--Q-RSVEVR-
A0A8C1P2N8_BMF-03      ---VLRQNL-R------MM-E-P----------AA-RP---E-RSVETL-
A0A8C1P2N8_BMF-01      ---VLRQNL-R------MM--EP----------AA-RP---E-RSVETL-
A0A3Q2PJX9_BMF-02      ---DARRQE----E-QNRMEPLP----------LH-QPA--A-LSLEAC-
A0A803YBD7_BMF-02      ----LQ--------------EEP----------QE-GQR--E-ARTEVQ-
A0A8C4W1J6_BMF-01      ----LQ--------------EEP----------RE-GQR--E-ALAEVQ-
A0A2R9BS98_BMF-01      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A2J8QDD5_BMF-02      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
Q96LC9_BMF-05          ----LP--------------AQP-----------C-FEW--R-REQERGR
Q96LC9_BMF-07          ----LP--------------AQP-----------C-FEW--R-REQERGR
A0A2R9BS98_BMF-02      ----LP--------------AQP-----------C-FEW--R-REQERGR
A0A2J8QDD5_BMF-01      ----LP--------------AQP-----------C-FEW--R-REQERGR
A0A3Q2YCX7_BMF-01      ---EERLQE-SDDGMEQQLQQQQ----------QQ-QPV--A-RSIEAC-
Q96LC9_BMF-01          ----IG--------------EQP----------PE-GQW--Q-HQAEVQ-
Q96LC9_BMF-02          ----IG--------------EQP----------PE-GQW--Q-HQAEVQ-
Q96LC9_BMF-04          ----IG--------------EQP----------PE-GQW--Q-HQAEVQ-
A0A8C6A5T3_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8D2HTN1_BMF-03      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C5IIR3_BMF-02      ----LQ--------------EDP----------QE-GQR--E-ARAEVQ-
A0A8D2MHD7_BMF-01      ----LQ--------------EDP----------QE-GQR--E-ARAEVQ-
A0A8D2MHD7_BMF-02      ----LQ--------------EDP----------QE-GQR--E-ARAEVQ-
A0A8C8WD49_BMF-01      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A8C9IYS3_BMF-01      ----LG--------------EQP----------PE-GHW--Q-HRAEVQ-
A0A5F7ZML1_BMF-03      ----IG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8C5UXV9_BMF-01      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A8C9BKQ1_BMF-01      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A2U4BC98_BMF-01      ----LG--------------EQP----------AE-GQW--Q-HRAEVQ-
A0A3Q3QZ16_BMF-01      ---EARRQE-D----QNGMEHLP----------RQ-QRV--A-RSVEAC-
A0A8C6GZK8_BMF-02      ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
A0A8C6GZK8_BMF-03      ----LG--------------EQP----------PE-GQFL-Q-HRAEVQ-
A0A670XMZ5_BMF-01      ----LQ--------------EEP----------QE-SLQ--E-LRTEVQ-
A0A3B3HAU1_BMF-02      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3B3HAU1_BMF-03      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3P9ICE1_BMF-03      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3P9ICE1_BMF-05      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3P9ICE1_BMF-02      ---EVRRHD-REAE-RRGMERLP----------RQ-QPV--A-RSTEAC-
A0A3B3WU80_BMF-01      ---DARQQE----E-QNRMEQLP----------LH-QPA--A-LSLEAC-
A0A2K6TW78_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A671M0H4_BMF-01      ---VLRQ------D-LRMMD--P----------AV-ARP--E-RSVETL-
A0A8D0WCZ8_BMF-02      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A8D0WCZ8_BMF-01      ----LG--------------EQP----------PE-GQW--Q-HRAEVQ-
A0A384D070_BMF-01      ----LG--------------EQP----------PE-GPW--Q-HRAEVQ-
A0A3B5QK08_BMF-01      ---DARQQE----E-QNRMEQLP----------LH-QPA--A-LSLEAS-
                                                                         

A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      IGR---KLR-EMGDQFQQEHLQ-----------------LV---------
A0A803SZ00_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0AA35JSQ3_BMF-05      IAR---KLQ-CIADQFHRLHLQ-----------------RV---------
A0A8B9NX34_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------RL---------
A0A670JUU6_BMF-02      IAR---KLQ-CIADQFHRLHLQ-----------------RI---------
A0A493T7X1_BMF-01      FTH---LFQ-ATSSLQGALNKH-----------------WF---------
A0A670JUU6_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A8C2TYD3_BMF-03      IAR---KLQ-CIADQFHRLHIQ-----------------RD---------
A0A8B9VI07_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RV---------
A0A670JUU6_BMF-04      IAR---KLQ-CIADQFHRLHLQ-----------------RI---------
A0A8C0U4T1_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RL---------
A0A8C5ST95_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RI---------
A0A803SZ00_BMF-02      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A8C9F3R5_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A337ST43_BMF-02      WGRSQVRLG-CPPRMGHH--------------------------------
A0A337ST43_BMF-04      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8B9NX34_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------RH---------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      IAR---KLQ-CIADQFHRLHIQ-----------------RV---------
A0A8B9VI07_BMF-03      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C4J3Z9_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------RG---------
A0A8C6JG54_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RV---------
A0A8B9MY06_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A663MPI8_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C9F3R5_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RV---------
A0A8C4J3Z9_BMF-04      IAR---KLQ-CIADQFHRLHVQ-----------------RH---------
A0A8C2TYD3_BMF-04      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0AA35JSQ3_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A8C6VCH5_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RHLLWTIEGSA
A0A6I8NF73_BMF-01      VAR---KLQ-CIADQFHRLHTQ-----------------RH---------
A0A8D2L6A0_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A669PL85_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RV---------
A0A8C2TYD3_BMF-05      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A3KND0_BMF-01          -YR---MFNASIPHESHRFHR-----------------------------
A0A8C2TYD3_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C1UAR1_BMF-01      IGQ---KLQ-LIGDQFYQEHMM-----------------SS---------
A0A8I3W4Q3_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QE---------
A0A3Q2HR24_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
G1PAU1_BMF-01          IAR---KLQ-SIADQFHRLQMQ-----------------QH---------
A0A8C2DDJ7_BMF-01      IGQ---KLQ-LIGDQFYQEHMM-----------------KQ---------
A0A8C0PT40_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8I3W4Q3_BMF-03      IAR---KLQ-CIADQFHRLHVQ-----------------QL---------
A0A8C0RSS3_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C2SHH9_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0PT40_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QV---------
A0A2K6L919_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A096NTE9_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QT---------
A0A337ST43_BMF-05      IAR---KLQ-CIADQFHRLHMQ-----------------QV---------
A0A7N5JI49_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A0N8EUV8_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C2VBL6_BMF-01      IAR---KLR-CIADQFHRLHMQ-----------------QR---------
A0A8I3W4Q3_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A803JQ26_BMF-02      IAR---KLQ-CIGDQFHRFHLQ-----------------RV---------
A0A8D2HTN1_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A287CXH0_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0XK68_BMF-01      IAR---KLR-CIADQFHRLHVQ-----------------QR---------
A0A3Q2HR24_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
G3T7Z4_BMF-01          IAR---KLQ-CIADHFHRLHMQ-----------------RH---------
A0A671DWL6_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C6GZK8_BMF-01      IAR---KLQ-CIADQFHRLHTQ-----------------QH---------
A0A3Q2HR24_BMF-05      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C5R6G2_BMF-01      IAR---KLQ-CIGDQFHRLHLQ-----------------KL---------
A0A7N5JI49_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0TVZ9_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A3Q2HR24_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0RSS3_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A3Q2HR24_BMF-06      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A7N5JI49_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C6R2L6_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QY---------
A0A2K5KGP2_BMF-01      PQV---RLG-CPLHMGHQEHRQ-----------------EG---------
A0A337ST43_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A0N8EUV8_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0TVZ9_BMF-04      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A4W3JXA1_BMF-01      IGR---KLQ-QIGDQFHSSCME-----------------RH---------
A0A3Q2HR24_BMF-04      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A2K5VLA3_BMF-03      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A673TA87_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8D2HTN1_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A668TQU8_BMF-01      IGQ---KLQ-LIGDQFHWERLQ-----------------LV---------
A0A8B9LSW6_BMF-01      IGQ---KLQ-MIGDQFYQEHML-----------------DG---------
A0A671M0H4_BMF-02      IGQ---KLQ-LIGDQFYQEHMM-----------------VS---------
A0A3Q2CXC4_BMF-02      IGQ---KLQ-IIGDQFHREHLQ-----------------QI---------
A0A672JWL9_BMF-02      IGQ---KLQ-LIGDQFYQDAPL-----------------HK---------
A0A3P8NFE2_BMF-02      IGQ---KLQ-LIGDQFHWERLQ-----------------LV---------
A0A673HDR4_BMF-01      IGQ---KLQ-LIGDQFYQEHMM-----------------VT---------
A0A8C7G467_BMF-02      IGQ---KLQ-LIGDQFHQEHLQ-----------------VV---------
W5N4P7_BMF-01          IGQ---KLQ-RIGDQFHRDYLH-----------------MY---------
A0A8C4SHZ6_BMF-02      IGQ---KLQ-RIGDQFHRDYTQ-----------------ML---------
A0A8C9VER0_BMF-01      IGQ---KLQ-VIGDQFHQDQVE-----------------LY---------
A0A8C4C2E0_BMF-02      IGQ---KLQ-MIGDQFHQEHVQ-----------------QH---------
A0A3B3RH63_BMF-01      IGQ---KLQ-MIGDQFHQDQLQ-----------------LY---------
W5UAU7_BMF-01          IGQ---KLQ-MIGDQFYQEHML------------------Q---------
Q0GKC7_BMF-01          IGQ---KLQ-LIGDQFYQEHIM------------------H---------
A0A8C7XJP0_BMF-02      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3Q2PJX9_BMF-01      IGQ---KLQ-LIGDQFHREHLQQRGSFRSSLAAGEVGKPMY---------
A0A9J7Y9L1_BMF-01      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A3Q2YCX7_BMF-02      VGQ---KLQ-LIGDQFHREHLQ-----------------LV---------
A0A673YQV3_BMF-01      IGQ---KLQ-LIGDQFHQEHVQ-----------------VY---------
A0A9J7Y9L1_BMF-03      IGQ---KLQ-LIGDQFYQEHMM-----------------DT---------
A0A3P8UA78_BMF-01      IGQ---KLQ-LIGDQFHRDHLQ-----------------LY---------
A0A3Q2CXC4_BMF-01      IGQ---KLQ-IIGDQFHREHLQ-----------------QY---------
A0A4W4DZH9_BMF-01      IGQ---KLQ-MIGDQFYQEHML------------------Q---------
A0A6F9BGV6_BMF-01      IGQ---KLQ-LIGDQFHQEHLQ-----------------LY---------
A0A3P9K487_BMF-02      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A2U9CJH3_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C2DDJ7_BMF-02      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A8C7XJP0_BMF-01      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A9J7Y9L1_BMF-02      IGQ---KLQ-LIGDQFYQEHMM-----------------SS---------
A0A3P9ICE1_BMF-01      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3Q3RVI2_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LQ---------
A0A8C4C2E0_BMF-01      IGQ---KLQ-MIGDQFHQEHVQ-----------------QH---------
A0A3Q3VLX6_BMF-01      IGQ---KLQ-LIGDQFHREHMQ-----------------LY---------
A0A3B5B8F6_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C6U3U8_BMF-01      IGQ---KLQ-LIGDQFHRDHLR-----------------LY---------
A0A8C1XUF5_BMF-01      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A8C6PNJ4_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------QL---------
A0A8K9UY13_BMF-01      IGQ---KLQ-LIGDQFYQEHLQ-----------------LY---------
A0A674EF64_BMF-01      IGQ---KLQ-LIGDQFYQEHLQ-----------------LY---------
A0A3B4B6Y3_BMF-01      IGH---KLQ-LIGDQFHRDHLQ-----------------RV---------
A0A8C4DD37_BMF-02      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A672HG10_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A6F9B4C5_BMF-01      IGQ---KLQ-LIGDQFLQQHLQ-----------------LY---------
A0A8C7JEQ7_BMF-02      IGR---KLR-EIGDQFHQEHVQ-----------------LF---------
A0A3B4UNJ0_BMF-01      IGR---KLR-EIGDKFQQDHF-----------------------------
A0A672RK14_BMF-01      IGR---KLR-EMGDQFQQDHLQ-----------------LV---------
A0A3Q1FVH7_BMF-02      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8B9MY06_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8B9FZ48_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3Q1D1K3_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A3Q1IPR4_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A493T7X1_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A803SZ00_BMF-03      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A2K5E1Q4_BMF-02      PE------------------------------------------------
A0A2K5E1Q4_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A663DZQ4_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3P8NFE2_BMF-01      IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
A0A3B1K1X5_BMF-01      IGQ---KLQ-MIGDQFYQEHML------------------Q---------
A0A8C0CL26_BMF-01      WGRSQ---------------------------------------------
L8IXF5_BMF-01          IAR---KLQ-CIADQFHRLHMQ-----------------QY---------
A0A8C0EML4_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3KIN9_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RV---------
A0A8C0JZ72_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0PT40_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0TVZ9_BMF-05      IAR---KLQ-CIADQFHRLHMQ-----------------QV---------
A0A452F2E0_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0XK68_BMF-02      IAR---KLR-CIADQFHRLHVQ-----------------QR---------
A0A8C3WX89_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C3VHE5_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A286XXB0_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------QH---------
A0A286XXB0_BMF-03      IAR---KLQ-CIADQFHRLHIQ-----------------QH---------
A0A286XXB0_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------QH---------
A0A2K5RN49_BMF-01      IAR---KLQ-CIADQFHQLHVQ-----------------QH---------
A0A2K5RN49_BMF-02      PE------------------------------------------------
A0A2K5MJW4_BMF-01      P-------------------------------------------------
A0A2K5MJW4_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C0GH19_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3XI05_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A0D9R4R5_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C3P5Z9_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3LTE5_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3EY31_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3EY31_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C2MZN7_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------QH---------
A0A8C2MZN7_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------QH---------
A0A7M4FPU2_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------RH---------
A0A8C3QVS1_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A9J7Z5T7_BMF-01      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A9J7Z5T7_BMF-02      IGQ---KLQ-LIGDQFYQEHMM----------------------------
A0A9J7Z5T7_BMF-03      IGQ---KLQ-LIGDQFYQEHMM-----------------SS---------
A0A8C1P2N8_BMF-02      IGQ---KLQ-LIGDQFYQEHMM-----------------SS---------
A0A8C1UAR1_BMF-02      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A8C4DD37_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C4J3Z9_BMF-03      IAR---KLQ-CIADQFHRLHVQ-----------------RH---------
A0A8C4J3Z9_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------RH---------
A0A665VG08_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C4MCB2_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C4SHZ6_BMF-01      IGQ---KLQ-RIGDQFHRDYTQ-----------------ML---------
A0A3P8ZIE7_BMF-01      IGQ---KLQ-LIGDQFHEEHLQ-----------------LY---------
A0A337ST43_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QV---------
U3JS06_BMF-01          IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3Q2PJX9_BMF-03      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A9XRG9_BMF-01          IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A9XRH0_BMF-01          IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A452H3N6_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A2I2Z168_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2I2Z168_BMF-02      P-------------------------------------------------
A0A8C5HAH2_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------RY---------
A0A0N8EUV8_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A0N8EUV8_BMF-04      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
Q96LC9_BMF-03          IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
Q96LC9_BMF-06          ----------------------------------------H---------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      IGQ---KLQ-LIGDQFHQEHLQ-----------------LY---------
A0A4W5N721_BMF-01      IGQ---KLQ-LIGDQFHQEHLQ-----------------VY---------
A0A287CXH0_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C5K765_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------QH---------
A0A8C5K765_BMF-02      IAR---KLQ-CIADQFHRLHLQ-----------------QH---------
A0A8C5IIR3_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3Q2ZA20_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A0A3Q3GUU5_BMF-01      IGL---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A4W6DUL1_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C5R6G2_BMF-02      IAR---KLQ-CIGDQFHRLHLQ-----------------KL---------
A0A667H967_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A2K5VLA3_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K5VLA3_BMF-02      IAR---KLQ-CIADQFHRLHVQ----------------------------
A0A5F7ZML1_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A5F7ZML1_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A3Q3RVI2_BMF-02      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A803YBD7_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C6JG54_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C5UXV9_BMF-03      PQ------------------------------------------------
A0A8C5UXV9_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A5F8GKJ8_BMF-01      IAQ---KLQ-CIADQFHRLHMQ-----------------RH---------
A0A8C6B0J8_BMF-01      IAR---KLQ-RIADQFHRLHMQ-----------------QH---------
A0A3Q3QZ16_BMF-02      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C6CWP8_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
Q91ZE9_BMF-06          IAR---KLQ-CIADQFHRLHTQ-----------------QH---------
Q91ZE9_BMF-01          IAR---KLQ-CIADQFHRLHTQ-----------------QH---------
Q91ZE9_BMF-02          IAR---KLQ-CIADQFHRLHTQ-----------------QH---------
M3YAD5_BMF-01          IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A667YNR9_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C6VCH5_BMF-03      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A8C6VCH5_BMF-02      IAR---KLQ-CIADQFHRLHLQ-----------------RHLLWTIEGSA
A0A8C6R2L6_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QY---------
A0A3Q4G1I4_BMF-01      IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
U6CSY8_BMF-01          IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A2I3HD83_BMF-01      P-------------------------------------------------
A0A8C6Z034_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C7FH91_BMF-01      IGQ---KLQ-LIGDQFYQEHLQ-----------------LY---------
A0A8C7G467_BMF-01      IGQ---KLQ-LIGDQFHQEHLQ-----------------VY---------
A0A8C7JEQ7_BMF-01      IGR---KLR-EIGDQFHQEHVQ-----------------LF---------
A0A8C7RCY3_BMF-01      IGQ---KLQ-LIGDQFHQEHLQ-----------------VY---------
A0A8C7SCN2_BMF-01      IGR---KLR-EIGDQFHQEHVQ-----------------LF---------
A0A8K9UY13_BMF-02      IGQ---KLQ-LIGDQFYQEHLQ-----------------LY---------
A0A8C8CQZ6_BMF-01      IGQ---KLQ-LIGDQFYQEHLQ-----------------LY---------
A0A8C8F9Y2_BMF-02      IGQ---KLQ-LIGDQFHQEHLQ-----------------VV---------
A0A8C8F9Y2_BMF-01      IGQ---KLQ-LIGDQFHQEHLQ-----------------VY---------
A0A8C8FNK5_BMF-01      IGR---KLR-EIGDQFHQEHVQ-----------------LF---------
I3K2D6_BMF-01          IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
G1SR62_BMF-01          IAR---KLQ-CIADQFHRLHLQ-----------------QH---------
A0A3B3HAU1_BMF-01      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3B3HAU1_BMF-04      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3P9ICE1_BMF-04      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3P9K487_BMF-01      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3B3CGR9_BMF-01      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
H0WYH6_BMF-01          IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
W5QFV1_BMF-01          IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C8WD49_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C9IYS3_BMF-02      WGRSQ---------------------------------------------
A0A096NTE9_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
K7FRX2_BMF-01          IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C8RL12_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A6I9LHF8_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------QH---------
A0A8C9LTX9_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0AA35JSQ3_BMF-04      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A670JUU6_BMF-05      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A670JUU6_BMF-03      IAR---KLQ-CIADQFHRLHLQ-----------------R----------
A0A096LRV0_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A0A3P9Q8E2_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A0A6D2XBX1_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C8ZAV1_BMF-01      IAR---KLQ-RIADQFHRLHVQ-----------------QH---------
A0A2K6FFN3_BMF-02      SQ------------------------------------------------
A0A2K6FFN3_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A3B4CNJ8_BMF-01      IGQ---KLQ-MIGDQFYQEHML------------------Q---------
A0A8I6GLK7_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8I6GLK7_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
Q8K589_BMF-01          IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A671DWL6_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6TW78_BMF-03      SE------------------------------------------------
A0A8D0CFD0_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A8C9XRX5_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A7N4PJP2_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------RH---------
A0A8D2AYP3_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8D3CAL2_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C9NB87_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3B4U5H8_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A3B4WM88_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A671MNR9_BMF-01      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A672JWL9_BMF-01      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A671X848_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C9UST6_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A673C8N3_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8D0LCG8_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A672V891_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------RH---------
A0A287BML0_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A287BML0_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8D0WCZ8_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A674GIP8_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------R----------
A0A674GIP8_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3B5KWG6_BMF-02      IGQ---KLQ-LIGDQFHRERVQ-----------------LY---------
A0A3B5KWG6_BMF-01      IGQ---KLQ-LIGDQFHRERVQ-----------------LY---------
A0A3B5KWG6_BMF-03      IGQ---KLQ-LIGDQFHRERVQ-----------------LY---------
A0A674IPL3_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A452SED0_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A4X2KLG2_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------RH---------
A0A3B5QK08_BMF-02      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A0A8D2PG36_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3Q1FVH7_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C0AW70_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3KIN9_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C4XVG9_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3P8RKY9_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8B9VI07_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8B9BPF5_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8B9EVW2_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3GPS7_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3Q3C5V2_BMF-01      IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
A0A3P9DPJ5_BMF-01      IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
A0A3P9DPJ5_BMF-02      IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
A0A3B4ETH0_BMF-01      IGQ---KLQ-LIGDQFHWERLQ-----------------LY---------
A0A8B9LSW6_BMF-02      IGQ---KLQ-MIGDQFYQEHML------------------Q---------
A0A8C8B299_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8D0FU29_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C0JZ72_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0RSS3_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0TVZ9_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8I3PRV2_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C0TVZ9_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8I3PRV2_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8I3PRV2_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A452F2E0_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A2K6B5F6_BMF-03      P-------------------------------------------------
A0A2K5Z4A9_BMF-02      P-------------------------------------------------
A0A2K5KGP2_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6B5F6_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6B5F6_BMF-04      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6B5F6_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K5Z4A9_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6L919_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6L919_BMF-03      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2K6RAW1_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8D2E2Z1_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C3P5Z9_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A669PL85_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C5THT3_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C2TYD3_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C3N153_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A3P8UA78_BMF-03      IGQ---KLQ-LIGDQFHRDHLQ-----------------LY---------
A0A3P8UA78_BMF-02      IGQ---KLQ-LIGDQFHRDHLQ-----------------LY---------
A0A8C1P2N8_BMF-03      IGQ---KLQ-LIGDQFYQEHMM------------------H---------
A0A8C1P2N8_BMF-01      IGQ---KLQ-LIGDQFYQEHMM-----------------DT---------
A0A3Q2PJX9_BMF-02      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A0A803YBD7_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C4W1J6_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A2R9BS98_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A2J8QDD5_BMF-02      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
Q96LC9_BMF-05          P-------------------------------------------------
Q96LC9_BMF-07          P-------------------------------------------------
A0A2R9BS98_BMF-02      P-------------------------------------------------
A0A2J8QDD5_BMF-01      P-------------------------------------------------
A0A3Q2YCX7_BMF-01      VGQ---KLQ-LIGDQFHREHLQ-----------------LV---------
Q96LC9_BMF-01          IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
Q96LC9_BMF-02          IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
Q96LC9_BMF-04          IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C6A5T3_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8D2HTN1_BMF-03      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C5IIR3_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8D2MHD7_BMF-01      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8D2MHD7_BMF-02      IAR---KLQ-CIADQFHRLHIQ-----------------RH---------
A0A8C8WD49_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8C9IYS3_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A5F7ZML1_BMF-03      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C5UXV9_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A8C9BKQ1_BMF-01      IAR---KLQ-RIADQFHRLHMQ-----------------QH---------
A0A2U4BC98_BMF-01      IAR---KLQ-RIADQFHRLHMQ-----------------QH---------
A0A3Q3QZ16_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------LY---------
A0A8C6GZK8_BMF-02      IAR---KLQ-CIADQFHRLHTQ-----------------QH---------
A0A8C6GZK8_BMF-03      IAR---KLQ-CIADQFHRLHTQ-----------------QH---------
A0A670XMZ5_BMF-01      IAR---KLQ-CIADQFHRLHLQ-----------------RH---------
A0A3B3HAU1_BMF-02      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3B3HAU1_BMF-03      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3P9ICE1_BMF-03      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3P9ICE1_BMF-05      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3P9ICE1_BMF-02      IAQ---KLQ-LIGDQFHRERLQ-----------------LY---------
A0A3B3WU80_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
A0A2K6TW78_BMF-01      IAR---KLQ-CIADQFHRLHVQ-----------------QH---------
A0A671M0H4_BMF-01      IGQ---KLQ-LIGDQFYQEHMM-----------------VS---------
A0A8D0WCZ8_BMF-02      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A8D0WCZ8_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A384D070_BMF-01      IAR---KLQ-CIADQFHRLHMQ-----------------QH---------
A0A3B5QK08_BMF-01      IGQ---KLQ-LIGDQFHREHLQ-----------------QY---------
                                                                         

A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      -------------I---------L--I-SDETSFF-S-------S-----
A0A803SZ00_BMF-01      -------------N---------M----------G-L-------L-----
A0AA35JSQ3_BMF-05      -------------G---------C----------L-L-------G-----
A0A8B9NX34_BMF-02      -------------P---------L----------P-K-------A-----
A0A670JUU6_BMF-02      -------------C---------M----------K-D-------L-----
A0A493T7X1_BMF-01      -------------GGETCTPPAGC----------E-DSEILLLVF-----
A0A670JUU6_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C2TYD3_BMF-03      -------------K---------H----------G-V-------L-----
A0A8B9VI07_BMF-02      -------------G---------C----------F-Q-------R-----
A0A670JUU6_BMF-04      -------------C---------M----------K-D-------L-----
A0A8C0U4T1_BMF-01      -------------L---------L----------F-S-------I-----
A0A8C5ST95_BMF-01      -------------L---------K----------S-H----CGDF-----
A0A803SZ00_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C9F3R5_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      -------------Q---------Q----------N-R-------R-----
A0A8B9NX34_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      -------------G---------R----------T-E-------I-----
A0A8B9VI07_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A8C4J3Z9_BMF-02      -------------H---------CLFN-P----GN-C-------V-----
A0A8C6JG54_BMF-02      -------------G---------C----------L-C-------R-----
A0A8B9MY06_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A663MPI8_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C9F3R5_BMF-02      -------------G---------C----------F-Q-------R-----
A0A8C4J3Z9_BMF-04      -------------Q---------Q----------N-R-------N-----
A0A8C2TYD3_BMF-04      -------------Q---------Q----------N-R-------N-----
A0AA35JSQ3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C6VCH5_BMF-01      AAIHNLAVSRYVHQ---------Q----------N-R-------N-----
A0A6I8NF73_BMF-01      -------------Q---------R----------N-R-------N-----
A0A8D2L6A0_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A669PL85_BMF-02      -------------G---------C----------F-L-------R-----
A0A8C2TYD3_BMF-05      -------------Q---------Q----------N-R-------N-----
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C1UAR1_BMF-01      -------------S---------N----------N-R-------L-----
A0A8I3W4Q3_BMF-02      -------------T---------E----------A-W-------------
A0A3Q2HR24_BMF-03      -------------Q---------Q----------N-R-------N-----
G1PAU1_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A8C2DDJ7_BMF-01      -------------A---------C----------S-Q-------I-----
A0A8C0PT40_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8I3W4Q3_BMF-03      -------------N---------K----------W-R-------P-----
A0A8C0RSS3_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8C2SHH9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C0PT40_BMF-03      -------------G---------T----------G-A-------G-----
A0A2K6L919_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A096NTE9_BMF-02      -------------S------------------------------------
A0A337ST43_BMF-05      -------------G---------M----------G-A----WGGG-----
A0A7N5JI49_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A0N8EUV8_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C2VBL6_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8I3W4Q3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A803JQ26_BMF-02      -------------I---------H--------------------------
A0A8D2HTN1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A287CXH0_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C0XK68_BMF-01      -------------Q---------Q----------H-R-------D-----
A0A3Q2HR24_BMF-02      -------------Q---------Q----------N-R-------N-----
G3T7Z4_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A671DWL6_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C6GZK8_BMF-01      -------------Q---------Q----------N-R-------D-----
A0A3Q2HR24_BMF-05      -------------Q---------Q----------N-R-------N-----
A0A8C5R6G2_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A7N5JI49_BMF-03      -------------Q---------Q----------N-Q-------N-----
A0A8C0TVZ9_BMF-03      -------------Q---------Q----------N-Q-------N-----
A0A3Q2HR24_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C0RSS3_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A3Q2HR24_BMF-06      -------------Q---------Q----------N-R-------N-----
A0A7N5JI49_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8C6R2L6_BMF-01      -------------Q---------Q----------N-R-------D-----
A0A2K5KGP2_BMF-01      -------------H---------R----------A-G-------L-----
A0A337ST43_BMF-01      -------------Q---------Q----------N-R-------R-----
A0A0N8EUV8_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A8C0TVZ9_BMF-04      -------------Q---------Q----------N-Q-------N-----
A0A4W3JXA1_BMF-01      -------------H---------R----------M-E-------N-----
A0A3Q2HR24_BMF-04      -------------Q---------Q----------N-R-------N-----
A0A2K5VLA3_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A673TA87_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8D2HTN1_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A668TQU8_BMF-01      -------------R---------R--M-----------------------
A0A8B9LSW6_BMF-01      --------------------------S-N----VV-H-------CCKELG
A0A671M0H4_BMF-02      -------------R---------V--G-SGDP-VN-V-------FSVR--
A0A3Q2CXC4_BMF-02      -------------P---------G--Q-P----FP-H-------LVHQH-
A0A672JWL9_BMF-02      -------------S---------V--------------------------
A0A3P8NFE2_BMF-02      -------------K---------A--S-R----IQ-T-------CWLET-
A0A673HDR4_BMF-01      -------------L---------L--------------------------
A0A8C7G467_BMF-02      -------------R---------I--P-T----VT-D-------CTAQLK
W5N4P7_BMF-01          -------------R---------R--N-Q----RN-H-------Q-----
A0A8C4SHZ6_BMF-02      -------------Q---------Q--N-Q----RN-P-------Q-----
A0A8C9VER0_BMF-01      -------------R---------R--N-Q----RN-Q-------R-----
A0A8C4C2E0_BMF-02      -------------H---------R--N-Q----RWRR-------Q-----
A0A3B3RH63_BMF-01      -------------H---------R--N-Q----RN-Q-------Q-----
W5UAU7_BMF-01          -------------H---------Q--N-Q----RN-Q-------W-----
Q0GKC7_BMF-01          -------------H--------------Q----RP-Q-------D-----
A0A8C7XJP0_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A3Q2PJX9_BMF-01      -------------Y---------T--N-V----YS-Q-------C-----
A0A9J7Y9L1_BMF-01      -------------H---------R--N-Q----RI-R-------E-----
A0A3Q2YCX7_BMF-02      -------------S---------R--N-Q----HK-H-------------
A0A673YQV3_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A9J7Y9L1_BMF-03      -------------Q---------W--K-----------------------
A0A3P8UA78_BMF-01      -------------H---------R--N-Q----RN-H-------G-----
A0A3Q2CXC4_BMF-01      -------------H---------Q--N-Q----RN-Q-------G-----
A0A4W4DZH9_BMF-01      -------------H---------R--N-Q----RN-H-------Q-----
A0A6F9BGV6_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A3P9K487_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A2U9CJH3_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C2DDJ7_BMF-02      -------------H---------R--N-Q----RN-R-------E-----
A0A8C7XJP0_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A9J7Y9L1_BMF-02      -------------S---------N--N------RL-S-------D-----
A0A3P9ICE1_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3Q3RVI2_BMF-01      -------------V---------G--WAP----ET-S-------G-----
A0A8C4C2E0_BMF-01      -------------H---------R--N-Q----RWRR-------Q-----
A0A3Q3VLX6_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B5B8F6_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C6U3U8_BMF-01      -------------Q---------R--H-Q----RN-Q-------G-----
A0A8C1XUF5_BMF-01      -------------H---------R--N-Q----RI-R-------E-----
A0A8C6PNJ4_BMF-01      -------------W---------R--Q-----------------------
A0A8K9UY13_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A674EF64_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A3B4B6Y3_BMF-01      -------------R---------E--------------------------
A0A8C4DD37_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A672HG10_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A6F9B4C5_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A8C7JEQ7_BMF-02      -------------L---------R--H-Q----RD-V-------L-----
A0A3B4UNJ0_BMF-01      -------------M---------R--H-Q----RQ-N-------L-----
A0A672RK14_BMF-01      -------------R---------V--I-S----DE-T-------S-----
A0A3Q1FVH7_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A8B9MY06_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8B9FZ48_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q1D1K3_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3Q1IPR4_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A493T7X1_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A803SZ00_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A663DZQ4_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3P8NFE2_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B1K1X5_BMF-01      -------------H---------R--N-Q----RN-Q-------Q-----
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A8C0EML4_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3KIN9_BMF-02      -------------G---------C----------L-W-------R-----
A0A8C0JZ72_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8C0PT40_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8C0TVZ9_BMF-05      -------------G---------M----------G-A-------G-----
A0A452F2E0_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C0XK68_BMF-02      -------------Q---------Q----------H-R-------D-----
A0A8C3WX89_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8C3VHE5_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A286XXB0_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A286XXB0_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A286XXB0_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A2K5RN49_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C0GH19_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3XI05_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A0D9R4R5_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3P5Z9_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C3LTE5_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3EY31_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C3EY31_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C2MZN7_BMF-02      -------------Q---------Q----------N-R-------D-----
A0A8C2MZN7_BMF-01      -------------Q---------Q----------N-R-------D-----
A0A7M4FPU2_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3QVS1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A9J7Z5T7_BMF-01      -------------H---------R--N-Q----RN-R-------E-----
A0A9J7Z5T7_BMF-02      -------------A---------C----------S-Q-------I-----
A0A9J7Z5T7_BMF-03      -------------S---------N----------N-R-------L-----
A0A8C1P2N8_BMF-02      -------------S---------N--N------RL-S-------G-----
A0A8C1UAR1_BMF-02      -------------H---------R--N-Q----RN-R-------E-----
A0A8C4DD37_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C4J3Z9_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A8C4J3Z9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A665VG08_BMF-01      -------------H---------Q--N-Q----RN-Q-------G-----
A0A8C4MCB2_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C4SHZ6_BMF-01      -------------Q---------Q--N-Q----RN-P-------Q-----
A0A3P8ZIE7_BMF-01      -------------H---------R--N-Q----RN-L-------R-----
A0A337ST43_BMF-03      -------------G---------M----------G-A----WGGG-----
U3JS06_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A3Q2PJX9_BMF-03      -------------H---------Q--N-Q----RN-Q-------G-----
A9XRG9_BMF-01          -------------Q---------Q----------N-R-------N-----
A9XRH0_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A452H3N6_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2I2Z168_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      -------------H---------R--N-Q----RN-N-------G-----
A0A0N8EUV8_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A0N8EUV8_BMF-04      -------------Q---------Q----------N-R-------N-----
Q96LC9_BMF-03          -------------Q---------Q----------N-Q-------N-----
Q96LC9_BMF-06          -------------Q---------Q----------N-Q-------N-----
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A4W5N721_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A287CXH0_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C5K765_BMF-01      -------------Q---------Q----------N-R-------D-----
A0A8C5K765_BMF-02      -------------Q---------Q----------N-R-------D-----
A0A8C5IIR3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q2ZA20_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3Q3GUU5_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A4W6DUL1_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C5R6G2_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A667H967_BMF-01      -------------Q---------Q----------N-R-------R-----
A0A2K5VLA3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K5VLA3_BMF-02      -----------------------Q----------N-R-------N-----
A0A5F7ZML1_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A5F7ZML1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q3RVI2_BMF-02      -------------H---------L--N-Q----RN-Q-------G-----
A0A803YBD7_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C6JG54_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A5F8GKJ8_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C6B0J8_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q3QZ16_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C6CWP8_BMF-01      -------------Q---------Q----------N-R-------N-----
Q91ZE9_BMF-06          -------------Q---------Q----------N-R-------D-----
Q91ZE9_BMF-01          -------------Q---------Q----------N-R-------D-----
Q91ZE9_BMF-02          -------------Q---------Q----------N-R-------D-----
M3YAD5_BMF-01          -------------Q---------Q----------N-Q-------N-----
A0A667YNR9_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C6VCH5_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A8C6VCH5_BMF-02      AAIHNLAVSRYVHQ---------Q----------N-R-------N-----
A0A8C6R2L6_BMF-02      -------------Q---------Q----------N-R-------D-----
A0A3Q4G1I4_BMF-01      -------------Q---------R--N-Q----RN-Q-------G-----
U6CSY8_BMF-01          -------------Q---------Q----------N-Q-------N-----
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C7FH91_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A8C7G467_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A8C7JEQ7_BMF-01      -------------L---------R--H-Q----RD-V-------L-----
A0A8C7RCY3_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A8C7SCN2_BMF-01      -------------L---------R--H-Q----RD-V-------L-----
A0A8K9UY13_BMF-02      -------------H---------R--N-Q----RN-M-------R-----
A0A8C8CQZ6_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A8C8F9Y2_BMF-02      -------------R---------I--P-T----VT-D-------CTAQLK
A0A8C8F9Y2_BMF-01      -------------H---------R--N-Q----RN-M-------R-----
A0A8C8FNK5_BMF-01      -------------L---------R--H-Q----RD-V-------L-----
I3K2D6_BMF-01          -------------H---------R--N-Q----RN-Q-------G-----
G1SR62_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A3B3HAU1_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B3HAU1_BMF-04      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9ICE1_BMF-04      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9K487_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B3CGR9_BMF-01      -------------H---------Q--N-Q----RN-Q-------G-----
H0WYH6_BMF-01          -------------Q---------Q----------N-Q-------N-----
W5QFV1_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A8C8WD49_BMF-02      -------------Q---------Q----------N-R-------R-----
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      -------------Q---------Q----------N-R-------N-----
K7FRX2_BMF-01          -------------Q---------Q----------N-R-------N-----
A0A8C8RL12_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A6I9LHF8_BMF-01      -------------Q---------Q----------N-R-------D-----
A0A8C9LTX9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0AA35JSQ3_BMF-04      -------------Q---------Q----------N-R-------N-----
A0A670JUU6_BMF-05      -------------Q---------Q----------N-R-------N-----
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      -------------Q---------Q--N-Q----RN-Q-------G-----
A0A3P9Q8E2_BMF-01      -------------Q---------Q--N-Q----RN-Q-------G-----
A0A6D2XBX1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C8ZAV1_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A3B4CNJ8_BMF-01      -------------H---------R--N-Q----RN-Q-------Q-----
A0A8I6GLK7_BMF-02      -------------Q---------Q----------N-R-------D-----
A0A8I6GLK7_BMF-01      -------------Q---------Q----------N-R-------D-----
Q8K589_BMF-01          -------------Q---------Q----------N-R-------D-----
A0A671DWL6_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C9XRX5_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A7N4PJP2_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8D2AYP3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8D3CAL2_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C9NB87_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3B4U5H8_BMF-01      -------------H---------Q--N-Q----RN-Q-------G-----
A0A3B4WM88_BMF-01      -------------H---------Q--N-Q----RN-H-------G-----
A0A671MNR9_BMF-01      -------------H---------R--N-Q----RN-R-------E-----
A0A672JWL9_BMF-01      -------------H---------R--N-Q----RN-R-------E-----
A0A671X848_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C9UST6_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A673C8N3_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8D0LCG8_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A672V891_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A287BML0_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A287BML0_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8D0WCZ8_BMF-03      -------------Q---------Q----------N-Q-------N-----
A0A674GIP8_BMF-02      -----------------------Q----------N-R-------N-----
A0A674GIP8_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3B5KWG6_BMF-02      -------------Q---------R--N-Q----RN-Q-------G-----
A0A3B5KWG6_BMF-01      -------------Q---------R--N-Q----RN-Q-------G-----
A0A3B5KWG6_BMF-03      -------------Q---------R--N-Q----RN-Q-------G-----
A0A674IPL3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A452SED0_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A4X2KLG2_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3B5QK08_BMF-02      -------------Q---------Q--N-Q----RN-Q-------G-----
A0A8D2PG36_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q1FVH7_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C0AW70_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3KIN9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C4XVG9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3P8RKY9_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8B9VI07_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8B9BPF5_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8B9EVW2_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3GPS7_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q3C5V2_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9DPJ5_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9DPJ5_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B4ETH0_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8B9LSW6_BMF-02      -------------H---------R--N-Q----RN-Q-------Q-----
A0A8C8B299_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8D0FU29_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C0JZ72_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8C0RSS3_BMF-03      -------------Q---------Q----------N-Q-------N-----
A0A8C0TVZ9_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8I3PRV2_BMF-03      -------------Q---------Q----------N-Q-------N-----
A0A8C0TVZ9_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8I3PRV2_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8I3PRV2_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A452F2E0_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A2K6B5F6_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K6B5F6_BMF-04      -------------Q---------Q----------N-R-------N-----
A0A2K6B5F6_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A2K5Z4A9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K6L919_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2K6L919_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A2K6RAW1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8D2E2Z1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C3P5Z9_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A669PL85_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C5THT3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8C2TYD3_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C3N153_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3P8UA78_BMF-03      -------------H---------R--N-Q----RN-H-------G-----
A0A3P8UA78_BMF-02      -------------H---------R--N-Q----RN-H-------G-----
A0A8C1P2N8_BMF-03      -------------H---------R--N-Q----RI-R-------E-----
A0A8C1P2N8_BMF-01      -------------Q---------W--K-----------------------
A0A3Q2PJX9_BMF-02      -------------H---------Q--N-Q----RN-Q-------G-----
A0A803YBD7_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C4W1J6_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2R9BS98_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A2J8QDD5_BMF-02      -------------Q---------Q----------N-Q-------N-----
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      -------------S---------R--N-Q----HK-H-------------
Q96LC9_BMF-01          -------------Q---------Q----------N-Q-------N-----
Q96LC9_BMF-02          -------------Q---------Q----------N-Q-------N-----
Q96LC9_BMF-04          -------------Q---------Q----------N-Q-------N-----
A0A8C6A5T3_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8D2HTN1_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A8C5IIR3_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8D2MHD7_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A8D2MHD7_BMF-02      -------------Q---------Q----------N-R-------N-----
A0A8C8WD49_BMF-01      -------------Q---------Q----------N-R-------R-----
A0A8C9IYS3_BMF-01      -------------Q---------Q----------N-R-------R-----
A0A5F7ZML1_BMF-03      -------------Q---------Q----------N-R-------N-----
A0A8C5UXV9_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A8C9BKQ1_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A2U4BC98_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3Q3QZ16_BMF-01      -------------H---------R--N-Q----RN-Q-------G-----
A0A8C6GZK8_BMF-02      -------------Q---------Q----------N-R-------D-----
A0A8C6GZK8_BMF-03      -------------Q---------Q----------N-R-------D-----
A0A670XMZ5_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A3B3HAU1_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B3HAU1_BMF-03      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9ICE1_BMF-03      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9ICE1_BMF-05      -------------H---------R--N-Q----RN-Q-------G-----
A0A3P9ICE1_BMF-02      -------------H---------R--N-Q----RN-Q-------G-----
A0A3B3WU80_BMF-01      -------------Q---------Q--N-Q----RN-Q-------G-----
A0A2K6TW78_BMF-01      -------------Q---------Q----------N-R-------N-----
A0A671M0H4_BMF-01      -------------R---------V--G-SGDP-VN-V-------FSVR--
A0A8D0WCZ8_BMF-02      -------------Q---------Q----------N-Q-------N-----
A0A8D0WCZ8_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A384D070_BMF-01      -------------Q---------Q----------N-Q-------N-----
A0A3B5QK08_BMF-01      -------------Q---------Q--N-Q----RN-Q-------G-----
                                                                         

A0A8C9QDA0_BMF-01      --------------------------------------------------
A0A673JJ10_BMF-01      --------------------------S-------L---------------
A0A803SZ00_BMF-01      --------------------------L-------W---------------
A0AA35JSQ3_BMF-05      --------------------------K-------E---------------
A0A8B9NX34_BMF-02      --------------------------K-------E---------------
A0A670JUU6_BMF-02      --------------------------HFPLLSVKI---------------
A0A493T7X1_BMF-01      --------------------------KFGVLWTPL---------------
A0A670JUU6_BMF-01      --------------------------Q-------V---------------
A0A8C2TYD3_BMF-03      --------------------------T-------Y---------------
A0A8B9VI07_BMF-02      --------------------------G-------R---------------
A0A670JUU6_BMF-04      --------------------------HFPLLSVKI---------------
A0A8C0U4T1_BMF-01      --------------------------L-------L---------------
A0A8C5ST95_BMF-01      --------------------------CFPLFH-PL---------------
A0A803SZ00_BMF-02      --------------------------Q-------V---------------
A0A8C9F3R5_BMF-01      --------------------------Q-------V---------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------R-------V---------------
A0A8B9NX34_BMF-01      --------------------------Q-------V---------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------K-------C---------------
A0A8B9VI07_BMF-03      --------------------------Q-------V---------------
A0A8C4J3Z9_BMF-02      --------------------------K-------V---------------
A0A8C6JG54_BMF-02      --------------------------G-------R---------------
A0A8B9MY06_BMF-01      --------------------------Q-------V---------------
A0A663MPI8_BMF-01      --------------------------Q-------V---------------
A0A8C9F3R5_BMF-02      --------------------------X-------Q---------------
A0A8C4J3Z9_BMF-04      --------------------------Q-------V---------------
A0A8C2TYD3_BMF-04      --------------------------Q-------V---------------
A0AA35JSQ3_BMF-01      --------------------------Q-------V---------------
A0A8C6VCH5_BMF-01      --------------------------Q-------V---------------
A0A6I8NF73_BMF-01      --------------------------H-------V---------------
A0A8D2L6A0_BMF-01      --------------------------Q-------V---------------
A0A669PL85_BMF-02      --------------------------G-------R---------------
A0A8C2TYD3_BMF-05      --------------------------Q-------V---------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      --------------------------Q-------V---------------
A0A8C1UAR1_BMF-01      --------------------------S-------D---------------
A0A8I3W4Q3_BMF-02      --------------------------R-----------------------
A0A3Q2HR24_BMF-03      --------------------------R-------V---------------
G1PAU1_BMF-01          --------------------------R-------M---------------
A0A8C2DDJ7_BMF-01      --------------------------R-------C---------------
A0A8C0PT40_BMF-02      --------------------------R-------V---------------
A0A8I3W4Q3_BMF-03      --------------------------I-------E---------------
A0A8C0RSS3_BMF-02      --------------------------R-------V---------------
A0A8C2SHH9_BMF-01      --------------------------R-------M---------------
A0A8C0PT40_BMF-03      --------------------------S-----------------------
A0A2K6L919_BMF-02      --------------------------R-------V---------------
A0A096NTE9_BMF-02      --------------------------K-------I---------------
A0A337ST43_BMF-05      --------------------------R-------VCWGWGARTCLSNSVS
A0A7N5JI49_BMF-01      --------------------------R-------V---------------
A0A0N8EUV8_BMF-02      --------------------------R-------A---------------
A0A8C2VBL6_BMF-01      --------------------------R-------V---------------
A0A8I3W4Q3_BMF-01      --------------------------R-------M---------------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      --------------------------R-------V---------------
A0A287CXH0_BMF-01      --------------------------R-------V---------------
A0A8C0XK68_BMF-01      --------------------------R-------A---------------
A0A3Q2HR24_BMF-02      --------------------------R-------V---------------
G3T7Z4_BMF-01          --------------------------P-------A---------------
A0A671DWL6_BMF-02      --------------------------R-------V---------------
A0A8C6GZK8_BMF-01      --------------------------R-------A---------------
A0A3Q2HR24_BMF-05      --------------------------R-------V---------------
A0A8C5R6G2_BMF-01      --------------------------Q-------V---------------
A0A7N5JI49_BMF-03      --------------------------R-------V---------------
A0A8C0TVZ9_BMF-03      --------------------------R-------V---------------
A0A3Q2HR24_BMF-01      --------------------------R-------V---------------
A0A8C0RSS3_BMF-01      --------------------------R-------V---------------
A0A3Q2HR24_BMF-06      --------------------------R-------V---------------
A0A7N5JI49_BMF-02      --------------------------R-------V---------------
A0A8C6R2L6_BMF-01      --------------------------R-------A---------------
A0A2K5KGP2_BMF-01      --------------------------T-------L---------------
A0A337ST43_BMF-01      --------------------------R-------V---------------
A0A0N8EUV8_BMF-03      --------------------------R-------A---------------
A0A8C0TVZ9_BMF-04      --------------------------R-------V---------------
A0A4W3JXA1_BMF-01      --------------------------H-------V---------------
A0A3Q2HR24_BMF-04      --------------------------R-------V---------------
A0A2K5VLA3_BMF-03      --------------------------R-------V---------------
A0A673TA87_BMF-01      --------------------------R-------V---------------
A0A8D2HTN1_BMF-02      --------------------------R-------V---------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      I-E-RSCSARH---------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------Q-------A---------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --AEAYATPCKVHH-SVITVWKPRGLS-------Q---------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      STEQAYCTQRSAERETEQQKWLLYGHP-------L---------------
W5N4P7_BMF-01          --------------------------P-------M---------------
A0A8C4SHZ6_BMF-02      --------------------------P-------L---------------
A0A8C9VER0_BMF-01      --------------------------P-------V---------------
A0A8C4C2E0_BMF-02      --------------------------P-------F---------------
A0A3B3RH63_BMF-01      --------------------------P-------V---------------
W5UAU7_BMF-01          --------------------------P-------F---------------
Q0GKC7_BMF-01          --------------------------P-------L---------------
A0A8C7XJP0_BMF-02      --------------------------P-------V---------------
A0A3Q2PJX9_BMF-01      --------------------------P-------T---------------
A0A9J7Y9L1_BMF-01      --------------------------P-------L---------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------P-------L---------------
A0A9J7Y9L1_BMF-03      ----------------------------------K---------------
A0A3P8UA78_BMF-01      --------------------------P-------L---------------
A0A3Q2CXC4_BMF-01      --------------------------P-------L---------------
A0A4W4DZH9_BMF-01      --------------------------P-------F---------------
A0A6F9BGV6_BMF-01      --------------------------P-------L---------------
A0A3P9K487_BMF-02      --------------------------P-------V---------------
A0A2U9CJH3_BMF-01      --------------------------P-------L---------------
A0A8C2DDJ7_BMF-02      --------------------------P-------L---------------
A0A8C7XJP0_BMF-01      --------------------------P-------V---------------
A0A9J7Y9L1_BMF-02      --------------------------C-----------------------
A0A3P9ICE1_BMF-01      --------------------------P-------V---------------
A0A3Q3RVI2_BMF-01      --------------------------S-------L---------------
A0A8C4C2E0_BMF-01      --------------------------P-------F---------------
A0A3Q3VLX6_BMF-01      --------------------------P-------L---------------
A0A3B5B8F6_BMF-01      --------------------------P-------L---------------
A0A8C6U3U8_BMF-01      --------------------------P-------V---------------
A0A8C1XUF5_BMF-01      --------------------------P-------L---------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------P-------L---------------
A0A674EF64_BMF-01      --------------------------P-------L---------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      --------------------------P-------L---------------
A0A672HG10_BMF-01      --------------------------P-------L---------------
A0A6F9B4C5_BMF-01      --------------------------P-------L---------------
A0A8C7JEQ7_BMF-02      --------------------------P-------V---------------
A0A3B4UNJ0_BMF-01      --------------------------P-------A---------------
A0A672RK14_BMF-01      --------------------------S-------L---------------
A0A3Q1FVH7_BMF-02      --------------------------P-------L---------------
A0A8B9MY06_BMF-02      --------------------------Q-------V---------------
A0A8B9FZ48_BMF-01      --------------------------Q-------V---------------
A0A3Q1D1K3_BMF-01      --------------------------P-------L---------------
A0A3Q1IPR4_BMF-01      --------------------------P-------L---------------
A0A493T7X1_BMF-02      --------------------------Q-------V---------------
A0A803SZ00_BMF-03      --------------------------Q-------V---------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------R-------V---------------
A0A663DZQ4_BMF-01      --------------------------Q-------V---------------
A0A3P8NFE2_BMF-01      --------------------------P-------M---------------
A0A3B1K1X5_BMF-01      --------------------------P-------L---------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------R-------M---------------
A0A8C0EML4_BMF-01      --------------------------Q-------V---------------
A0A8C3KIN9_BMF-02      --------------------------G-------W---------------
A0A8C0JZ72_BMF-02      --------------------------R-------V---------------
A0A8C0PT40_BMF-01      --------------------------R-------V---------------
A0A8C0TVZ9_BMF-05      --------------------------S-----------------------
A0A452F2E0_BMF-02      --------------------------R-------M---------------
A0A8C0XK68_BMF-02      --------------------------R-------A---------------
A0A8C3WX89_BMF-01      --------------------------R-------V---------------
A0A8C3VHE5_BMF-01      --------------------------Q-------V---------------
A0A286XXB0_BMF-01      --------------------------R-------A---------------
A0A286XXB0_BMF-03      --------------------------R-------A---------------
A0A286XXB0_BMF-02      --------------------------R-------A---------------
A0A2K5RN49_BMF-01      --------------------------R-------V---------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------R-------V---------------
A0A8C0GH19_BMF-01      --------------------------Q-------V---------------
A0A8C3XI05_BMF-01      --------------------------Q-------V---------------
A0A0D9R4R5_BMF-01      --------------------------R-------M---------------
A0A8C3P5Z9_BMF-02      --------------------------Q-------V---------------
A0A8C3LTE5_BMF-01      --------------------------Q-------V---------------
A0A8C3EY31_BMF-02      --------------------------Q-------V---------------
A0A8C3EY31_BMF-01      --------------------------Q-------V---------------
A0A8C2MZN7_BMF-02      --------------------------R-------A---------------
A0A8C2MZN7_BMF-01      --------------------------R-------A---------------
A0A7M4FPU2_BMF-01      --------------------------Q-------V---------------
A0A8C3QVS1_BMF-01      --------------------------Q-------V---------------
A0A9J7Z5T7_BMF-01      --------------------------P-------L---------------
A0A9J7Z5T7_BMF-02      --------------------------R-------C---------------
A0A9J7Z5T7_BMF-03      --------------------------S-------D---------------
A0A8C1P2N8_BMF-02      --------------------------C-----------------------
A0A8C1UAR1_BMF-02      --------------------------P-------L---------------
A0A8C4DD37_BMF-01      --------------------------P-------L---------------
A0A8C4J3Z9_BMF-03      --------------------------Q-------V---------------
A0A8C4J3Z9_BMF-01      --------------------------Q-------V---------------
A0A665VG08_BMF-01      --------------------------P-------L---------------
A0A8C4MCB2_BMF-01      --------------------------R-------V---------------
A0A8C4SHZ6_BMF-01      --------------------------P-------L---------------
A0A3P8ZIE7_BMF-01      --------------------------P-------L---------------
A0A337ST43_BMF-03      --------------------------R-------VCWGWGARTCLSNSVS
U3JS06_BMF-01          --------------------------Q-------V---------------
A0A3Q2PJX9_BMF-03      --------------------------P-------L---------------
A9XRG9_BMF-01          --------------------------Q-------V---------------
A9XRH0_BMF-01          --------------------------Q-------V---------------
A0A452H3N6_BMF-01      --------------------------Q-------V---------------
A0A2I2Z168_BMF-01      --------------------------R-------V---------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------P-------V---------------
A0A0N8EUV8_BMF-01      --------------------------R-------A---------------
A0A0N8EUV8_BMF-04      --------------------------R-------A---------------
Q96LC9_BMF-03          --------------------------R-------V---------------
Q96LC9_BMF-06          --------------------------R-------V---------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------P-------L---------------
A0A4W5N721_BMF-01      --------------------------P-------L---------------
A0A287CXH0_BMF-02      --------------------------R-------V---------------
A0A8C5K765_BMF-01      --------------------------R-------A---------------
A0A8C5K765_BMF-02      --------------------------R-------A---------------
A0A8C5IIR3_BMF-01      --------------------------Q-------V---------------
A0A3Q2ZA20_BMF-01      --------------------------P-------L---------------
A0A3Q3GUU5_BMF-01      --------------------------P-------L---------------
A0A4W6DUL1_BMF-01      --------------------------P-------L---------------
A0A8C5R6G2_BMF-02      --------------------------Q-------V---------------
A0A667H967_BMF-01      --------------------------R-------V---------------
A0A2K5VLA3_BMF-01      --------------------------R-------V---------------
A0A2K5VLA3_BMF-02      --------------------------R-------V---------------
A0A5F7ZML1_BMF-02      --------------------------R-------V---------------
A0A5F7ZML1_BMF-01      --------------------------R-------V---------------
A0A3Q3RVI2_BMF-02      --------------------------L-------L---------------
A0A803YBD7_BMF-01      --------------------------Q-------V---------------
A0A8C6JG54_BMF-01      --------------------------Q-------V---------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------R-------V---------------
A0A5F8GKJ8_BMF-01      --------------------------H-------V---------------
A0A8C6B0J8_BMF-01      --------------------------R-------V---------------
A0A3Q3QZ16_BMF-02      --------------------------P-------L---------------
A0A8C6CWP8_BMF-01      --------------------------R-------V---------------
Q91ZE9_BMF-06          --------------------------R-------A---------------
Q91ZE9_BMF-01          --------------------------R-------A---------------
Q91ZE9_BMF-02          --------------------------R-------A---------------
M3YAD5_BMF-01          --------------------------R-------V---------------
A0A667YNR9_BMF-01      --------------------------P-------L---------------
A0A8C6VCH5_BMF-03      --------------------------Q-------V---------------
A0A8C6VCH5_BMF-02      --------------------------Q-------V---------------
A0A8C6R2L6_BMF-02      --------------------------R-------A---------------
A0A3Q4G1I4_BMF-01      --------------------------P-------M---------------
U6CSY8_BMF-01          --------------------------R-------V---------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------Q-------V---------------
A0A8C7FH91_BMF-01      --------------------------P-------L---------------
A0A8C7G467_BMF-01      --------------------------P-------L---------------
A0A8C7JEQ7_BMF-01      --------------------------P-------V---------------
A0A8C7RCY3_BMF-01      --------------------------P-------L---------------
A0A8C7SCN2_BMF-01      --------------------------P-------V---------------
A0A8K9UY13_BMF-02      --------------------------P-------L---------------
A0A8C8CQZ6_BMF-01      --------------------------P-------L---------------
A0A8C8F9Y2_BMF-02      STEQAYCTQRSAERETEQQKWLLYGHP-------L---------------
A0A8C8F9Y2_BMF-01      --------------------------P-------L---------------
A0A8C8FNK5_BMF-01      --------------------------P-------V---------------
I3K2D6_BMF-01          --------------------------P-------M---------------
G1SR62_BMF-01          --------------------------R-------V---------------
A0A3B3HAU1_BMF-01      --------------------------P-------V---------------
A0A3B3HAU1_BMF-04      --------------------------P-------V---------------
A0A3P9ICE1_BMF-04      --------------------------P-------V---------------
A0A3P9K487_BMF-01      --------------------------P-------V---------------
A0A3B3CGR9_BMF-01      --------------------------P-------L---------------
H0WYH6_BMF-01          --------------------------R-------V---------------
W5QFV1_BMF-01          --------------------------R-------M---------------
A0A8C8WD49_BMF-02      --------------------------R-------V---------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------R-------V---------------
K7FRX2_BMF-01          --------------------------Q-------V---------------
A0A8C8RL12_BMF-01      --------------------------Q-------V---------------
A0A6I9LHF8_BMF-01      --------------------------R-------A---------------
A0A8C9LTX9_BMF-01      --------------------------R-------V---------------
A0AA35JSQ3_BMF-04      --------------------------Q-------V---------------
A0A670JUU6_BMF-05      --------------------------Q-------V---------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------P-------L---------------
A0A3P9Q8E2_BMF-01      --------------------------P-------L---------------
A0A6D2XBX1_BMF-01      --------------------------R-------V---------------
A0A8C8ZAV1_BMF-01      --------------------------R-------V---------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------R-------M---------------
A0A3B4CNJ8_BMF-01      --------------------------P-------F---------------
A0A8I6GLK7_BMF-02      --------------------------R-------A---------------
A0A8I6GLK7_BMF-01      --------------------------R-------A---------------
Q8K589_BMF-01          --------------------------R-------A---------------
A0A671DWL6_BMF-01      --------------------------R-------V---------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------R-------V---------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------Q-------V---------------
A0A8C9XRX5_BMF-01      --------------------------W-------M---------------
A0A7N4PJP2_BMF-01      --------------------------H-------V---------------
A0A8D2AYP3_BMF-01      --------------------------R-------V---------------
A0A8D3CAL2_BMF-01      --------------------------P-------L---------------
A0A8C9NB87_BMF-01      --------------------------Q-------V---------------
A0A3B4U5H8_BMF-01      --------------------------P-------L---------------
A0A3B4WM88_BMF-01      --------------------------P-------L---------------
A0A671MNR9_BMF-01      --------------------------P-------L---------------
A0A672JWL9_BMF-01      --------------------------P-------L---------------
A0A671X848_BMF-01      --------------------------P-------L---------------
A0A8C9UST6_BMF-01      --------------------------R-------V---------------
A0A673C8N3_BMF-01      --------------------------P-------L---------------
A0A8D0LCG8_BMF-01      --------------------------H-------V---------------
A0A672V891_BMF-01      --------------------------Q-------V---------------
A0A287BML0_BMF-01      --------------------------R-------V---------------
A0A287BML0_BMF-02      --------------------------R-------V---------------
A0A8D0WCZ8_BMF-03      --------------------------R-------V---------------
A0A674GIP8_BMF-02      --------------------------Q-------V---------------
A0A674GIP8_BMF-01      --------------------------Q-------V---------------
A0A3B5KWG6_BMF-02      --------------------------P-------L---------------
A0A3B5KWG6_BMF-01      --------------------------P-------L---------------
A0A3B5KWG6_BMF-03      --------------------------P-------L---------------
A0A674IPL3_BMF-01      --------------------------Q-------V---------------
A0A452SED0_BMF-01      --------------------------R-------V---------------
A0A4X2KLG2_BMF-01      --------------------------H-------V---------------
A0A3B5QK08_BMF-02      --------------------------P-------L---------------
A0A8D2PG36_BMF-01      --------------------------Q-------V---------------
A0A3Q1FVH7_BMF-01      --------------------------P-------L---------------
A0A8C0AW70_BMF-01      --------------------------Q-------V---------------
A0A8C3KIN9_BMF-01      --------------------------Q-------V---------------
A0A8C4XVG9_BMF-01      --------------------------Q-------V---------------
A0A3P8RKY9_BMF-01      --------------------------P-------L---------------
A0A8B9VI07_BMF-01      --------------------------Q-------V---------------
A0A8B9BPF5_BMF-01      --------------------------Q-------V---------------
A0A8B9EVW2_BMF-01      --------------------------Q-------V---------------
A0A8C3GPS7_BMF-01      --------------------------Q-------V---------------
A0A3Q3C5V2_BMF-01      --------------------------P-------M---------------
A0A3P9DPJ5_BMF-01      --------------------------P-------M---------------
A0A3P9DPJ5_BMF-02      --------------------------P-------M---------------
A0A3B4ETH0_BMF-01      --------------------------P-------M---------------
A0A8B9LSW6_BMF-02      --------------------------P-------L---------------
A0A8C8B299_BMF-01      --------------------------Q-------V---------------
A0A8D0FU29_BMF-01      --------------------------Q-------V---------------
A0A8C0JZ72_BMF-01      --------------------------R-------V---------------
A0A8C0RSS3_BMF-03      --------------------------R-------V---------------
A0A8C0TVZ9_BMF-02      --------------------------R-------V---------------
A0A8I3PRV2_BMF-03      --------------------------R-------V---------------
A0A8C0TVZ9_BMF-01      --------------------------R-------V---------------
A0A8I3PRV2_BMF-02      --------------------------R-------V---------------
A0A8I3PRV2_BMF-01      --------------------------R-------V---------------
A0A452F2E0_BMF-01      --------------------------R-------M---------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------R-------V---------------
A0A2K6B5F6_BMF-01      --------------------------R-------V---------------
A0A2K6B5F6_BMF-04      --------------------------R-------V---------------
A0A2K6B5F6_BMF-02      --------------------------R-------V---------------
A0A2K5Z4A9_BMF-01      --------------------------R-------V---------------
A0A2K6L919_BMF-01      --------------------------R-------V---------------
A0A2K6L919_BMF-03      --------------------------R-------V---------------
A0A2K6RAW1_BMF-01      --------------------------R-------V---------------
A0A8D2E2Z1_BMF-01      --------------------------R-------V---------------
A0A8C3P5Z9_BMF-01      --------------------------Q-------V---------------
A0A669PL85_BMF-01      --------------------------Q-------V---------------
A0A8C5THT3_BMF-01      --------------------------Q-------V---------------
A0A8C2TYD3_BMF-02      --------------------------Q-------V---------------
A0A8C3N153_BMF-01      --------------------------Q-------V---------------
A0A3P8UA78_BMF-03      --------------------------P-------L---------------
A0A3P8UA78_BMF-02      --------------------------P-------L---------------
A0A8C1P2N8_BMF-03      --------------------------P-------L---------------
A0A8C1P2N8_BMF-01      ----------------------------------K---------------
A0A3Q2PJX9_BMF-02      --------------------------P-------L---------------
A0A803YBD7_BMF-02      --------------------------Q-------V---------------
A0A8C4W1J6_BMF-01      --------------------------Q-------V---------------
A0A2R9BS98_BMF-01      --------------------------R-------V---------------
A0A2J8QDD5_BMF-02      --------------------------R-------V---------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------R-------V---------------
Q96LC9_BMF-02          --------------------------R-------V---------------
Q96LC9_BMF-04          --------------------------R-------V---------------
A0A8C6A5T3_BMF-01      --------------------------R-------V---------------
A0A8D2HTN1_BMF-03      --------------------------R-------V---------------
A0A8C5IIR3_BMF-02      --------------------------Q-------V---------------
A0A8D2MHD7_BMF-01      --------------------------Q-------V---------------
A0A8D2MHD7_BMF-02      --------------------------Q-------V---------------
A0A8C8WD49_BMF-01      --------------------------R-------V---------------
A0A8C9IYS3_BMF-01      --------------------------R-------V---------------
A0A5F7ZML1_BMF-03      --------------------------R-------V---------------
A0A8C5UXV9_BMF-01      --------------------------R-------V---------------
A0A8C9BKQ1_BMF-01      --------------------------R-------V---------------
A0A2U4BC98_BMF-01      --------------------------R-------V---------------
A0A3Q3QZ16_BMF-01      --------------------------P-------L---------------
A0A8C6GZK8_BMF-02      --------------------------R-------A---------------
A0A8C6GZK8_BMF-03      --------------------------R-------A---------------
A0A670XMZ5_BMF-01      --------------------------Q-------V---------------
A0A3B3HAU1_BMF-02      --------------------------P-------V---------------
A0A3B3HAU1_BMF-03      --------------------------P-------V---------------
A0A3P9ICE1_BMF-03      --------------------------P-------V---------------
A0A3P9ICE1_BMF-05      --------------------------P-------V---------------
A0A3P9ICE1_BMF-02      --------------------------P-------V---------------
A0A3B3WU80_BMF-01      --------------------------P-------L---------------
A0A2K6TW78_BMF-01      --------------------------R-------V---------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------R-------V---------------
A0A8D0WCZ8_BMF-01      --------------------------R-------V---------------
A0A384D070_BMF-01      --------------------------R-------V---------------
A0A3B5QK08_BMF-01      --------------------------P-------L---------------
                                                                         

A0A8C9QDA0_BMF-01      -------------------------V------------------------
A0A673JJ10_BMF-01      ----------W--------------F------------------------
A0A803SZ00_BMF-01      ----------T--------------SSE---------------------R
A0AA35JSQ3_BMF-05      ----------S---------------------------------------
A0A8B9NX34_BMF-02      ----------T--------------LRT----------------------
A0A670JUU6_BMF-02      ----------K--------------VRFPPRILSTCSAVGKKKGMVRFER
A0A493T7X1_BMF-01      ----------C--------------CSLPCEAGSSCPTLSKES-------
A0A670JUU6_BMF-01      ----------W--------------W------------------------
A0A8C2TYD3_BMF-03      ----------T--------------R------------------------
A0A8B9VI07_BMF-02      ----------W--------------GLT----------------------
A0A670JUU6_BMF-04      ----------K--------------VRFPPRILSTCSAVGKKKGMVRFER
A0A8C0U4T1_BMF-01      ----------T--------------TSTF---------------------
A0A8C5ST95_BMF-01      ----------V--------------TRFFCH-------------------
A0A803SZ00_BMF-02      ----------W--------------W------------------------
A0A8C9F3R5_BMF-01      ----------W--------------W------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      ----------W--------------W------------------------
A0A8B9NX34_BMF-01      ----------W--------------W------------------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      ----------G--------------G------------------------
A0A8B9VI07_BMF-03      ----------W--------------W------------------------
A0A8C4J3Z9_BMF-02      ----------W--------------G------------------------
A0A8C6JG54_BMF-02      ----------W--------------G------------------------
A0A8B9MY06_BMF-01      ----------W--------------W------------------------
A0A663MPI8_BMF-01      ----------W--------------W------------------------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      ----------W--------------W------------------------
A0A8C2TYD3_BMF-04      ----------W--------------W------------------------
A0AA35JSQ3_BMF-01      ----------W--------------W------------------------
A0A8C6VCH5_BMF-01      ----------W--------------W------------------------
A0A6I8NF73_BMF-01      ----------W--------------W------------------------
A0A8D2L6A0_BMF-01      ----------W--------------W------------------------
A0A669PL85_BMF-02      ----------W--------------G------------------------
A0A8C2TYD3_BMF-05      ----------W--------------W------------------------
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      ----------W--------------W------------------------
A0A8C1UAR1_BMF-01      ----------C--------------S------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      ----------W--------------W------------------------
G1PAU1_BMF-01          ----------W--------------W------------------------
A0A8C2DDJ7_BMF-01      ----------R---------------------------------------
A0A8C0PT40_BMF-02      ----------W--------------W------------------------
A0A8I3W4Q3_BMF-03      ----------I--------------R------------------------
A0A8C0RSS3_BMF-02      ----------W--------------W------------------------
A0A8C2SHH9_BMF-01      ----------W--------------W------------------------
A0A8C0PT40_BMF-03      ----------WAGAGGESAGAGGWGW------------------------
A0A2K6L919_BMF-02      ----------W--------------W------------------------
A0A096NTE9_BMF-02      ----------W--------------S------------------------
A0A337ST43_BMF-05      ARLYQDMVPEF--------------W------------------------
A0A7N5JI49_BMF-01      ----------W--------------W------------------------
A0A0N8EUV8_BMF-02      ----------W--------------W------------------------
A0A8C2VBL6_BMF-01      ----------W--------------W------------------------
A0A8I3W4Q3_BMF-01      ----------W--------------W------------------------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      ----------W--------------W------------------------
A0A287CXH0_BMF-01      ----------W--------------W------------------------
A0A8C0XK68_BMF-01      ----------W--------------W------------------------
A0A3Q2HR24_BMF-02      ----------W--------------W------------------------
G3T7Z4_BMF-01          ----------W--------------R------------------------
A0A671DWL6_BMF-02      ----------W--------------W------------------------
A0A8C6GZK8_BMF-01      ----------W--------------W------------------------
A0A3Q2HR24_BMF-05      ----------W--------------W------------------------
A0A8C5R6G2_BMF-01      ----------W--------------S------------------------
A0A7N5JI49_BMF-03      ----------W--------------W------------------------
A0A8C0TVZ9_BMF-03      ----------W--------------W------------------------
A0A3Q2HR24_BMF-01      ----------W--------------W------------------------
A0A8C0RSS3_BMF-01      ----------W--------------W------------------------
A0A3Q2HR24_BMF-06      ----------W--------------W------------------------
A0A7N5JI49_BMF-02      ----------W--------------W------------------------
A0A8C6R2L6_BMF-01      ----------W--------------W------------------------
A0A2K5KGP2_BMF-01      ----------C--------------L------------------------
A0A337ST43_BMF-01      ----------W--------------W------------------------
A0A0N8EUV8_BMF-03      ----------W--------------W------------------------
A0A8C0TVZ9_BMF-04      ----------W--------------W------------------------
A0A4W3JXA1_BMF-01      ------DQPFW--------------W------------------------
A0A3Q2HR24_BMF-04      ----------W--------------W------------------------
A0A2K5VLA3_BMF-03      ----------W--------------W------------------------
A0A673TA87_BMF-01      ----------W--------------W------------------------
A0A8D2HTN1_BMF-02      ----------W--------------W------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      ----------W--------------I------------------------
A0A3Q2CXC4_BMF-02      ----------L--------------T------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      ----------W--------------Q------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      ----------W--------------S------------------------
W5N4P7_BMF-01          ----------W--------------W------------------------
A0A8C4SHZ6_BMF-02      ----------W--------------W------------------------
A0A8C9VER0_BMF-01      ----------W--------------W------------------------
A0A8C4C2E0_BMF-02      ----------L--------------W------------------------
A0A3B3RH63_BMF-01      ----------W--------------W------------------------
W5UAU7_BMF-01          ----------W--------------L------------------------
Q0GKC7_BMF-01          ----------W--------------R------------------------
A0A8C7XJP0_BMF-02      ----------W--------------W------------------------
A0A3Q2PJX9_BMF-01      ----------C--------------W------LANCLS------------
A0A9J7Y9L1_BMF-01      ----------W--------------W------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      ----------W--------------R------------------------
A0A9J7Y9L1_BMF-03      ----------S--------------W------------------------
A0A3P8UA78_BMF-01      ----------W--------------W------------------------
A0A3Q2CXC4_BMF-01      ----------W--------------W------------------------
A0A4W4DZH9_BMF-01      ----------W--------------L------------------------
A0A6F9BGV6_BMF-01      ----------W--------------W------------------------
A0A3P9K487_BMF-02      ----------W--------------W------------------------
A0A2U9CJH3_BMF-01      ----------W--------------W------------------------
A0A8C2DDJ7_BMF-02      ----------W--------------W------------------------
A0A8C7XJP0_BMF-01      ----------W--------------W------------------------
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      ----------W--------------W------------------------
A0A3Q3RVI2_BMF-01      ----------P--------------V------------------------
A0A8C4C2E0_BMF-01      ----------L--------------W------------------------
A0A3Q3VLX6_BMF-01      ----------W--------------W------------------------
A0A3B5B8F6_BMF-01      ----------W--------------W------------------------
A0A8C6U3U8_BMF-01      ----------W--------------W------------------------
A0A8C1XUF5_BMF-01      ----------W--------------W------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      ----------W--------------W------------------------
A0A674EF64_BMF-01      ----------W--------------W------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      ----------W--------------W------------------------
A0A672HG10_BMF-01      ----------W--------------W------------------------
A0A6F9B4C5_BMF-01      ----------W--------------R------------------------
A0A8C7JEQ7_BMF-02      ----------W--------------I------------------------
A0A3B4UNJ0_BMF-01      ----------W--------------M------------------------
A0A672RK14_BMF-01      ----------W--------------F------------------------
A0A3Q1FVH7_BMF-02      ----------W--------------W------------------------
A0A8B9MY06_BMF-02      ----------W--------------W------------------------
A0A8B9FZ48_BMF-01      ----------W--------------W------------------------
A0A3Q1D1K3_BMF-01      ----------W--------------W------------------------
A0A3Q1IPR4_BMF-01      ----------W--------------W------------------------
A0A493T7X1_BMF-02      ----------W--------------W------------------------
A0A803SZ00_BMF-03      ----------W--------------W------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      ----------W--------------W------------------------
A0A663DZQ4_BMF-01      ----------W--------------W------------------------
A0A3P8NFE2_BMF-01      ----------W--------------W------------------------
A0A3B1K1X5_BMF-01      ----------W--------------L------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          ----------W--------------W------------------------
A0A8C0EML4_BMF-01      ----------W--------------W------------------------
A0A8C3KIN9_BMF-02      ----------W--------------GFS----------------------
A0A8C0JZ72_BMF-02      ----------W--------------W------------------------
A0A8C0PT40_BMF-01      ----------W--------------W------------------------
A0A8C0TVZ9_BMF-05      ----------WAGAGGESSGAGGWGW------------------------
A0A452F2E0_BMF-02      ----------W--------------W------------------------
A0A8C0XK68_BMF-02      ----------W--------------W------------------------
A0A8C3WX89_BMF-01      ----------W--------------W------------------------
A0A8C3VHE5_BMF-01      ----------W--------------W------------------------
A0A286XXB0_BMF-01      ----------W--------------W------------------------
A0A286XXB0_BMF-03      ----------W--------------W------------------------
A0A286XXB0_BMF-02      ----------W--------------W------------------------
A0A2K5RN49_BMF-01      ----------W--------------W------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      ----------W--------------W------------------------
A0A8C0GH19_BMF-01      ----------W--------------W------------------------
A0A8C3XI05_BMF-01      ----------W--------------W------------------------
A0A0D9R4R5_BMF-01      ----------W--------------W------------------------
A0A8C3P5Z9_BMF-02      ----------W--------------W------------------------
A0A8C3LTE5_BMF-01      ----------W--------------W------------------------
A0A8C3EY31_BMF-02      ----------W--------------W------------------------
A0A8C3EY31_BMF-01      ----------W--------------W------------------------
A0A8C2MZN7_BMF-02      ----------W--------------W------------------------
A0A8C2MZN7_BMF-01      ----------W--------------W------------------------
A0A7M4FPU2_BMF-01      ----------W--------------W------------------------
A0A8C3QVS1_BMF-01      ----------W--------------W------------------------
A0A9J7Z5T7_BMF-01      ----------W--------------W------------------------
A0A9J7Z5T7_BMF-02      ----------R---------------------------------------
A0A9J7Z5T7_BMF-03      ----------C--------------S------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      ----------W--------------W------------------------
A0A8C4DD37_BMF-01      ----------W--------------W------------------------
A0A8C4J3Z9_BMF-03      ----------W--------------W------------------------
A0A8C4J3Z9_BMF-01      ----------W--------------W------------------------
A0A665VG08_BMF-01      ----------W--------------W------------------------
A0A8C4MCB2_BMF-01      ----------W--------------W------------------------
A0A8C4SHZ6_BMF-01      ----------W--------------W------------------------
A0A3P8ZIE7_BMF-01      ----------W--------------W------------------------
A0A337ST43_BMF-03      ARLYQDMVPEF--------------W------------------------
U3JS06_BMF-01          ----------W--------------W------------------------
A0A3Q2PJX9_BMF-03      ----------W--------------W------------------------
A9XRG9_BMF-01          ----------W--------------W------------------------
A9XRH0_BMF-01          ----------W--------------W------------------------
A0A452H3N6_BMF-01      ----------W--------------W------------------------
A0A2I2Z168_BMF-01      ----------W--------------W------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      ----------W--------------W------------------------
A0A0N8EUV8_BMF-01      ----------W--------------W------------------------
A0A0N8EUV8_BMF-04      ----------W--------------W------------------------
Q96LC9_BMF-03          ----------W--------------W------------------------
Q96LC9_BMF-06          ----------W--------------W------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      ----------W--------------W------------------------
A0A4W5N721_BMF-01      ----------W--------------R------------------------
A0A287CXH0_BMF-02      ----------W--------------W------------------------
A0A8C5K765_BMF-01      ----------W--------------W------------------------
A0A8C5K765_BMF-02      ----------W--------------W------------------------
A0A8C5IIR3_BMF-01      ----------W--------------W------------------------
A0A3Q2ZA20_BMF-01      ----------W--------------W------------------------
A0A3Q3GUU5_BMF-01      ----------W--------------W------------------------
A0A4W6DUL1_BMF-01      ----------W--------------W------------------------
A0A8C5R6G2_BMF-02      ----------W--------------S------------------------
A0A667H967_BMF-01      ----------W--------------W------------------------
A0A2K5VLA3_BMF-01      ----------W--------------W------------------------
A0A2K5VLA3_BMF-02      ----------W--------------W------------------------
A0A5F7ZML1_BMF-02      ----------W--------------W------------------------
A0A5F7ZML1_BMF-01      ----------W--------------W------------------------
A0A3Q3RVI2_BMF-02      ----------W--------------W------------------------
A0A803YBD7_BMF-01      ----------W--------------W------------------------
A0A8C6JG54_BMF-01      ----------W--------------W------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      ----------W--------------W------------------------
A0A5F8GKJ8_BMF-01      ----------W--------------W------------------------
A0A8C6B0J8_BMF-01      ----------W--------------W------------------------
A0A3Q3QZ16_BMF-02      ----------W--------------W------------------------
A0A8C6CWP8_BMF-01      ----------W--------------W------------------------
Q91ZE9_BMF-06          ----------W--------------W------------------------
Q91ZE9_BMF-01          ----------W--------------W------------------------
Q91ZE9_BMF-02          ----------W--------------W------------------------
M3YAD5_BMF-01          ----------W--------------W------------------------
A0A667YNR9_BMF-01      ----------W--------------W------------------------
A0A8C6VCH5_BMF-03      ----------W--------------W------------------------
A0A8C6VCH5_BMF-02      ----------W--------------W------------------------
A0A8C6R2L6_BMF-02      ----------W--------------W------------------------
A0A3Q4G1I4_BMF-01      ----------W--------------W------------------------
U6CSY8_BMF-01          ----------W--------------W------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      ----------W--------------W------------------------
A0A8C7FH91_BMF-01      ----------W--------------W------------------------
A0A8C7G467_BMF-01      ----------W--------------W------------------------
A0A8C7JEQ7_BMF-01      ----------W--------------I------------------------
A0A8C7RCY3_BMF-01      ----------W--------------W------------------------
A0A8C7SCN2_BMF-01      ----------W--------------I------------------------
A0A8K9UY13_BMF-02      ----------W--------------W------------------------
A0A8C8CQZ6_BMF-01      ----------W--------------W------------------------
A0A8C8F9Y2_BMF-02      ----------W--------------S------------------------
A0A8C8F9Y2_BMF-01      ----------W--------------W------------------------
A0A8C8FNK5_BMF-01      ----------W--------------I------------------------
I3K2D6_BMF-01          ----------W--------------W------------------------
G1SR62_BMF-01          ----------W--------------W------------------------
A0A3B3HAU1_BMF-01      ----------W--------------W------------------------
A0A3B3HAU1_BMF-04      ----------W--------------W------------------------
A0A3P9ICE1_BMF-04      ----------W--------------W------------------------
A0A3P9K487_BMF-01      ----------W--------------W------------------------
A0A3B3CGR9_BMF-01      ----------W--------------W------------------------
H0WYH6_BMF-01          ----------W--------------W------------------------
W5QFV1_BMF-01          ----------W--------------W------------------------
A0A8C8WD49_BMF-02      ----------W--------------W------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      ----------W--------------W------------------------
K7FRX2_BMF-01          ----------W--------------W------------------------
A0A8C8RL12_BMF-01      ----------W--------------W------------------------
A0A6I9LHF8_BMF-01      ----------W--------------W------------------------
A0A8C9LTX9_BMF-01      ----------W--------------W------------------------
A0AA35JSQ3_BMF-04      ----------W--------------W------------------------
A0A670JUU6_BMF-05      ----------W--------------W------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      ----------W--------------W------------------------
A0A3P9Q8E2_BMF-01      ----------W--------------W------------------------
A0A6D2XBX1_BMF-01      ----------W--------------W------------------------
A0A8C8ZAV1_BMF-01      ----------W--------------W------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      ----------W--------------W------------------------
A0A3B4CNJ8_BMF-01      ----------W--------------L------------------------
A0A8I6GLK7_BMF-02      ----------W--------------R------------------------
A0A8I6GLK7_BMF-01      ----------W--------------R------------------------
Q8K589_BMF-01          ----------W--------------R------------------------
A0A671DWL6_BMF-01      ----------W--------------W------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      ----------W--------------W------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      ----------W--------------W------------------------
A0A8C9XRX5_BMF-01      ----------W--------------W------------------------
A0A7N4PJP2_BMF-01      ----------W--------------W------------------------
A0A8D2AYP3_BMF-01      ----------W--------------W------------------------
A0A8D3CAL2_BMF-01      ----------W--------------W------------------------
A0A8C9NB87_BMF-01      ----------W--------------W------------------------
A0A3B4U5H8_BMF-01      ----------W--------------W------------------------
A0A3B4WM88_BMF-01      ----------W--------------W------------------------
A0A671MNR9_BMF-01      ----------W--------------W------------------------
A0A672JWL9_BMF-01      ----------W--------------W------------------------
A0A671X848_BMF-01      ----------W--------------W------------------------
A0A8C9UST6_BMF-01      ----------W--------------W------------------------
A0A673C8N3_BMF-01      ----------W--------------W------------------------
A0A8D0LCG8_BMF-01      ----------W--------------W------------------------
A0A672V891_BMF-01      ----------W--------------W------------------------
A0A287BML0_BMF-01      ----------W--------------W------------------------
A0A287BML0_BMF-02      ----------W--------------W------------------------
A0A8D0WCZ8_BMF-03      ----------W--------------W------------------------
A0A674GIP8_BMF-02      ----------W--------------W------------------------
A0A674GIP8_BMF-01      ----------W--------------W------------------------
A0A3B5KWG6_BMF-02      ----------W--------------W------------------------
A0A3B5KWG6_BMF-01      ----------W--------------W------------------------
A0A3B5KWG6_BMF-03      ----------W--------------W------------------------
A0A674IPL3_BMF-01      ----------W--------------W------------------------
A0A452SED0_BMF-01      ----------W--------------W------------------------
A0A4X2KLG2_BMF-01      ----------W--------------W------------------------
A0A3B5QK08_BMF-02      ----------W--------------W------------------------
A0A8D2PG36_BMF-01      ----------W--------------W------------------------
A0A3Q1FVH7_BMF-01      ----------W--------------W------------------------
A0A8C0AW70_BMF-01      ----------W--------------W------------------------
A0A8C3KIN9_BMF-01      ----------W--------------W------------------------
A0A8C4XVG9_BMF-01      ----------W--------------W------------------------
A0A3P8RKY9_BMF-01      ----------W--------------W------------------------
A0A8B9VI07_BMF-01      ----------W--------------W------------------------
A0A8B9BPF5_BMF-01      ----------W--------------W------------------------
A0A8B9EVW2_BMF-01      ----------W--------------W------------------------
A0A8C3GPS7_BMF-01      ----------W--------------W------------------------
A0A3Q3C5V2_BMF-01      ----------W--------------W------------------------
A0A3P9DPJ5_BMF-01      ----------W--------------W------------------------
A0A3P9DPJ5_BMF-02      ----------W--------------W------------------------
A0A3B4ETH0_BMF-01      ----------W--------------W------------------------
A0A8B9LSW6_BMF-02      ----------W--------------L------------------------
A0A8C8B299_BMF-01      ----------W--------------W------------------------
A0A8D0FU29_BMF-01      ----------W--------------W------------------------
A0A8C0JZ72_BMF-01      ----------W--------------W------------------------
A0A8C0RSS3_BMF-03      ----------W--------------W------------------------
A0A8C0TVZ9_BMF-02      ----------W--------------W------------------------
A0A8I3PRV2_BMF-03      ----------W--------------W------------------------
A0A8C0TVZ9_BMF-01      ----------W--------------W------------------------
A0A8I3PRV2_BMF-02      ----------W--------------W------------------------
A0A8I3PRV2_BMF-01      ----------W--------------W------------------------
A0A452F2E0_BMF-01      ----------W--------------W------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      ----------W--------------W------------------------
A0A2K6B5F6_BMF-01      ----------W--------------W------------------------
A0A2K6B5F6_BMF-04      ----------W--------------W------------------------
A0A2K6B5F6_BMF-02      ----------W--------------W------------------------
A0A2K5Z4A9_BMF-01      ----------W--------------W------------------------
A0A2K6L919_BMF-01      ----------W--------------W------------------------
A0A2K6L919_BMF-03      ----------W--------------W------------------------
A0A2K6RAW1_BMF-01      ----------W--------------W------------------------
A0A8D2E2Z1_BMF-01      ----------W--------------W------------------------
A0A8C3P5Z9_BMF-01      ----------W--------------W------------------------
A0A669PL85_BMF-01      ----------W--------------W------------------------
A0A8C5THT3_BMF-01      ----------W--------------W------------------------
A0A8C2TYD3_BMF-02      ----------W--------------W------------------------
A0A8C3N153_BMF-01      ----------W--------------W------------------------
A0A3P8UA78_BMF-03      ----------W--------------W------------------------
A0A3P8UA78_BMF-02      ----------W--------------W------------------------
A0A8C1P2N8_BMF-03      ----------W--------------W------------------------
A0A8C1P2N8_BMF-01      ----------S--------------W------------------------
A0A3Q2PJX9_BMF-02      ----------W--------------W------------------------
A0A803YBD7_BMF-02      ----------W--------------W------------------------
A0A8C4W1J6_BMF-01      ----------W--------------W------------------------
A0A2R9BS98_BMF-01      ----------W--------------W------------------------
A0A2J8QDD5_BMF-02      ----------W--------------W------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          ----------W--------------W------------------------
Q96LC9_BMF-02          ----------W--------------W------------------------
Q96LC9_BMF-04          ----------W--------------W------------------------
A0A8C6A5T3_BMF-01      ----------W--------------W------------------------
A0A8D2HTN1_BMF-03      ----------W--------------W------------------------
A0A8C5IIR3_BMF-02      ----------W--------------W------------------------
A0A8D2MHD7_BMF-01      ----------W--------------W------------------------
A0A8D2MHD7_BMF-02      ----------W--------------W------------------------
A0A8C8WD49_BMF-01      ----------W--------------W------------------------
A0A8C9IYS3_BMF-01      ----------W--------------W------------------------
A0A5F7ZML1_BMF-03      ----------W--------------W------------------------
A0A8C5UXV9_BMF-01      ----------W--------------W------------------------
A0A8C9BKQ1_BMF-01      ----------W--------------W------------------------
A0A2U4BC98_BMF-01      ----------W--------------W------------------------
A0A3Q3QZ16_BMF-01      ----------W--------------W------------------------
A0A8C6GZK8_BMF-02      ----------W--------------W------------------------
A0A8C6GZK8_BMF-03      ----------W--------------W------------------------
A0A670XMZ5_BMF-01      ----------W--------------W------------------------
A0A3B3HAU1_BMF-02      ----------W--------------W------------------------
A0A3B3HAU1_BMF-03      ----------W--------------W------------------------
A0A3P9ICE1_BMF-03      ----------W--------------W------------------------
A0A3P9ICE1_BMF-05      ----------W--------------W------------------------
A0A3P9ICE1_BMF-02      ----------W--------------W------------------------
A0A3B3WU80_BMF-01      ----------W--------------W------------------------
A0A2K6TW78_BMF-01      ----------W--------------W------------------------
A0A671M0H4_BMF-01      ----------W--------------I------------------------
A0A8D0WCZ8_BMF-02      ----------W--------------W------------------------
A0A8D0WCZ8_BMF-01      ----------W--------------W------------------------
A0A384D070_BMF-01      ----------W--------------W------------------------
A0A3B5QK08_BMF-01      ----------W--------------W------------------------
                                                                         

A0A8C9QDA0_BMF-01      ------------------------C-VCV-------F--VRS-------A
A0A673JJ10_BMF-01      ------------------------S-LQW-------F--LSR-------C
A0A803SZ00_BMF-01      GW-ADPSCGCFT-----------WR-S-C-------T-------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      ALDPQREGTYTQLYP--------WP-L-S-------L--KRD-------S
A0A493T7X1_BMF-01      ----QNVGVFGKA-------------C---------C-------------
A0A670JUU6_BMF-01      ------------------------Q-ILL-------F--LHN-------V
A0A8C2TYD3_BMF-03      KILSHKTCLYLT-----------WY-IEC-------L--IHH-------C
A0A8B9VI07_BMF-02      -------------YP--------G-VV-L-------L--KPG-------S
A0A670JUU6_BMF-04      ALDPQREGTYTQANPTTGSEGTLWR-K-R-------M--LQT-------T
A0A8C0U4T1_BMF-01      ---SSVEHAAIS-----------GL-C---------Q-------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      ------------------------Q-IFF-------F--LHN-------V
A0A8C9F3R5_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      ------------------------Q-ILL-------F--LHN-------L
A0A8B9NX34_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      ------------------------S-FFS-------S-------------
A0A8B9VI07_BMF-03      ------------------------Q-LFL-------F--LHN-------L
A0A8C4J3Z9_BMF-02      ------------------------S-SAG-------G--QRN-------G
A0A8C6JG54_BMF-02      ------------------------V-A-----------------------
A0A8B9MY06_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A663MPI8_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      ------------------------Q-LFL-------F--LHN-------L
A0A8C2TYD3_BMF-04      ------------------------Q-LFL-------F--LHN-------L
A0AA35JSQ3_BMF-01      ------------------------Q-ILL-------F--LHN-------V
A0A8C6VCH5_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A6I8NF73_BMF-01      ------------------------R-VLP-------L--LHN-------L
A0A8D2L6A0_BMF-01      ------------------------Q-ILL-------F--LHN-------M
A0A669PL85_BMF-02      ------------------------I-SYP----RV-V--LQK-------T
A0A8C2TYD3_BMF-05      ------------------------Q-LFL-------F--LHN-------L
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C1UAR1_BMF-01      ------------------------Q-ALM-------A--INK-------I
A0A8I3W4Q3_BMF-02      --------------------------IEV-------TRPSH---------
A0A3Q2HR24_BMF-03      ------------------------Q-TLL-------F--LHN-------L
G1PAU1_BMF-01          ------------------------Q-FLL-------F--LHN-------L
A0A8C2DDJ7_BMF-01      --------------------------VCL-------S--CRS-------V
A0A8C0PT40_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8I3W4Q3_BMF-03      ------------------------M-TFL-------Q--RHN-------Q
A0A8C0RSS3_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C2SHH9_BMF-01      ------------------------Q-ILL-------F--LHN-------V
A0A8C0PT40_BMF-03      ------------------------T-RTC-------L--SHS-------V
A0A2K6L919_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A096NTE9_BMF-02      ------------------------Q-SFG-------S------------C
A0A337ST43_BMF-05      ------------------------P-RLL---------------------
A0A7N5JI49_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A0N8EUV8_BMF-02      ------------------------Q-VLL-------F--LHN-------L
A0A8C2VBL6_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A8I3W4Q3_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A803JQ26_BMF-02      ----------------------------Y-------F--FYM-------I
A0A8D2HTN1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A287CXH0_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C0XK68_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3Q2HR24_BMF-02      ------------------------Q-TLL-------F--LHN-------L
G3T7Z4_BMF-01          ------------------------Q-ILQ-------F--LHH-------L
A0A671DWL6_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C6GZK8_BMF-01      ------------------------Q-VFL-------F--LQN-------L
A0A3Q2HR24_BMF-05      ------------------------Q-TLL-------F--LHN-------L
A0A8C5R6G2_BMF-01      ------------------------Q-IFF-------F--FRN-------L
A0A7N5JI49_BMF-03      ------------------------Q-VLL-------F--LHN-------L
A0A8C0TVZ9_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A3Q2HR24_BMF-01      ------------------------Q-TLL-------F--LHN-------L
A0A8C0RSS3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3Q2HR24_BMF-06      ------------------------Q-TLL-------F--LHN-------L
A0A7N5JI49_BMF-02      ------------------------Q-VLL-------F--LHN-------L
A0A8C6R2L6_BMF-01      ------------------------Q-VFL-------F--LHN-------L
A0A2K5KGP2_BMF-01      ------------------------V-KLF-------F--CCY-------F
A0A337ST43_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A0N8EUV8_BMF-03      ------------------------Q-VLL-------F--LHN-------L
A0A8C0TVZ9_BMF-04      ------------------------Q-ILL-------F--LHN-------L
A0A4W3JXA1_BMF-01      ------------------------R-LLV-------L--LFA-------M
A0A3Q2HR24_BMF-04      ------------------------Q-TLL-------F--LHN-------L
A0A2K5VLA3_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A673TA87_BMF-01      ------------------------Q-LLL-------F--LHN-------L
A0A8D2HTN1_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      ----------------------------F-------P--RPA-------F
A0A671M0H4_BMF-02      ------------------------I-IALCLALALVY--TKA-------F
A0A3Q2CXC4_BMF-02      ------------------------L-PPL-------P--VYF-------S
A0A672JWL9_BMF-02      ------------------------------------P--CAV-------F
A0A3P8NFE2_BMF-02      ------------------------F-------------------------
A0A673HDR4_BMF-01      ------------------------------------Y--TKV-------F
A0A8C7G467_BMF-02      ------------------------C-LSV-------P--CLF-------W
W5N4P7_BMF-01          ------------------------R-LAL-------A--LFT-------F
A0A8C4SHZ6_BMF-02      ------------------------R-MAV-------T--LLA-------F
A0A8C9VER0_BMF-01      ------------------------R-LLL-------T--LYT-------L
A0A8C4C2E0_BMF-02      ------------------------R-LAF-------A--LYT-------L
A0A3B3RH63_BMF-01      ------------------------R-LVM-------A--LCG-------L
W5UAU7_BMF-01          ------------------------R-LAS-------A--LYA-------L
Q0GKC7_BMF-01          ------------------------R-VAT-------A--VLT-------L
A0A8C7XJP0_BMF-02      ------------------------R-LAT-------A--LVS-------L
A0A3Q2PJX9_BMF-01      ------------------------R-LAA-------E--LLI-------L
A0A9J7Y9L1_BMF-01      ------------------------R-VAL-------A--VYT-------L
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A9J7Y9L1_BMF-03      ------------------------S-LGA-------A--VIHGRDGNVCM
A0A3P8UA78_BMF-01      ------------------------R-LTT-------T--LLS-------L
A0A3Q2CXC4_BMF-01      ------------------------R-MTA-------A--LLS-------L
A0A4W4DZH9_BMF-01      ------------------------R-LAS-------A--LYV-------L
A0A6F9BGV6_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A3P9K487_BMF-02      ------------------------R-LAT-------A--LVS-------L
A0A2U9CJH3_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A8C2DDJ7_BMF-02      ------------------------R-VAL-------A--VYT-------L
A0A8C7XJP0_BMF-01      ------------------------R-LAT-------A--LVS-------L
A0A9J7Y9L1_BMF-02      ---------------------------SQ-------A--LMA-------I
A0A3P9ICE1_BMF-01      ------------------------R-LAT-------A--LVS-------L
A0A3Q3RVI2_BMF-01      ---------------------------LL-------A--CLT-------L
A0A8C4C2E0_BMF-01      ------------------------R-LAF-------A--LYT-------L
A0A3Q3VLX6_BMF-01      ------------------------R-LGS-------A--LLS-------L
A0A3B5B8F6_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A8C6U3U8_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A8C1XUF5_BMF-01      ------------------------R-VAL-------A--VYT-------L
A0A8C6PNJ4_BMF-01      --------------------------VAW-------K--VPG-------L
A0A8K9UY13_BMF-01      ------------------------R-LAS-------A--LLN-------L
A0A674EF64_BMF-01      ------------------------R-LAS-------A--LFT-------L
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      ------------------------R-LGA-------A--LLS-------L
A0A672HG10_BMF-01      ------------------------R-LAT-------T--LLS-------L
A0A6F9B4C5_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A8C7JEQ7_BMF-02      ------------------------R-LTM-------A--LYG-------F
A0A3B4UNJ0_BMF-01      ------------------------R-LTM-------A--LFG-------F
A0A672RK14_BMF-01      ------------------------S-LQW-------F--LSR-------C
A0A3Q1FVH7_BMF-02      ------------------------R-LVA-------A--ILS-------L
A0A8B9MY06_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A8B9FZ48_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3Q1D1K3_BMF-01      ------------------------R-LAA-------A--VLS-------L
A0A3Q1IPR4_BMF-01      ------------------------R-LAA-------A--MLS-------L
A0A493T7X1_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A803SZ00_BMF-03      ------------------------Q-IFF-------F--LHN-------V
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A663DZQ4_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3P8NFE2_BMF-01      ------------------------R-LAA-------A--ILS-------L
A0A3B1K1X5_BMF-01      ------------------------R-LAS-------A--LYT-------L
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          ------------------------Q-ILL-------F--LHN-------V
A0A8C0EML4_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C3KIN9_BMF-02      -------------SP--------G-VV-L-------W--KTR-------S
A0A8C0JZ72_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C0PT40_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C0TVZ9_BMF-05      ------------------------T-RTC-------L--SHS-------V
A0A452F2E0_BMF-02      ------------------------Q-ILL-------F--LHN-------V
A0A8C0XK68_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C3WX89_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A8C3VHE5_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A286XXB0_BMF-01      ------------------------Q-VLL-------F--MHN-------L
A0A286XXB0_BMF-03      ------------------------Q-VLL-------F--MHN-------L
A0A286XXB0_BMF-02      ------------------------Q-VLL-------F--MHN-------L
A0A2K5RN49_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C0GH19_BMF-01      ------------------------Q-ILL-------F--IHN-------L
A0A8C3XI05_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A0D9R4R5_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C3P5Z9_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C3LTE5_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C3EY31_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A8C3EY31_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C2MZN7_BMF-02      ------------------------Q-VFL-------F--LQN-------L
A0A8C2MZN7_BMF-01      ------------------------Q-VFL-------F--LQN-------L
A0A7M4FPU2_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C3QVS1_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A9J7Z5T7_BMF-01      ------------------------R-VAL-------A--VYT-------L
A0A9J7Z5T7_BMF-02      --------------------------VCL-------S--CRS-------V
A0A9J7Z5T7_BMF-03      ------------------------Q-ALM-------A--INK-------I
A0A8C1P2N8_BMF-02      ---------------------------SQ-------A--LMA-------I
A0A8C1UAR1_BMF-02      ------------------------R-VAL-------A--VYT-------L
A0A8C4DD37_BMF-01      ------------------------R-LGA-------A--LLS-------L
A0A8C4J3Z9_BMF-03      ------------------------Q-LFL-------F--LHN-------L
A0A8C4J3Z9_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A665VG08_BMF-01      ------------------------R-LAT-------A--LLS-------L
A0A8C4MCB2_BMF-01      ------------------------Q-TLL-------F--LHN-------L
A0A8C4SHZ6_BMF-01      ------------------------R-MAV-------T--LLA-------F
A0A3P8ZIE7_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A337ST43_BMF-03      ------------------------P-RLL---------------------
U3JS06_BMF-01          ------------------------Q-LFL-------F--LHN-------L
A0A3Q2PJX9_BMF-03      ------------------------R-MTA-------A--LLS-------L
A9XRG9_BMF-01          ------------------------Q-LFL-------F--LHN-------L
A9XRH0_BMF-01          ------------------------Q-LFL-------F--LHN-------L
A0A452H3N6_BMF-01      ------------------------Q-ILL-------F--IHN-------L
A0A2I2Z168_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      ------------------------R-LAA-------T--LLG-------L
A0A0N8EUV8_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A0N8EUV8_BMF-04      ------------------------Q-VLL-------F--LHN-------L
Q96LC9_BMF-03          ------------------------Q-ILL-------F--LHN-------L
Q96LC9_BMF-06          ------------------------Q-ILL-------F--LHN-------L
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      ------------------------R-VAS-------A--LLT-------L
A0A4W5N721_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A287CXH0_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C5K765_BMF-01      ------------------------Q-VFL-------F--LHN-------L
A0A8C5K765_BMF-02      ------------------------Q-VFL-------F--LHN-------L
A0A8C5IIR3_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3Q2ZA20_BMF-01      ------------------------R-LTA-------A--LLS-------L
A0A3Q3GUU5_BMF-01      ------------------------R-LGA-------A--LLS-------L
A0A4W6DUL1_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A8C5R6G2_BMF-02      ------------------------Q-IFF-------F--FRN-------L
A0A667H967_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K5VLA3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K5VLA3_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A5F7ZML1_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A5F7ZML1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3Q3RVI2_BMF-02      ------------------------R-LAT-------A--LLS-------L
A0A803YBD7_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C6JG54_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A5F8GKJ8_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C6B0J8_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3Q3QZ16_BMF-02      ------------------------R-LAT-------T--LLS-------L
A0A8C6CWP8_BMF-01      ------------------------Q-ILL-------F--LHN-------V
Q91ZE9_BMF-06          ------------------------Q-VFL-------F--LQN-------L
Q91ZE9_BMF-01          ------------------------Q-VFL-------F--LQN-------L
Q91ZE9_BMF-02          ------------------------Q-VFL-------F--LQN-------L
M3YAD5_BMF-01          ------------------------Q-ILL-------F--LHN-------L
A0A667YNR9_BMF-01      ------------------------R-LAS-------A--LLN-------L
A0A8C6VCH5_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A8C6VCH5_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C6R2L6_BMF-02      ------------------------Q-VFL-------F--LHN-------L
A0A3Q4G1I4_BMF-01      ------------------------R-LAA-------A--ILS-------L
U6CSY8_BMF-01          ------------------------Q-ILL-------F--LHN-------L
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      ------------------------Q-LLL-------F--LHN-------L
A0A8C7FH91_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A8C7G467_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A8C7JEQ7_BMF-01      ------------------------R-LTM-------A--LYG-------F
A0A8C7RCY3_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A8C7SCN2_BMF-01      ------------------------R-LTM-------A--LYG-------F
A0A8K9UY13_BMF-02      ------------------------R-LAS-------A--LLN-------L
A0A8C8CQZ6_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A8C8F9Y2_BMF-02      ------------------------C-LSV-------P--CLF-------W
A0A8C8F9Y2_BMF-01      ------------------------R-LAS-------A--LLT-------L
A0A8C8FNK5_BMF-01      ------------------------R-LTM-------A--LYG-------F
I3K2D6_BMF-01          ------------------------R-LAA-------A--LLS-------L
G1SR62_BMF-01          ------------------------Q-ILL-------F--LHN-------L
A0A3B3HAU1_BMF-01      ------------------------R-LAT-------A--LVS-------L
A0A3B3HAU1_BMF-04      ------------------------R-LAT-------A--LVS-------L
A0A3P9ICE1_BMF-04      ------------------------R-LAT-------A--LVS-------L
A0A3P9K487_BMF-01      ------------------------R-LAT-------A--LVS-------L
A0A3B3CGR9_BMF-01      ------------------------R-LTT-------A--LVS-------L
H0WYH6_BMF-01          ------------------------Q-VLF-------F--LHN-------L
W5QFV1_BMF-01          ------------------------Q-ILL-------F--LHN-------V
A0A8C8WD49_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      ------------------------Q-ILL-------F--LHN-------L
K7FRX2_BMF-01          ------------------------Q-ILL-------F--LHN-------L
A0A8C8RL12_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A6I9LHF8_BMF-01      ------------------------Q-VFL-------F--LQN-------L
A0A8C9LTX9_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0AA35JSQ3_BMF-04      ------------------------Q-ILL-------F--LHN-------V
A0A670JUU6_BMF-05      ------------------------Q-ILL-------F--LHN-------V
A0A670JUU6_BMF-03      ------------LYP--------WP-L-S-------L--KRD-------S
A0A096LRV0_BMF-01      ------------------------R-MTA-------A--LLS-------L
A0A3P9Q8E2_BMF-01      ------------------------R-MTA-------A--LLS-------L
A0A6D2XBX1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C8ZAV1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3B4CNJ8_BMF-01      ------------------------R-LAS-------A--LYT-------L
A0A8I6GLK7_BMF-02      ------------------------Q-VFL-------F--LQN-------L
A0A8I6GLK7_BMF-01      ------------------------Q-VFL-------F--LQN-------L
Q8K589_BMF-01          ------------------------Q-VFL-------F--LQN-------L
A0A671DWL6_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      ------------------------Q-VLL-------F--LHN-------L
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      ------------------------Q-ILL-------F--LHN-------V
A0A8C9XRX5_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A7N4PJP2_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8D2AYP3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8D3CAL2_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A8C9NB87_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3B4U5H8_BMF-01      ------------------------R-LAV-------A--LLS-------L
A0A3B4WM88_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A671MNR9_BMF-01      ------------------------R-VAV-------A--FYT-------L
A0A672JWL9_BMF-01      ------------------------R-VAV-------A--FYT-------L
A0A671X848_BMF-01      ------------------------R-LGA-------A--LIN-------L
A0A8C9UST6_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A673C8N3_BMF-01      ------------------------R-LAA-------A--LLS-------L
A0A8D0LCG8_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A672V891_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A287BML0_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A287BML0_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8D0WCZ8_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A674GIP8_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A674GIP8_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3B5KWG6_BMF-02      ------------------------R-LGT-------A--LLS-------L
A0A3B5KWG6_BMF-01      ------------------------R-LGT-------A--LLS-------L
A0A3B5KWG6_BMF-03      ------------------------A-------------------------
A0A674IPL3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A452SED0_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A4X2KLG2_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3B5QK08_BMF-02      ------------------------R-MTA-------A--LLS-------L
A0A8D2PG36_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3Q1FVH7_BMF-01      ------------------------R-LVA-------A--ILS-------L
A0A8C0AW70_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C3KIN9_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C4XVG9_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3P8RKY9_BMF-01      ------------------------R-LAA-------A--VLS-------L
A0A8B9VI07_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8B9BPF5_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8B9EVW2_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C3GPS7_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3Q3C5V2_BMF-01      ------------------------R-LAA-------A--ILS-------L
A0A3P9DPJ5_BMF-01      ------------------------R-LAA-------A--ILS-------L
A0A3P9DPJ5_BMF-02      ------------------------R-LAA-------A--ILS-------L
A0A3B4ETH0_BMF-01      ------------------------R-LAA-------A--ILS-------L
A0A8B9LSW6_BMF-02      ------------------------R-LAS-------A--LYT-------L
A0A8C8B299_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8D0FU29_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C0JZ72_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C0RSS3_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A8C0TVZ9_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8I3PRV2_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A8C0TVZ9_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8I3PRV2_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8I3PRV2_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A452F2E0_BMF-01      ------------------------Q-ILL-------F--LHN-------V
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A2K6B5F6_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K6B5F6_BMF-04      ------------------------Q-ILL-------F--LHN-------L
A0A2K6B5F6_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A2K5Z4A9_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K6L919_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2K6L919_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A2K6RAW1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8D2E2Z1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C3P5Z9_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A669PL85_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C5THT3_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8C2TYD3_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A8C3N153_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A3P8UA78_BMF-03      ------------------------R-LTT-------T--LLS-------L
A0A3P8UA78_BMF-02      ------------------------R-LTT-------T--LLS-------L
A0A8C1P2N8_BMF-03      ------------------------R-VAL-------A--VYT-------L
A0A8C1P2N8_BMF-01      ------------------------S-LGA-------A--VIHGRDGNVCM
A0A3Q2PJX9_BMF-02      ------------------------R-MTA-------A--LLS-------L
A0A803YBD7_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A8C4W1J6_BMF-01      ------------------------Q-ILL-------F--IHN-------L
A0A2R9BS98_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2J8QDD5_BMF-02      ------------------------Q-ILL-------F--LHN-------L
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          ------------------------Q-ILL-------F--LHN-------L
Q96LC9_BMF-02          ------------------------Q-ILL-------F--LHN-------L
Q96LC9_BMF-04          ------------------------Q-ILL-------F--LHN-------L
A0A8C6A5T3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8D2HTN1_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A8C5IIR3_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A8D2MHD7_BMF-01      ------------------------Q-LFL-------F--LHN-------L
A0A8D2MHD7_BMF-02      ------------------------Q-LFL-------F--LHN-------L
A0A8C8WD49_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C9IYS3_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A5F7ZML1_BMF-03      ------------------------Q-ILL-------F--LHN-------L
A0A8C5UXV9_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A8C9BKQ1_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A2U4BC98_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3Q3QZ16_BMF-01      ------------------------R-LAT-------T--LLS-------L
A0A8C6GZK8_BMF-02      ------------------------Q-VFL-------F--LQN-------L
A0A8C6GZK8_BMF-03      ------------------------Q-VFL-------F--LQN-------L
A0A670XMZ5_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3B3HAU1_BMF-02      ------------------------R-LAT-------A--LVS-------L
A0A3B3HAU1_BMF-03      ------------------------R-LAT-------A--LVS-------L
A0A3P9ICE1_BMF-03      ------------------------R-LAT-------A--LVS-------L
A0A3P9ICE1_BMF-05      ------------------------R-LAT-------A--LVS-------L
A0A3P9ICE1_BMF-02      ------------------------R-LAT-------A--LVS-------L
A0A3B3WU80_BMF-01      ------------------------R-MTA-------A--LLS-------L
A0A2K6TW78_BMF-01      ------------------------Q-VLL-------F--LHN-------L
A0A671M0H4_BMF-01      ------------------------I-IALCLALALVY--TKA-------F
A0A8D0WCZ8_BMF-02      ------------------------Q-ILL-------F--LHN-------L
A0A8D0WCZ8_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A384D070_BMF-01      ------------------------Q-ILL-------F--LHN-------L
A0A3B5QK08_BMF-01      ------------------------R-MTA-------A--LLS-------L
                                                                         

A0A8C9QDA0_BMF-01      V-L-----SA----------------------V-E----A-R--G-V---
A0A673JJ10_BMF-01      A-M-----TS----------------------S-S----V-I--S-M---
A0A803SZ00_BMF-01      --------KQ----------------------R-I------E--L-N---
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      AGR-----PK----------------------R-L----Q-C--L-S---
A0A493T7X1_BMF-01      --------WV----------------------P-A------P--V-T---
A0A670JUU6_BMF-01      A-L-----NM----------------------E-A----N-R--H-H---
A0A8C2TYD3_BMF-03      A-Q-----RQ----------------------S-V----L-P--E-R---
A0A8B9VI07_BMF-02      RHQ-----PS----------------------R-L----L----------
A0A670JUU6_BMF-04      DGG-----VL----------------------E-Q------E--V-H---
A0A8C0U4T1_BMF-01      --------LL----------------------I-L------E--I-T---
A0A8C5ST95_BMF-01      -----------------------------------------L--------
A0A803SZ00_BMF-02      A-L-----NM----------------------E-A----N-R--H-R---
A0A8C9F3R5_BMF-01      A-L-----NV----------------------E-A----N-R--N-R---
A0A337ST43_BMF-02      -----------------------------------------R--K-D---
A0A337ST43_BMF-04      A-L-----NA----------------------E-E----N-R--N-G---
A0A8B9NX34_BMF-01      A-L-----NG----------------------E-A----N-R--N-H---
A0A803JQ26_BMF-01      ----------------------------------------------A---
A0A674GIP8_BMF-03      ----------------------------------------------Y---
A0A8B9VI07_BMF-03      A-L-----NV----------------------E-A----N-R--N-H---
A0A8C4J3Z9_BMF-02      L-Y-----VC----------------------E-S----P-S--R-S---
A0A8C6JG54_BMF-02      --I-----QE----------------------H-C----S-R-RL-A---
A0A8B9MY06_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A663MPI8_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A8C9F3R5_BMF-02      ---------I----------------------T-E----N-D--E-Q---
A0A8C4J3Z9_BMF-04      A-L-----NV----------------------E-A----N-R--N-H---
A0A8C2TYD3_BMF-04      A-L-----NV----------------------E-A----N-R--N-R---
A0AA35JSQ3_BMF-01      A-L-----NM----------------------E-A----N-R--H-H---
A0A8C6VCH5_BMF-01      A-L-----NV----------------------E-A----N-R--Q-R---
A0A6I8NF73_BMF-01      A-L-----GM----------------------E-E----N-G--Q-G---
A0A8D2L6A0_BMF-01      A-L-----NM----------------------E-A----N-R--H-R---
A0A669PL85_BMF-02      G-S-----RL----------------------Q-L------S--N-G---
A0A8C2TYD3_BMF-05      A-L-----NV----------------------E-A----N-R--N-R---
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C1UAR1_BMF-01      V-------------------------------E-P----F-V--S-T---
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      A-L-----NG----------------------D-E----N-R--N-G---
G1PAU1_BMF-01          A-L-----NG----------------------D-E----N-R--N-G---
A0A8C2DDJ7_BMF-01      W-M-----VA----------------------C-----------L-G---
A0A8C0PT40_BMF-02      A-L-----NA----------------------D-E----N-R--N-G---
A0A8I3W4Q3_BMF-03      E-MPSWALNPKTRRRRQDFAWEVRGRQGLGREE-K----K-R--S-G---
A0A8C0RSS3_BMF-02      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C2SHH9_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A8C0PT40_BMF-03      S-A-----GT-------PRAWS-RG-LGLGC-C-G----S-G--E-L---
A0A2K6L919_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A096NTE9_BMF-02      G-C-----HG----------------------Q-D----G-P--N-WMSI
A0A337ST43_BMF-05      --------------------------------------------------
A0A7N5JI49_BMF-01      A-L-----NA----------------------D-E----N-R--N-G---
A0A0N8EUV8_BMF-02      G-P-----NG----------------------E-E----N-R--E-G---
A0A8C2VBL6_BMF-01      G-L-----NG----------------------E-E----N-R--E-G---
A0A8I3W4Q3_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      A-L-----NG----------------------D-E----N-R--D-R---
A0A287CXH0_BMF-01      A-L-----NG----------------------D-E----N-R--D-R---
A0A8C0XK68_BMF-01      A-L-----NR----------------------G-E----N-R--D-G---
A0A3Q2HR24_BMF-02      A-L-----NG----------------------D-E----N-R--N-G---
G3T7Z4_BMF-01          A-V-----NG----------------------E-E----N-R--N-G---
A0A671DWL6_BMF-02      A-L-----NG----------------------D-E----N-R--N-G---
A0A8C6GZK8_BMF-01      A-L-----NR----------------------Q-E----N-R--E-G---
A0A3Q2HR24_BMF-05      A-L-----NG----------------------D-E----N-R--N-G---
A0A8C5R6G2_BMF-01      V-I-----QN----------------------E-R----N-R--G-E---
A0A7N5JI49_BMF-03      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C0TVZ9_BMF-03      A-L-----NA----------------------D-E----N-R--N-G---
A0A3Q2HR24_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A8C0RSS3_BMF-01      A-L-----NA----------------------D-E----N-R--N-G---
A0A3Q2HR24_BMF-06      A-L-----NG----------------------D-E----N-R--N-G---
A0A7N5JI49_BMF-02      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C6R2L6_BMF-01      A-L-----NR----------------------E-G----N-R--D-G---
A0A2K5KGP2_BMF-01      A-F-----------------------------------------------
A0A337ST43_BMF-01      A-L-----NA----------------------E-E----N-R--N-G---
A0A0N8EUV8_BMF-03      G-P-----NG----------------------E-E----N-R--E-G---
A0A8C0TVZ9_BMF-04      A-L-----NA----------------------D-E----N-R--N-G---
A0A4W3JXA1_BMF-01      I-F-----DP----------------------E-E----N-R--A-M---
A0A3Q2HR24_BMF-04      A-L-----NG----------------------D-E----N-R--N-G---
A0A2K5VLA3_BMF-03      A-L-----NG----------------------E-E----N-R--N-G---
A0A673TA87_BMF-01      A-L-----NA----------------------E-E----N-R--N-G---
A0A8D2HTN1_BMF-02      A-L-----NG----------------------D-E----N-R--D-R---
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      V-L------------------------------------A-RHFL-Q---
A0A671M0H4_BMF-02      S-M------------------------------------C-RVCF-G---
A0A3Q2CXC4_BMF-02      L-L-----SP----------------------V------V-PLCC-G---
A0A672JWL9_BMF-02      V-L------------------------------------A-GLFPDS---
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      S-V------------------------------------C-RVCF-G---
A0A8C7G467_BMF-02      L-V-----SE----------------------H-A-LAQCSDLSF-Y---
W5N4P7_BMF-01          L-F-----ER----------------------Q-G-NR-N-Q--L-R---
A0A8C4SHZ6_BMF-02      L-F-----DR----------------------D-A-GP-N------R---
A0A8C9VER0_BMF-01      L-F-----ER----------------------E-G-VV-R-Q--Q-R---
A0A8C4C2E0_BMF-02      I-F-----ER----------------------D-A-VG-V-Q--G-R---
A0A3B3RH63_BMF-01      L-F-----ER----------------------R-Q-----------R---
W5UAU7_BMF-01          L-F-----DG----------------------E-P-AVHR-R--R-Q---
Q0GKC7_BMF-01          L-F-----GA------------------------------------R---
A0A8C7XJP0_BMF-02      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3Q2PJX9_BMF-01      C-E-----F-----------------------------------------
A0A9J7Y9L1_BMF-01      V-F-----GR----------------------E-A-EA--------R---
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      L-F-----EQ----------------------E-A-IA-G-G--E-R---
A0A9J7Y9L1_BMF-03      I-K-----TR----------------------Q-N-IG-A-TPSM-R---
A0A3P8UA78_BMF-01      L-F-----NR----------------------G-F-FA-G-G--G-A---
A0A3Q2CXC4_BMF-01      L-F-----DR----------------------G-L-IG--------G---
A0A4W4DZH9_BMF-01      L-F-----ER----------------------E-P-AA-R-W--R-G---
A0A6F9BGV6_BMF-01      L-F-----EQ----------------------E-A-IA-G-R--G-----
A0A3P9K487_BMF-02      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A2U9CJH3_BMF-01      L-F-----DR----------------------G-F-LA-G-G--G-G---
A0A8C2DDJ7_BMF-02      L-F-----GR----------------------E-A-EA--------R---
A0A8C7XJP0_BMF-01      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A9J7Y9L1_BMF-02      N-K-----IV----------------------EPF-VS--------T---
A0A3P9ICE1_BMF-01      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3Q3RVI2_BMF-01      I------------------------------------T-G-V--W-----
A0A8C4C2E0_BMF-01      I-F-----ER----------------------D-A-VG-V-Q--G-R---
A0A3Q3VLX6_BMF-01      L-F-----DR----------------------G-F-FA-G-G--G-G---
A0A3B5B8F6_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A8C6U3U8_BMF-01      L-L-----DR----------------------GGF-MA-G-GGRG-A---
A0A8C1XUF5_BMF-01      V-F-----GR----------------------E-A-EA--------R---
A0A8C6PNJ4_BMF-01      E-C-----YT----------------------E-------------V---
A0A8K9UY13_BMF-01      L-F-----EQ----------------------E-A-ID-G-R--G-R---
A0A674EF64_BMF-01      L-F-----EQ----------------------E-A-IA-G-R--G-R---
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      L-F-----DR----------------------G-F-IA-G-R--G-G---
A0A672HG10_BMF-01      L-F-----DR----------------------G-V-IA-G-GGGG-G---
A0A6F9B4C5_BMF-01      L-F-----EQ----------------------E-A-VA-G-G--G-R---
A0A8C7JEQ7_BMF-02      L-F-----NR----------------------E-APAV-P-R--L-R---
A0A3B4UNJ0_BMF-01      L-F-----PR----------------------Q-A-LV-P-R--L-R---
A0A672RK14_BMF-01      A-M-----TS----------------------S-S--V-I-S--M-L---
A0A3Q1FVH7_BMF-02      L-F-----DG----------------------G-F-IA-G-G--G-G---
A0A8B9MY06_BMF-02      A-L-----NA----------------------E-A----N-R--N-H---
A0A8B9FZ48_BMF-01      A-L-----NA----------------------E-V----N-R--N-H---
A0A3Q1D1K3_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A3Q1IPR4_BMF-01      L-F-----DR----------------------G-L-IA-G-G--G-G---
A0A493T7X1_BMF-02      A-L-----NV----------------------E-A----N-R--N-H---
A0A803SZ00_BMF-03      A-L-----NM----------------------E-A----N-R--H-R---
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A663DZQ4_BMF-01      A-L-----NA----------------------E-V----N-R--N-H---
A0A3P8NFE2_BMF-01      L-F-----DR----------------------G-F-IA-G-GGGG-----
A0A3B1K1X5_BMF-01      L-F-----ER----------------------E-P-AA-H-G--R-R---
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          A-L-----NG----------------------D-E----N-R--N-G---
A0A8C0EML4_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A8C3KIN9_BMF-02      RHQ-----LS----------------------R-P----L----------
A0A8C0JZ72_BMF-02      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C0PT40_BMF-01      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C0TVZ9_BMF-05      S-A-----GT-------PRAWS-RG-LGLGC-C-G----S-G--E-L---
A0A452F2E0_BMF-02      A-L-----NG----------------------D-E----N-R--N-G---
A0A8C0XK68_BMF-02      A-L-----NR----------------------G-E----N-R--D-G---
A0A8C3WX89_BMF-01      A-L-----HG----------------------D-E----N-R--N-G---
A0A8C3VHE5_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A286XXB0_BMF-01      G-L-----NG----------------------E-E----N-R--E-G---
A0A286XXB0_BMF-03      G-L-----NG----------------------E-E----N-R--E-G---
A0A286XXB0_BMF-02      G-L-----NG----------------------E-E----N-R--E-G---
A0A2K5RN49_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A8C0GH19_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A8C3XI05_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A0D9R4R5_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A8C3P5Z9_BMF-02      A-L-----NV----------------------E-A----N-R--N-H---
A0A8C3LTE5_BMF-01      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C3EY31_BMF-02      A-L-----NA----------------------E-V----N-R--N-H---
A0A8C3EY31_BMF-01      A-L-----NA----------------------E-V----N-R--N-H---
A0A8C2MZN7_BMF-02      A-L-----NR----------------------E-E----N-R--E-G---
A0A8C2MZN7_BMF-01      A-L-----NR----------------------E-E----N-R--E-G---
A0A7M4FPU2_BMF-01      A-L-----NV----------------------E-A----N-R--N-Q---
A0A8C3QVS1_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A9J7Z5T7_BMF-01      L-F-----GR----------------------E-A-EA--------R---
A0A9J7Z5T7_BMF-02      W-M-----VA----------------------C-----------L-C---
A0A9J7Z5T7_BMF-03      V-------------------------------E-P----F-V--S-T---
A0A8C1P2N8_BMF-02      N-K-----IV----------------------EPF-VS--------T---
A0A8C1UAR1_BMF-02      L-F-----GR----------------------E-A-EA--------R---
A0A8C4DD37_BMF-01      L-F-----DR----------------------G-F-IA-G-R--G-G---
A0A8C4J3Z9_BMF-03      A-L-----NV----------------------E-A----N-R--N-H---
A0A8C4J3Z9_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A665VG08_BMF-01      L-F-----DR----------------------G-L-IA-G-G--G-G---
A0A8C4MCB2_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A8C4SHZ6_BMF-01      L-F-----DR----------------------D-A-GP-N------R---
A0A3P8ZIE7_BMF-01      L-W-----EQ----------------------E-A-VA-G-G--G-R---
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          A-L-----NT----------------------E-V----N-R--N-H---
A0A3Q2PJX9_BMF-03      L-L-----DR----------------------G-F-VA-G-R--G-G---
A9XRG9_BMF-01          A-L-----NV----------------------E-A----N-R--N-R---
A9XRH0_BMF-01          A-L-----NV----------------------E-A----N-R--N-R---
A0A452H3N6_BMF-01      A-L-----NV----------------------E-V----N-R--N-H---
A0A2I2Z168_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A0N8EUV8_BMF-01      G-P-----NG----------------------E-E----N-R--E-G---
A0A0N8EUV8_BMF-04      G-P-----NG----------------------E-E----N-R--E-G---
Q96LC9_BMF-03          A-L-----NG----------------------E-E----N-R--N-G---
Q96LC9_BMF-06          A-L-----NG----------------------E-E----N-R--N-G---
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      L-F-----EQ----------------------E-A-IA-G-G--G-R---
A0A4W5N721_BMF-01      L-F-----EQ----------------------E-A-IA-G-G--G-R---
A0A287CXH0_BMF-02      A-L-----NG----------------------D-E----N-R--D-R---
A0A8C5K765_BMF-01      A-L-----NR----------------------E-E----N-R--D-G---
A0A8C5K765_BMF-02      A-L-----NR----------------------E-E----N-R--D-G---
A0A8C5IIR3_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A3Q2ZA20_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A3Q3GUU5_BMF-01      L-F-----DR----------------------G-F-IA-G----------
A0A4W6DUL1_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A8C5R6G2_BMF-02      V-I-----QN----------------------E-R----N-R--G-E---
A0A667H967_BMF-01      A-L-----NA----------------------E-E----N-R--N-G---
A0A2K5VLA3_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K5VLA3_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A5F7ZML1_BMF-02      A-L-----NG----------------------E-Q----N-R--N-G---
A0A5F7ZML1_BMF-01      A-L-----NG----------------------E-Q----N-R--N-G---
A0A3Q3RVI2_BMF-02      L-F-----DR----------------------G-F-IA-G-G--G-R---
A0A803YBD7_BMF-01      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C6JG54_BMF-01      A-L-----NA----------------------E-V----N-R--N-H---
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A5F8GKJ8_BMF-01      A-L-----NR----------------------E-E----N-R--N-G---
A0A8C6B0J8_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A3Q3QZ16_BMF-02      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A8C6CWP8_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
Q91ZE9_BMF-06          A-L-----NR----------------------Q-E----N-R--E-G---
Q91ZE9_BMF-01          A-L-----NR----------------------Q-E----N-R--E-G---
Q91ZE9_BMF-02          A-L-----NR----------------------Q-E----N-R--E-G---
M3YAD5_BMF-01          A-L-----NA----------------------D-E----N-R--N-G---
A0A667YNR9_BMF-01      L-F-----DR----------------------G-A-FA-G-G--G-G---
A0A8C6VCH5_BMF-03      A-L-----NV----------------------E-A----N-R--Q-R---
A0A8C6VCH5_BMF-02      A-L-----NV----------------------E-A----N-R--Q-R---
A0A8C6R2L6_BMF-02      A-L-----NR----------------------E-G----N-R--D-G---
A0A3Q4G1I4_BMF-01      L-F-----DR----------------------G-F-IA-G-GGGG-----
U6CSY8_BMF-01          A-L-----NA----------------------D-G----N-R--N-G---
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C7FH91_BMF-01      L-F-----EQ----------------------E-A-IA-G-R--G-R---
A0A8C7G467_BMF-01      L-F-----EQ----------------------E-A-IA-G-G--G-R---
A0A8C7JEQ7_BMF-01      L-F-----NR----------------------E-APAV-P-R--L-R---
A0A8C7RCY3_BMF-01      L-F-----EQ----------------------E-A-IA-G-G--G-R---
A0A8C7SCN2_BMF-01      L-F-----NR----------------------E-APAV-P-H--L-R---
A0A8K9UY13_BMF-02      L-F-----EQ----------------------E-A-ID-G-R--G-R---
A0A8C8CQZ6_BMF-01      L-F-----EQ----------------------E-A-IA-G-R--G-R---
A0A8C8F9Y2_BMF-02      L-V-----SE----------------------H-A-LAQCSDLSF-Y---
A0A8C8F9Y2_BMF-01      L-F-----EQ----------------------E-A-IA-G-G--G-R---
A0A8C8FNK5_BMF-01      L-F-----NR----------------------E-APAV-P-H--L-R---
I3K2D6_BMF-01          L-F-----DR----------------------G-F-IA-G-GGGG-----
G1SR62_BMF-01          A-L-----NG----------------------D-E----N-R--D-G---
A0A3B3HAU1_BMF-01      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3B3HAU1_BMF-04      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3P9ICE1_BMF-04      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3P9K487_BMF-01      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3B3CGR9_BMF-01      L-L-----DR----------------------G-F-IA-G-G--G-G---
H0WYH6_BMF-01          A-L-----NG----------------------E-E----N-R--N-G---
W5QFV1_BMF-01          A-L-----NG----------------------D-E----N-R--N-G---
A0A8C8WD49_BMF-02      A-L-----NA----------------------E-E----N-R--N-G---
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
K7FRX2_BMF-01          A-L-----NV----------------------E-A----N-R--N-H---
A0A8C8RL12_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A6I9LHF8_BMF-01      A-L-----NR----------------------E-E----N-R--E-G---
A0A8C9LTX9_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0AA35JSQ3_BMF-04      A-L-----NM----------------------E-A----N-R--H-H---
A0A670JUU6_BMF-05      A-L-----NM----------------------E-A----N-R--H-H---
A0A670JUU6_BMF-03      AGR-----PK----------------------R-L----Q-C--L-S---
A0A096LRV0_BMF-01      L-F-----HR----------------------G-F-IA-G-G--G-G---
A0A3P9Q8E2_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A6D2XBX1_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A8C8ZAV1_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A3B4CNJ8_BMF-01      L-F-----ER----------------------E-P-VA-N-G--R-R---
A0A8I6GLK7_BMF-02      A-L-----NR----------------------R-E----N-R--E-G---
A0A8I6GLK7_BMF-01      A-L-----NR----------------------R-E----N-R--E-G---
Q8K589_BMF-01          A-L-----NR----------------------R-E----N-R--E-G---
A0A671DWL6_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      A-L-----NM----------------------E-A----N-R--H-H---
A0A8C9XRX5_BMF-01      L-F-----DR----------------------G-F-ID-G-G--G-G---
A0A7N4PJP2_BMF-01      A-L-----NR----------------------E-E----N-R--N-G---
A0A8D2AYP3_BMF-01      A-L-----NG----------------------D-E----N-R--D-G---
A0A8D3CAL2_BMF-01      L-F-----DR----------------------G-F-LA-G-G--G-G---
A0A8C9NB87_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A3B4U5H8_BMF-01      L-F-----DR----------------------G-L-IA-G-G--G-G---
A0A3B4WM88_BMF-01      L-F-----DR----------------------G-L-IA-G-G--G-G---
A0A671MNR9_BMF-01      L-F-----GR----------------------E-P-NA--------R---
A0A672JWL9_BMF-01      L-F-----GR----------------------E-P-NA--------R---
A0A671X848_BMF-01      L-F-----DR----------------------R-F-IA-G-G--G-G---
A0A8C9UST6_BMF-01      A-L-----NG----------------------D-E----N-R--D-R---
A0A673C8N3_BMF-01      L-F-----DR----------------------G-F-IA-G-R--G-G---
A0A8D0LCG8_BMF-01      A-L-----NV----------------------E-A----N-R--H-H---
A0A672V891_BMF-01      A-L-----NA----------------------E-V----N-R--N-H---
A0A287BML0_BMF-01      A-L-----HG----------------------D-E----N-R--N-G---
A0A287BML0_BMF-02      A-L-----HG----------------------D-E----N-R--N-G---
A0A8D0WCZ8_BMF-03      A-L-----HG----------------------D-E----N-R--N-G---
A0A674GIP8_BMF-02      A-L-----NT----------------------E-V----N-R--N-H---
A0A674GIP8_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A3B5KWG6_BMF-02      L-F-----DR----------------------G-F-VA-G-G--G-G---
A0A3B5KWG6_BMF-01      L-F-----DR----------------------G-F-VA-G-G--G-G---
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      A-L-----NV----------------------E-A----N-R--N-N---
A0A452SED0_BMF-01      A-L-----NA----------------------D-E----N-R--D-G---
A0A4X2KLG2_BMF-01      A-L-----NR----------------------E-E----N-R--N-G---
A0A3B5QK08_BMF-02      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A8D2PG36_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A3Q1FVH7_BMF-01      L-F-----DG----------------------G-F-IA-G-G--G-G---
A0A8C0AW70_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A8C3KIN9_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A8C4XVG9_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A3P8RKY9_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A8B9VI07_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A8B9BPF5_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A8B9EVW2_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A8C3GPS7_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A3Q3C5V2_BMF-01      L-F-----DR----------------------G-F-IA-G-GGGG-----
A0A3P9DPJ5_BMF-01      L-F-----DR----------------------G-F-IA-G-GGGG-----
A0A3P9DPJ5_BMF-02      L-F-----DR----------------------G-F-IA-G-GGGG-----
A0A3B4ETH0_BMF-01      L-F-----DR----------------------G-F-IA-G-GGGG-----
A0A8B9LSW6_BMF-02      L-F-----ER----------------------E-P-AA-H-G--R-R---
A0A8C8B299_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A8D0FU29_BMF-01      A-L-----NA----------------------E-A----N-R--N-H---
A0A8C0JZ72_BMF-01      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C0RSS3_BMF-03      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C0TVZ9_BMF-02      A-L-----NA----------------------D-E----N-R--N-G---
A0A8I3PRV2_BMF-03      A-L-----NA----------------------D-E----N-R--N-G---
A0A8C0TVZ9_BMF-01      A-L-----NA----------------------D-E----N-R--N-G---
A0A8I3PRV2_BMF-02      A-L-----NA----------------------D-E----N-R--N-G---
A0A8I3PRV2_BMF-01      A-L-----NA----------------------D-E----N-R--N-G---
A0A452F2E0_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6B5F6_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6B5F6_BMF-04      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6B5F6_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K5Z4A9_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6L919_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6L919_BMF-03      A-L-----NG----------------------E-E----N-R--N-G---
A0A2K6RAW1_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A8D2E2Z1_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A8C3P5Z9_BMF-01      A-L-----NV----------------------E-A----N-R--N-H---
A0A669PL85_BMF-01      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C5THT3_BMF-01      A-L-----NA----------------------E-V----N-R--N-H---
A0A8C2TYD3_BMF-02      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C3N153_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A3P8UA78_BMF-03      L-F-----NR----------------------G-F-FA-G-G--G-A---
A0A3P8UA78_BMF-02      L-F-----NR----------------------G-F-FA-G-G--G-A---
A0A8C1P2N8_BMF-03      V-F-----GR----------------------E-A-EA--------R---
A0A8C1P2N8_BMF-01      I-K-----TR----------------------Q-N-IG-A-TPSM-R---
A0A3Q2PJX9_BMF-02      L-L-----DR----------------------G-F-VA-G-R--G-G---
A0A803YBD7_BMF-02      A-L-----NV----------------------E-A----N-R--N-R---
A0A8C4W1J6_BMF-01      A-L-----NV----------------------E-V----N-R--N-H---
A0A2R9BS98_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A2J8QDD5_BMF-02      A-L-----NG----------------------E-E----N-R--N-G---
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          A-L-----NG----------------------E-E----N-R--N-G---
Q96LC9_BMF-02          A-L-----NG----------------------E-E----N-R--N-G---
Q96LC9_BMF-04          A-L-----NG----------------------E-E----N-R--N-G---
A0A8C6A5T3_BMF-01      A-L-----NG----------------------D-E----N-R--D-R---
A0A8D2HTN1_BMF-03      A-L-----NG----------------------D-E----N-R--D-R---
A0A8C5IIR3_BMF-02      A-L-----NT----------------------E-V----N-R--N-H---
A0A8D2MHD7_BMF-01      A-L-----NT----------------------E-V----N-R--N-H---
A0A8D2MHD7_BMF-02      A-L-----NT----------------------E-V----N-R--N-H---
A0A8C8WD49_BMF-01      A-L-----NA----------------------E-E----N-R--N-G---
A0A8C9IYS3_BMF-01      A-L-----NA----------------------E-E----N-R--N-G---
A0A5F7ZML1_BMF-03      A-L-----NG----------------------E-Q----N-R--N-G---
A0A8C5UXV9_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A8C9BKQ1_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A2U4BC98_BMF-01      A-L-----NG----------------------D-E----N-R--N-G---
A0A3Q3QZ16_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
A0A8C6GZK8_BMF-02      A-L-----NR----------------------Q-E----N-R--E-G---
A0A8C6GZK8_BMF-03      A-L-----NR----------------------Q-E----N-R--E-G---
A0A670XMZ5_BMF-01      A-L-----NV----------------------E-A----N-R--Q-R---
A0A3B3HAU1_BMF-02      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3B3HAU1_BMF-03      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3P9ICE1_BMF-03      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3P9ICE1_BMF-05      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3P9ICE1_BMF-02      L-F-----DR----------------------G-F-IA-G-A--G-G---
A0A3B3WU80_BMF-01      L-F-----HR----------------------G-F-IA-G-G--G-G---
A0A2K6TW78_BMF-01      A-L-----NG----------------------E-E----N-R--N-G---
A0A671M0H4_BMF-01      S-M------------------------------------C-RVCF-G---
A0A8D0WCZ8_BMF-02      A-L-----HG----------------------D-E----N-R--N-G---
A0A8D0WCZ8_BMF-01      A-L-----HG----------------------D-E----N-R--N-G---
A0A384D070_BMF-01      A-L-----NA----------------------D-E----N-R--D-G---
A0A3B5QK08_BMF-01      L-F-----DR----------------------G-F-IA-G-G--G-G---
                                                                         

A0A8C9QDA0_BMF-01      ---------------W-L--------------------------------
A0A673JJ10_BMF-01      ---------------L----------------------------------
A0A803SZ00_BMF-01      ---------------G----------------------------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      ---------------P----------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      ---------------A----------------------------------
A0A8C2TYD3_BMF-03      ---------------S----------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      ---------------P----------------------------------
A0A8C0U4T1_BMF-01      ---------------S----------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      ---------------A----------------------------------
A0A8C9F3R5_BMF-01      ---------------T----------------------------------
A0A337ST43_BMF-02      ---------------I----------------------------------
A0A337ST43_BMF-04      ---------------A----------------------------------
A0A8B9NX34_BMF-01      ---------------T----------------------------------
A0A803JQ26_BMF-01      ---------------S----------------------------------
A0A674GIP8_BMF-03      ---------------T----------------------------------
A0A8B9VI07_BMF-03      ---------------T----------------------------------
A0A8C4J3Z9_BMF-02      ---------------S----------------------------------
A0A8C6JG54_BMF-02      ---------------P----------------------------------
A0A8B9MY06_BMF-01      ---------------T----------------------------------
A0A663MPI8_BMF-01      ---------------T----------------------------------
A0A8C9F3R5_BMF-02      ---------------P----------------------------------
A0A8C4J3Z9_BMF-04      ---------------T----------------------------------
A0A8C2TYD3_BMF-04      ---------------T----------------------------------
A0AA35JSQ3_BMF-01      ---------------A----------------------------------
A0A8C6VCH5_BMF-01      ---------------V----------------------------------
A0A6I8NF73_BMF-01      ---------------G----------------------------------
A0A8D2L6A0_BMF-01      ---------------A----------------------------------
A0A669PL85_BMF-02      ---------------L----------------------------------
A0A8C2TYD3_BMF-05      ---------------T----------------------------------
A3KND0_BMF-01          ---------------L----------------------------------
A0A8C2TYD3_BMF-01      ---------------T----------------------------------
A0A8C1UAR1_BMF-01      ---------------S----------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      ---------------A----------------------------------
G1PAU1_BMF-01          ---------------A----------------------------------
A0A8C2DDJ7_BMF-01      ---------------A----------------------------------
A0A8C0PT40_BMF-02      ---------------A----------------------------------
A0A8I3W4Q3_BMF-03      ---------------E----------------------------------
A0A8C0RSS3_BMF-02      ---------------A----------------------------------
A0A8C2SHH9_BMF-01      ---------------A----------------------------------
A0A8C0PT40_BMF-03      ---------------G----------------------------------
A0A2K6L919_BMF-02      ---------------A----------------------------------
A0A096NTE9_BMF-02      LPSSLSSTLVNCPLST----------------------------------
A0A337ST43_BMF-05      --------------------------------------------------
A0A7N5JI49_BMF-01      ---------------A----------------------------------
A0A0N8EUV8_BMF-02      ---------------A----------------------------------
A0A8C2VBL6_BMF-01      ---------------V----------------------------------
A0A8I3W4Q3_BMF-01      ---------------A----------------------------------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      ---------------A----------------------------------
A0A287CXH0_BMF-01      ---------------A----------------------------------
A0A8C0XK68_BMF-01      ---------------A----------------------------------
A0A3Q2HR24_BMF-02      ---------------A----------------------------------
G3T7Z4_BMF-01          ---------------A----------------------------------
A0A671DWL6_BMF-02      ---------------A----------------------------------
A0A8C6GZK8_BMF-01      ---------------V----------------------------------
A0A3Q2HR24_BMF-05      ---------------A----------------------------------
A0A8C5R6G2_BMF-01      ---------------V----------------------------------
A0A7N5JI49_BMF-03      ---------------A----------------------------------
A0A8C0TVZ9_BMF-03      ---------------A----------------------------------
A0A3Q2HR24_BMF-01      ---------------A----------------------------------
A0A8C0RSS3_BMF-01      ---------------A----------------------------------
A0A3Q2HR24_BMF-06      ---------------A----------------------------------
A0A7N5JI49_BMF-02      ---------------A----------------------------------
A0A8C6R2L6_BMF-01      ---------------A----------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      ---------------A----------------------------------
A0A0N8EUV8_BMF-03      ---------------A----------------------------------
A0A8C0TVZ9_BMF-04      ---------------A----------------------------------
A0A4W3JXA1_BMF-01      ---------------P----------------------------------
A0A3Q2HR24_BMF-04      ---------------A----------------------------------
A0A2K5VLA3_BMF-03      ---------------A----------------------------------
A0A673TA87_BMF-01      ---------------A----------------------------------
A0A8D2HTN1_BMF-02      ---------------A----------------------------------
A0A668TQU8_BMF-01      ---------------D----------------------------------
A0A8B9LSW6_BMF-01      ---------------Q----------------------------------
A0A671M0H4_BMF-02      ---------------R----------------------------------
A0A3Q2CXC4_BMF-02      ---------------G----------------------------------
A0A672JWL9_BMF-02      ---------------G----------------------------------
A0A3P8NFE2_BMF-02      ---------------L----------------------------------
A0A673HDR4_BMF-01      ---------------R----------------------------------
A0A8C7G467_BMF-02      ---------------P----------------------------------
W5N4P7_BMF-01          ---------------G----------------------------------
A0A8C4SHZ6_BMF-02      ---------------M----------------------------------
A0A8C9VER0_BMF-01      ---------------G----------------------------------
A0A8C4C2E0_BMF-02      ---------------G----------------------------------
A0A3B3RH63_BMF-01      ---------------A----------------------------------
W5UAU7_BMF-01          ---------------E----------------------------------
Q0GKC7_BMF-01          ---------------E----------------------------------
A0A8C7XJP0_BMF-02      ---------------A----------------------------------
A0A3Q2PJX9_BMF-01      ---------------P----------------------------------
A0A9J7Y9L1_BMF-01      ---------------E----------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      ---------------A----------------------------------
A0A9J7Y9L1_BMF-03      ---------------F----------------------------------
A0A3P8UA78_BMF-01      ---------------A----------------------------------
A0A3Q2CXC4_BMF-01      ---------------A----------------------------------
A0A4W4DZH9_BMF-01      ---------------V----------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      ---------------A----------------------------------
A0A2U9CJH3_BMF-01      ---------------A----------------------------------
A0A8C2DDJ7_BMF-02      ---------------A----------------------------------
A0A8C7XJP0_BMF-01      ---------------A----------------------------------
A0A9J7Y9L1_BMF-02      ---------------S----------------------------------
A0A3P9ICE1_BMF-01      ---------------A----------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------GLEQRAGGVRGRPVVSTVSYPGFTCRTTFLAKTTAA
A0A3Q3VLX6_BMF-01      ---------------A----------------------------------
A0A3B5B8F6_BMF-01      ---------------A----------------------------------
A0A8C6U3U8_BMF-01      ---------------A----------------------------------
A0A8C1XUF5_BMF-01      ---------------E----------------------------------
A0A8C6PNJ4_BMF-01      ---------------T----------------------------------
A0A8K9UY13_BMF-01      ---------------A----------------------------------
A0A674EF64_BMF-01      ---------------A----------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      ---------------A----------------------------------
A0A672HG10_BMF-01      ---------------A----------------------------------
A0A6F9B4C5_BMF-01      ---------------A----------------------------------
A0A8C7JEQ7_BMF-02      ---------------G----------------------------------
A0A3B4UNJ0_BMF-01      ---------------G----------------------------------
A0A672RK14_BMF-01      ---------------H----------------------------------
A0A3Q1FVH7_BMF-02      ---------------A----------------------------------
A0A8B9MY06_BMF-02      ---------------T----------------------------------
A0A8B9FZ48_BMF-01      ---------------T----------------------------------
A0A3Q1D1K3_BMF-01      ---------------A----------------------------------
A0A3Q1IPR4_BMF-01      ---------------A----------------------------------
A0A493T7X1_BMF-02      ---------------T----------------------------------
A0A803SZ00_BMF-03      ---------------A----------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      ---------------A----------------------------------
A0A663DZQ4_BMF-01      ---------------T----------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      ---------------E----------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          ---------------A----------------------------------
A0A8C0EML4_BMF-01      ---------------T----------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      ---------------A----------------------------------
A0A8C0PT40_BMF-01      ---------------A----------------------------------
A0A8C0TVZ9_BMF-05      ---------------G----------------------------------
A0A452F2E0_BMF-02      ---------------A----------------------------------
A0A8C0XK68_BMF-02      ---------------A----------------------------------
A0A8C3WX89_BMF-01      ---------------A----------------------------------
A0A8C3VHE5_BMF-01      ---------------T----------------------------------
A0A286XXB0_BMF-01      ---------------A----------------------------------
A0A286XXB0_BMF-03      ---------------A----------------------------------
A0A286XXB0_BMF-02      ---------------A----------------------------------
A0A2K5RN49_BMF-01      ---------------A----------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      ---------------A----------------------------------
A0A8C0GH19_BMF-01      ---------------V----------------------------------
A0A8C3XI05_BMF-01      ---------------I----------------------------------
A0A0D9R4R5_BMF-01      ---------------A----------------------------------
A0A8C3P5Z9_BMF-02      ---------------V----------------------------------
A0A8C3LTE5_BMF-01      ---------------T----------------------------------
A0A8C3EY31_BMF-02      ---------------T----------------------------------
A0A8C3EY31_BMF-01      ---------------T----------------------------------
A0A8C2MZN7_BMF-02      ---------------V----------------------------------
A0A8C2MZN7_BMF-01      ---------------V----------------------------------
A0A7M4FPU2_BMF-01      ---------------A----------------------------------
A0A8C3QVS1_BMF-01      ---------------T----------------------------------
A0A9J7Z5T7_BMF-01      ---------------A----------------------------------
A0A9J7Z5T7_BMF-02      ---------------A----------------------------------
A0A9J7Z5T7_BMF-03      ---------------S----------------------------------
A0A8C1P2N8_BMF-02      ---------------S----------------------------------
A0A8C1UAR1_BMF-02      ---------------A----------------------------------
A0A8C4DD37_BMF-01      ---------------A----------------------------------
A0A8C4J3Z9_BMF-03      ---------------T----------------------------------
A0A8C4J3Z9_BMF-01      ---------------T----------------------------------
A0A665VG08_BMF-01      ---------------A----------------------------------
A0A8C4MCB2_BMF-01      ---------------A----------------------------------
A0A8C4SHZ6_BMF-01      ---------------M----------------------------------
A0A3P8ZIE7_BMF-01      ---------------A----------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          ---------------T----------------------------------
A0A3Q2PJX9_BMF-03      ---------------A----------------------------------
A9XRG9_BMF-01          ---------------T----------------------------------
A9XRH0_BMF-01          ---------------T----------------------------------
A0A452H3N6_BMF-01      ---------------V----------------------------------
A0A2I2Z168_BMF-01      ---------------A----------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      ---------------A----------------------------------
A0A0N8EUV8_BMF-01      ---------------A----------------------------------
A0A0N8EUV8_BMF-04      ---------------A----------------------------------
Q96LC9_BMF-03          ---------------A----------------------------------
Q96LC9_BMF-06          ---------------A----------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      ---------------A----------------------------------
A0A4W5N721_BMF-01      ---------------A----------------------------------
A0A287CXH0_BMF-02      ---------------A----------------------------------
A0A8C5K765_BMF-01      ---------------A----------------------------------
A0A8C5K765_BMF-02      ---------------A----------------------------------
A0A8C5IIR3_BMF-01      ---------------T----------------------------------
A0A3Q2ZA20_BMF-01      ---------------A----------------------------------
A0A3Q3GUU5_BMF-01      ---------------A----------------------------------
A0A4W6DUL1_BMF-01      ---------------A----------------------------------
A0A8C5R6G2_BMF-02      ---------------V----------------------------------
A0A667H967_BMF-01      ---------------A----------------------------------
A0A2K5VLA3_BMF-01      ---------------A----------------------------------
A0A2K5VLA3_BMF-02      ---------------A----------------------------------
A0A5F7ZML1_BMF-02      ---------------A----------------------------------
A0A5F7ZML1_BMF-01      ---------------A----------------------------------
A0A3Q3RVI2_BMF-02      ---------------A----------------------------------
A0A803YBD7_BMF-01      ---------------T----------------------------------
A0A8C6JG54_BMF-01      ---------------T----------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      ---------------A----------------------------------
A0A5F8GKJ8_BMF-01      ---------------A----------------------------------
A0A8C6B0J8_BMF-01      ---------------A----------------------------------
A0A3Q3QZ16_BMF-02      ---------------A----------------------------------
A0A8C6CWP8_BMF-01      ---------------A----------------------------------
Q91ZE9_BMF-06          ---------------V----------------------------------
Q91ZE9_BMF-01          ---------------V----------------------------------
Q91ZE9_BMF-02          ---------------V----------------------------------
M3YAD5_BMF-01          ---------------A----------------------------------
A0A667YNR9_BMF-01      ---------------A----------------------------------
A0A8C6VCH5_BMF-03      ---------------V----------------------------------
A0A8C6VCH5_BMF-02      ---------------V----------------------------------
A0A8C6R2L6_BMF-02      ---------------A----------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          ---------------A----------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      ---------------T----------------------------------
A0A8C7FH91_BMF-01      ---------------A----------------------------------
A0A8C7G467_BMF-01      ---------------A----------------------------------
A0A8C7JEQ7_BMF-01      ---------------G----------------------------------
A0A8C7RCY3_BMF-01      ---------------A----------------------------------
A0A8C7SCN2_BMF-01      ---------------G----------------------------------
A0A8K9UY13_BMF-02      ---------------A----------------------------------
A0A8C8CQZ6_BMF-01      ---------------A----------------------------------
A0A8C8F9Y2_BMF-02      ---------------P----------------------------------
A0A8C8F9Y2_BMF-01      ---------------A----------------------------------
A0A8C8FNK5_BMF-01      ---------------G----------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          ---------------A----------------------------------
A0A3B3HAU1_BMF-01      ---------------A----------------------------------
A0A3B3HAU1_BMF-04      ---------------A----------------------------------
A0A3P9ICE1_BMF-04      ---------------A----------------------------------
A0A3P9K487_BMF-01      ---------------A----------------------------------
A0A3B3CGR9_BMF-01      ---------------A----------------------------------
H0WYH6_BMF-01          ---------------A----------------------------------
W5QFV1_BMF-01          ---------------A----------------------------------
A0A8C8WD49_BMF-02      ---------------A----------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      ---------------A----------------------------------
K7FRX2_BMF-01          ---------------I----------------------------------
A0A8C8RL12_BMF-01      ---------------A----------------------------------
A0A6I9LHF8_BMF-01      ---------------A----------------------------------
A0A8C9LTX9_BMF-01      ---------------A----------------------------------
A0AA35JSQ3_BMF-04      ---------------A----------------------------------
A0A670JUU6_BMF-05      ---------------A----------------------------------
A0A670JUU6_BMF-03      ---------------P----------------------------------
A0A096LRV0_BMF-01      ---------------A----------------------------------
A0A3P9Q8E2_BMF-01      ---------------A----------------------------------
A0A6D2XBX1_BMF-01      ---------------A----------------------------------
A0A8C8ZAV1_BMF-01      ---------------A----------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      ---------------A----------------------------------
A0A3B4CNJ8_BMF-01      ---------------V----------------------------------
A0A8I6GLK7_BMF-02      ---------------V----------------------------------
A0A8I6GLK7_BMF-01      ---------------V----------------------------------
Q8K589_BMF-01          ---------------V----------------------------------
A0A671DWL6_BMF-01      ---------------A----------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      ---------------A----------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      ---------------A----------------------------------
A0A8C9XRX5_BMF-01      ---------------A----------------------------------
A0A7N4PJP2_BMF-01      ---------------A----------------------------------
A0A8D2AYP3_BMF-01      ---------------A----------------------------------
A0A8D3CAL2_BMF-01      ---------------A----------------------------------
A0A8C9NB87_BMF-01      ---------------T----------------------------------
A0A3B4U5H8_BMF-01      ---------------A----------------------------------
A0A3B4WM88_BMF-01      ---------------A----------------------------------
A0A671MNR9_BMF-01      ---------------A----------------------------------
A0A672JWL9_BMF-01      ---------------A----------------------------------
A0A671X848_BMF-01      ---------------A----------------------------------
A0A8C9UST6_BMF-01      ---------------A----------------------------------
A0A673C8N3_BMF-01      ---------------A----------------------------------
A0A8D0LCG8_BMF-01      ---------------A----------------------------------
A0A672V891_BMF-01      ---------------T----------------------------------
A0A287BML0_BMF-01      ---------------A----------------------------------
A0A287BML0_BMF-02      ---------------A----------------------------------
A0A8D0WCZ8_BMF-03      ---------------A----------------------------------
A0A674GIP8_BMF-02      ---------------T----------------------------------
A0A674GIP8_BMF-01      ---------------T----------------------------------
A0A3B5KWG6_BMF-02      ---------------A----------------------------------
A0A3B5KWG6_BMF-01      ---------------A----------------------------------
A0A3B5KWG6_BMF-03      ---------------P----------------------------------
A0A674IPL3_BMF-01      ---------------V----------------------------------
A0A452SED0_BMF-01      ---------------A----------------------------------
A0A4X2KLG2_BMF-01      ---------------A----------------------------------
A0A3B5QK08_BMF-02      ---------------A----------------------------------
A0A8D2PG36_BMF-01      ---------------T----------------------------------
A0A3Q1FVH7_BMF-01      ---------------A----------------------------------
A0A8C0AW70_BMF-01      ---------------T----------------------------------
A0A8C3KIN9_BMF-01      ---------------T----------------------------------
A0A8C4XVG9_BMF-01      ---------------T----------------------------------
A0A3P8RKY9_BMF-01      ---------------A----------------------------------
A0A8B9VI07_BMF-01      ---------------T----------------------------------
A0A8B9BPF5_BMF-01      ---------------T----------------------------------
A0A8B9EVW2_BMF-01      ---------------T----------------------------------
A0A8C3GPS7_BMF-01      ---------------T----------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      ---------------E----------------------------------
A0A8C8B299_BMF-01      ---------------T----------------------------------
A0A8D0FU29_BMF-01      ---------------T----------------------------------
A0A8C0JZ72_BMF-01      ---------------A----------------------------------
A0A8C0RSS3_BMF-03      ---------------A----------------------------------
A0A8C0TVZ9_BMF-02      ---------------A----------------------------------
A0A8I3PRV2_BMF-03      ---------------A----------------------------------
A0A8C0TVZ9_BMF-01      ---------------A----------------------------------
A0A8I3PRV2_BMF-02      ---------------A----------------------------------
A0A8I3PRV2_BMF-01      ---------------A----------------------------------
A0A452F2E0_BMF-01      ---------------A----------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      ---------------A----------------------------------
A0A2K6B5F6_BMF-01      ---------------A----------------------------------
A0A2K6B5F6_BMF-04      ---------------A----------------------------------
A0A2K6B5F6_BMF-02      ---------------A----------------------------------
A0A2K5Z4A9_BMF-01      ---------------A----------------------------------
A0A2K6L919_BMF-01      ---------------A----------------------------------
A0A2K6L919_BMF-03      ---------------A----------------------------------
A0A2K6RAW1_BMF-01      ---------------A----------------------------------
A0A8D2E2Z1_BMF-01      ---------------A----------------------------------
A0A8C3P5Z9_BMF-01      ---------------V----------------------------------
A0A669PL85_BMF-01      ---------------T----------------------------------
A0A8C5THT3_BMF-01      ---------------T----------------------------------
A0A8C2TYD3_BMF-02      ---------------T----------------------------------
A0A8C3N153_BMF-01      ---------------T----------------------------------
A0A3P8UA78_BMF-03      ---------------A----------------------------------
A0A3P8UA78_BMF-02      ---------------A----------------------------------
A0A8C1P2N8_BMF-03      ---------------E----------------------------------
A0A8C1P2N8_BMF-01      ---------------F----------------------------------
A0A3Q2PJX9_BMF-02      ---------------A----------------------------------
A0A803YBD7_BMF-02      ---------------T----------------------------------
A0A8C4W1J6_BMF-01      ---------------V----------------------------------
A0A2R9BS98_BMF-01      ---------------A----------------------------------
A0A2J8QDD5_BMF-02      ---------------A----------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          ---------------A----------------------------------
Q96LC9_BMF-02          ---------------A----------------------------------
Q96LC9_BMF-04          ---------------A----------------------------------
A0A8C6A5T3_BMF-01      ---------------A----------------------------------
A0A8D2HTN1_BMF-03      ---------------A----------------------------------
A0A8C5IIR3_BMF-02      ---------------T----------------------------------
A0A8D2MHD7_BMF-01      ---------------T----------------------------------
A0A8D2MHD7_BMF-02      ---------------T----------------------------------
A0A8C8WD49_BMF-01      ---------------A----------------------------------
A0A8C9IYS3_BMF-01      ---------------A----------------------------------
A0A5F7ZML1_BMF-03      ---------------A----------------------------------
A0A8C5UXV9_BMF-01      ---------------A----------------------------------
A0A8C9BKQ1_BMF-01      ---------------A----------------------------------
A0A2U4BC98_BMF-01      ---------------A----------------------------------
A0A3Q3QZ16_BMF-01      ---------------A----------------------------------
A0A8C6GZK8_BMF-02      ---------------V----------------------------------
A0A8C6GZK8_BMF-03      ---------------V----------------------------------
A0A670XMZ5_BMF-01      ---------------V----------------------------------
A0A3B3HAU1_BMF-02      ---------------A----------------------------------
A0A3B3HAU1_BMF-03      ---------------A----------------------------------
A0A3P9ICE1_BMF-03      ---------------A----------------------------------
A0A3P9ICE1_BMF-05      ---------------A----------------------------------
A0A3P9ICE1_BMF-02      ---------------A----------------------------------
A0A3B3WU80_BMF-01      ---------------A----------------------------------
A0A2K6TW78_BMF-01      ---------------A----------------------------------
A0A671M0H4_BMF-01      ---------------R----------------------------------
A0A8D0WCZ8_BMF-02      ---------------A----------------------------------
A0A8D0WCZ8_BMF-01      ---------------A----------------------------------
A0A384D070_BMF-01      ---------------A----------------------------------
A0A3B5QK08_BMF-01      ---------------A----------------------------------
                                                                         

A0A8C9QDA0_BMF-01      ---------------------L-PSPT--KRRS-----------------
A0A673JJ10_BMF-01      ---------------------H-MQML--SGRD------D----------
A0A803SZ00_BMF-01      ---------------------P-KG-------------------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      ---------------------A-QR-------------------------
A0A493T7X1_BMF-01      -----------------------SV-------------------------
A0A670JUU6_BMF-01      ---------------------G-RS-------------------------
A0A8C2TYD3_BMF-03      ---------------------T-SI-------------------------
A0A8B9VI07_BMF-02      ------------------------P-------------------------
A0A670JUU6_BMF-04      ---------------------R-KP-------------------------
A0A8C0U4T1_BMF-01      ---------------------L-ES-------------------------
A0A8C5ST95_BMF-01      ---------------------E-YI-------------------------
A0A803SZ00_BMF-02      ---------------------G-RSCT--TTYF------P----------
A0A8C9F3R5_BMF-01      ---------------------G-QR-------------------------
A0A337ST43_BMF-02      ---------------------S-ED-------------------------
A0A337ST43_BMF-04      ---------------------G-PR-------------------------
A0A8B9NX34_BMF-01      ---------------------G-QRQN--CFCK------SI---------
A0A803JQ26_BMF-01      ---------------------S-GE-------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      ---------------------G-QSHR--K--------------------
A0A8C4J3Z9_BMF-02      ---------------------D-ER-------------------------
A0A8C6JG54_BMF-02      ---------------------T-IN-------------------------
A0A8B9MY06_BMF-01      ---------------------G-QR-------------------------
A0A663MPI8_BMF-01      ---------------------G-QR-------------------------
A0A8C9F3R5_BMF-02      ---------------------Q-AF-------------------------
A0A8C4J3Z9_BMF-04      ---------------------G-QRVL--SSGA------V----------
A0A8C2TYD3_BMF-04      ---------------------G-QRIS--TEYS------H----------
A0AA35JSQ3_BMF-01      ---------------------G-RR-------------------------
A0A8C6VCH5_BMF-01      ---------------------G-QR-------------------------
A0A6I8NF73_BMF-01      ---------------------G-PR-------------------------
A0A8D2L6A0_BMF-01      ---------------------G-RR-------------------------
A0A669PL85_BMF-02      ---------------------G-QP-------------------------
A0A8C2TYD3_BMF-05      ---------------------G-QRSL--PDLW------TQ---------
A3KND0_BMF-01          ---------------------F-QV-------------------------
A0A8C2TYD3_BMF-01      ---------------------G-QREM--ESWG------HS---------
A0A8C1UAR1_BMF-01      ---------------------C-RS-------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      ---------------------G-PSPL--GRSP------LPQENLMKREV
G1PAU1_BMF-01          ---------------------G-PR-------------------------
A0A8C2DDJ7_BMF-01      ---------------------G-R--------------------------
A0A8C0PT40_BMF-02      ---------------------G-PSFQ--LVP------------------
A0A8I3W4Q3_BMF-03      ---------------------GVPAHS--ALP------------------
A0A8C0RSS3_BMF-02      ---------------------G-PSQS--LQI------------------
A0A8C2SHH9_BMF-01      ---------------------G-PRAS--TRSW------GPLSNTVEVEA
A0A8C0PT40_BMF-03      ---------------------G-PNCP--STP------------------
A0A2K6L919_BMF-02      ---------------------G-PRPL--TWN------------------
A0A096NTE9_BMF-02      ---------------------H-VP-------------------------
A0A337ST43_BMF-05      --------------------------------------------------
A0A7N5JI49_BMF-01      ---------------------G-PR-------------------------
A0A0N8EUV8_BMF-02      ---------------------G-PR-------------------------
A0A8C2VBL6_BMF-01      ---------------------G-PR-------------------------
A0A8I3W4Q3_BMF-01      ---------------------G-PSFQ--PGQK------GM---------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      ---------------------G-PR-------------------------
A0A287CXH0_BMF-01      ---------------------G-PR-------------------------
A0A8C0XK68_BMF-01      ---------------------G-PR-------------------------
A0A3Q2HR24_BMF-02      ---------------------G-PR-------------------------
G3T7Z4_BMF-01          ---------------------G-PR-------------------------
A0A671DWL6_BMF-02      ---------------------G-PR-------------------------
A0A8C6GZK8_BMF-01      ---------------------G-PW-------------------------
A0A3Q2HR24_BMF-05      ---------------------G-PRKD--PRKG------L----------
A0A8C5R6G2_BMF-01      ---------------------N-WR-------------------------
A0A7N5JI49_BMF-03      ---------------------G-PR-------------------------
A0A8C0TVZ9_BMF-03      ---------------------G-PSVF--IAVF-----------------
A0A3Q2HR24_BMF-01      ---------------------G-PSFQ--PGQE------GV---------
A0A8C0RSS3_BMF-01      ---------------------G-PSQS--LQIR-----------------
A0A3Q2HR24_BMF-06      ---------------------G-PSWC--LGREIHPHAESA---------
A0A7N5JI49_BMF-02      ---------------------G-PR-------------------------
A0A8C6R2L6_BMF-01      ---------------------G-PR-------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      ---------------------G-PRTS--PGMR------A----------
A0A0N8EUV8_BMF-03      ---------------------G-PR-------------------------
A0A8C0TVZ9_BMF-04      ---------------------G-PR-------------------------
A0A4W3JXA1_BMF-01      ---------------------G-QR-------------------------
A0A3Q2HR24_BMF-04      ---------------------G-PRCG--KNVR------GP---------
A0A2K5VLA3_BMF-03      ---------------------G-PRPL--TWNG------A----------
A0A673TA87_BMF-01      ---------------------G-PR-------------------------
A0A8D2HTN1_BMF-02      ---------------------G-PR-------------------------
A0A668TQU8_BMF-01      ---------------------A-FG-------------------------
A0A8B9LSW6_BMF-01      ---------------------S-LM-------------------------
A0A671M0H4_BMF-02      ---------------------T-VS-------------------------
A0A3Q2CXC4_BMF-02      ---------------------K-WH-------------------------
A0A672JWL9_BMF-02      ---------------------L-VV-------------------------
A0A3P8NFE2_BMF-02      ---------------------T-VN-------------------------
A0A673HDR4_BMF-01      ---------------------T-VS-------------------------
A0A8C7G467_BMF-02      ---------------------P-KT-------------------------
W5N4P7_BMF-01          ---------------------D-QR-------------------------
A0A8C4SHZ6_BMF-02      ---------------------D-AR-------------------------
A0A8C9VER0_BMF-01      ---------------------D-ER-------------------------
A0A8C4C2E0_BMF-02      --------------------LE-QR-------------------------
A0A3B3RH63_BMF-01      ---------------------E-QR-------------------------
W5UAU7_BMF-01          ---------------------D-RR-------------------------
Q0GKC7_BMF-01          ---------------------N-RR-------------------------
A0A8C7XJP0_BMF-02      ---------------------G-QRSP--VERS-----EVPVM-------
A0A3Q2PJX9_BMF-01      ---------------------T-LL-------------------------
A0A9J7Y9L1_BMF-01      ---------------------N-RR-------------------------
A0A3Q2YCX7_BMF-02      ------------------------K-------------------------
A0A673YQV3_BMF-01      ---------------------G-WR-------------------------
A0A9J7Y9L1_BMF-03      ---------------------M-KV-------------------------
A0A3P8UA78_BMF-01      ---------------------G-RR-------------------------
A0A3Q2CXC4_BMF-01      ---------------------G-WR-------------------------
A0A4W4DZH9_BMF-01      ---------------------D-QR-------------------------
A0A6F9BGV6_BMF-01      ------------------------R-------------------------
A0A3P9K487_BMF-02      ---------------------G-QRLS-----------------------
A0A2U9CJH3_BMF-01      ---------------------G-RRQA--HTKR-----RAKAS-------
A0A8C2DDJ7_BMF-02      ---------------------N-RR-------------------------
A0A8C7XJP0_BMF-01      ---------------------G-QRSP--VERS-----EVPVM-------
A0A9J7Y9L1_BMF-02      ---------------------C-RS-------------------------
A0A3P9ICE1_BMF-01      ---------------------G-QR-------------------------
A0A3Q3RVI2_BMF-01      ---------------------R-EG-------------------------
A0A8C4C2E0_BMF-01      GPMSTTDRRCGFHHISAGSTNK-GL-------------------------
A0A3Q3VLX6_BMF-01      ---------------------G-RR-------------------------
A0A3B5B8F6_BMF-01      ---------------------G-RR-------------------------
A0A8C6U3U8_BMF-01      ---------------------G-QR-------------------------
A0A8C1XUF5_BMF-01      ---------------------N-RR-------------------------
A0A8C6PNJ4_BMF-01      ---------------------M-SE-------------------------
A0A8K9UY13_BMF-01      ---------------------G-WR-------------------------
A0A674EF64_BMF-01      ---------------------G-WR-------------------------
A0A3B4B6Y3_BMF-01      ------------------------H-------------------------
A0A8C4DD37_BMF-02      ---------------------G-RREDSPDVDQ-----LVPLI-------
A0A672HG10_BMF-01      ---------------------G-RR-------------------------
A0A6F9B4C5_BMF-01      ---------------------G-WR-------------------------
A0A8C7JEQ7_BMF-02      ---------------------Q-ER-------------------------
A0A3B4UNJ0_BMF-01      ---------------------E-QR-------------------------
A0A672RK14_BMF-01      ---------------------M-QI-------------------------
A0A3Q1FVH7_BMF-02      ---------------------G-RR-------------------------
A0A8B9MY06_BMF-02      ---------------------G-QR-------------------------
A0A8B9FZ48_BMF-01      ---------------------G-QR-------------------------
A0A3Q1D1K3_BMF-01      ---------------------G-RR-------------------------
A0A3Q1IPR4_BMF-01      ---------------------G-RR-------------------------
A0A493T7X1_BMF-02      ---------------------G-QR-------------------------
A0A803SZ00_BMF-03      ---------------------G-RR-------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      ---------------------G-PR-------------------------
A0A663DZQ4_BMF-01      ---------------------G-QR-------------------------
A0A3P8NFE2_BMF-01      ---------------------G-RR-------------------------
A0A3B1K1X5_BMF-01      ---------------------D-RR-------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          ---------------------G-PR-------------------------
A0A8C0EML4_BMF-01      ---------------------G-QR-------------------------
A0A8C3KIN9_BMF-02      ------------------------S-------------------------
A0A8C0JZ72_BMF-02      ---------------------G-PR-------------------------
A0A8C0PT40_BMF-01      ---------------------G-PSQS--LQIR-----------------
A0A8C0TVZ9_BMF-05      ---------------------G-PNCP--STP------------------
A0A452F2E0_BMF-02      ---------------------G-PR-------------------------
A0A8C0XK68_BMF-02      ---------------------G-PR-------------------------
A0A8C3WX89_BMF-01      ---------------------G-PR-------------------------
A0A8C3VHE5_BMF-01      ---------------------G-QR-------------------------
A0A286XXB0_BMF-01      ---------------------G-PR-------------------------
A0A286XXB0_BMF-03      ---------------------G-PR-------------------------
A0A286XXB0_BMF-02      ---------------------G-PR-------------------------
A0A2K5RN49_BMF-01      ---------------------G-LR-------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      ---------------------G-PR-------------------------
A0A8C0GH19_BMF-01      ---------------------G-QR-------------------------
A0A8C3XI05_BMF-01      ---------------------G-QR-------------------------
A0A0D9R4R5_BMF-01      ---------------------G-PR-------------------------
A0A8C3P5Z9_BMF-02      ---------------------G-QR-------------------------
A0A8C3LTE5_BMF-01      ---------------------G-QR-------------------------
A0A8C3EY31_BMF-02      ---------------------G-QR-------------------------
A0A8C3EY31_BMF-01      ---------------------G-QRNH--WLC------------------
A0A8C2MZN7_BMF-02      ---------------------G-PW-------------------------
A0A8C2MZN7_BMF-01      ---------------------G-PW-------------------------
A0A7M4FPU2_BMF-01      ---------------------G-QR-------------------------
A0A8C3QVS1_BMF-01      ---------------------G-QR-------------------------
A0A9J7Z5T7_BMF-01      ---------------------N-RR-------------------------
A0A9J7Z5T7_BMF-02      ---------------------G-R--------------------------
A0A9J7Z5T7_BMF-03      ---------------------C-RS-------------------------
A0A8C1P2N8_BMF-02      ---------------------C-RS-------------------------
A0A8C1UAR1_BMF-02      ---------------------N-RR-------------------------
A0A8C4DD37_BMF-01      ---------------------G-RR-------------------------
A0A8C4J3Z9_BMF-03      ---------------------G-QSHR--KEGL------F----------
A0A8C4J3Z9_BMF-01      ---------------------G-QR-------------------------
A0A665VG08_BMF-01      ---------------------G-RR-------------------------
A0A8C4MCB2_BMF-01      ---------------------G-PSFQ--PGQE------GV---------
A0A8C4SHZ6_BMF-01      ---------------------D-AR-------------------------
A0A3P8ZIE7_BMF-01      ---------------------G-WR-------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          ---------------------G-QR-------------------------
A0A3Q2PJX9_BMF-03      ---------------------G-RR-------------------------
A9XRG9_BMF-01          ---------------------G-QR-------------------------
A9XRH0_BMF-01          ---------------------G-QR-------------------------
A0A452H3N6_BMF-01      ---------------------G-QR-------------------------
A0A2I2Z168_BMF-01      ---------------------G-PR-------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      ---------------------G-RR-------------------------
A0A0N8EUV8_BMF-01      ---------------------G-PR-------------------------
A0A0N8EUV8_BMF-04      ---------------------G-PR-------------------------
Q96LC9_BMF-03          ---------------------G-PR-------------------------
Q96LC9_BMF-06          ---------------------G-PR-------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      ---------------------G-WR-------------------------
A0A4W5N721_BMF-01      ---------------------G-WR-------------------------
A0A287CXH0_BMF-02      ---------------------G-PR-------------------------
A0A8C5K765_BMF-01      ---------------------G-PR-------------------------
A0A8C5K765_BMF-02      ---------------------G-PR-------------------------
A0A8C5IIR3_BMF-01      ---------------------G-QR-------------------------
A0A3Q2ZA20_BMF-01      ---------------------G-RR-------------------------
A0A3Q3GUU5_BMF-01      ---------------------G-RR-------------------------
A0A4W6DUL1_BMF-01      ---------------------G-RR-------------------------
A0A8C5R6G2_BMF-02      ---------------------N-WR-------------------------
A0A667H967_BMF-01      ---------------------G-PR-------------------------
A0A2K5VLA3_BMF-01      ---------------------G-PR-------------------------
A0A2K5VLA3_BMF-02      ---------------------G-PR-------------------------
A0A5F7ZML1_BMF-02      ---------------------G-PR-------------------------
A0A5F7ZML1_BMF-01      ---------------------G-PRPL--TWNG------A----------
A0A3Q3RVI2_BMF-02      ---------------------G-RR-------------------------
A0A803YBD7_BMF-01      ---------------------G-QR-------------------------
A0A8C6JG54_BMF-01      ---------------------G-QR-------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      ---------------------G-PR-------------------------
A0A5F8GKJ8_BMF-01      ---------------------G-PR-------------------------
A0A8C6B0J8_BMF-01      ---------------------G-PR-------------------------
A0A3Q3QZ16_BMF-02      ---------------------G-RR-------------------------
A0A8C6CWP8_BMF-01      ---------------------G-PR-------------------------
Q91ZE9_BMF-06          ---------------------G-PW-------------------------
Q91ZE9_BMF-01          ---------------------G-PW-------------------------
Q91ZE9_BMF-02          ---------------------G-PW-------------------------
M3YAD5_BMF-01          ---------------------G-PR-------------------------
A0A667YNR9_BMF-01      ---------------------G-RR-------------------------
A0A8C6VCH5_BMF-03      ---------------------G-QR-------------------------
A0A8C6VCH5_BMF-02      ---------------------G-QR-------------------------
A0A8C6R2L6_BMF-02      ---------------------G-PR-------------------------
A0A3Q4G1I4_BMF-01      ---------------------G-RR-------------------------
U6CSY8_BMF-01          ---------------------G-PR-------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      ---------------------G-QR-------------------------
A0A8C7FH91_BMF-01      ---------------------G-WR-------------------------
A0A8C7G467_BMF-01      ---------------------G-WR-------------------------
A0A8C7JEQ7_BMF-01      ---------------------Q-ER-------------------------
A0A8C7RCY3_BMF-01      ---------------------G-WR-------------------------
A0A8C7SCN2_BMF-01      ---------------------Q-ER-------------------------
A0A8K9UY13_BMF-02      ---------------------G-WR-------------------------
A0A8C8CQZ6_BMF-01      ---------------------G-WR-------------------------
A0A8C8F9Y2_BMF-02      ---------------------P-KT-------------------------
A0A8C8F9Y2_BMF-01      ---------------------G-WR-------------------------
A0A8C8FNK5_BMF-01      ---------------------Q-ER-------------------------
I3K2D6_BMF-01          ---------------------G-RR-------------------------
G1SR62_BMF-01          ---------------------G-PR-------------------------
A0A3B3HAU1_BMF-01      ---------------------G-QR-------------------------
A0A3B3HAU1_BMF-04      ---------------------G-QRQS-----------------------
A0A3P9ICE1_BMF-04      ---------------------G-QRLS-----------------------
A0A3P9K487_BMF-01      ---------------------G-QR-------------------------
A0A3B3CGR9_BMF-01      ---------------------G-QR-------------------------
H0WYH6_BMF-01          ---------------------G-PR-------------------------
W5QFV1_BMF-01          ---------------------G-PR-------------------------
A0A8C8WD49_BMF-02      ---------------------G-PR-------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      ---------------------D-PRPL--TWNG------A----------
K7FRX2_BMF-01          ---------------------G-QR-------------------------
A0A8C8RL12_BMF-01      ---------------------G-QR-------------------------
A0A6I9LHF8_BMF-01      ---------------------G-PW-------------------------
A0A8C9LTX9_BMF-01      ---------------------G-PRPL--TWN------------------
A0AA35JSQ3_BMF-04      ---------------------G-RR-------------------------
A0A670JUU6_BMF-05      ---------------------G-RR-------------------------
A0A670JUU6_BMF-03      ---------------------A-QR-------------------------
A0A096LRV0_BMF-01      ---------------------G-RR-------------------------
A0A3P9Q8E2_BMF-01      ---------------------G-RR-------------------------
A0A6D2XBX1_BMF-01      ---------------------G-PR-------------------------
A0A8C8ZAV1_BMF-01      ---------------------G-PR-------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      ---------------------G-PR-------------------------
A0A3B4CNJ8_BMF-01      ---------------------D-QR-------------------------
A0A8I6GLK7_BMF-02      ---------------------G-PW-------------------------
A0A8I6GLK7_BMF-01      ---------------------G-PW-------------------------
Q8K589_BMF-01          ---------------------G-PW-------------------------
A0A671DWL6_BMF-01      ---------------------G-PR-------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      ---------------------G-PR-------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      ---------------------G-RR-------------------------
A0A8C9XRX5_BMF-01      ---------------------G-RR-------------------------
A0A7N4PJP2_BMF-01      ---------------------G-PR-------------------------
A0A8D2AYP3_BMF-01      ---------------------G-PR-------------------------
A0A8D3CAL2_BMF-01      ---------------------G-RR-------------------------
A0A8C9NB87_BMF-01      ---------------------G-QR-------------------------
A0A3B4U5H8_BMF-01      ---------------------G-RR-------------------------
A0A3B4WM88_BMF-01      ---------------------G-RR-------------------------
A0A671MNR9_BMF-01      ---------------------N-RR-------------------------
A0A672JWL9_BMF-01      ---------------------N-RR-------------------------
A0A671X848_BMF-01      ---------------------G-RR-------------------------
A0A8C9UST6_BMF-01      ---------------------G-PR-------------------------
A0A673C8N3_BMF-01      ---------------------G-QR-------------------------
A0A8D0LCG8_BMF-01      ---------------------G-RR-------------------------
A0A672V891_BMF-01      ---------------------G-QR-------------------------
A0A287BML0_BMF-01      ---------------------G-PR-------------------------
A0A287BML0_BMF-02      ---------------------G-PR-------------------------
A0A8D0WCZ8_BMF-03      ---------------------G-PR-------------------------
A0A674GIP8_BMF-02      ---------------------G-QR-------------------------
A0A674GIP8_BMF-01      ---------------------G-QRNH--WLC------------------
A0A3B5KWG6_BMF-02      ---------------------G-RR-------------------------
A0A3B5KWG6_BMF-01      ---------------------G-RR-------------------------
A0A3B5KWG6_BMF-03      ---------------------G-HRSA-----------------------
A0A674IPL3_BMF-01      ---------------------G-QR-------------------------
A0A452SED0_BMF-01      ---------------------G-PR-------------------------
A0A4X2KLG2_BMF-01      ---------------------G-PR-------------------------
A0A3B5QK08_BMF-02      ---------------------G-RR-------------------------
A0A8D2PG36_BMF-01      ---------------------G-QR-------------------------
A0A3Q1FVH7_BMF-01      ---------------------G-RR-------------------------
A0A8C0AW70_BMF-01      ---------------------G-QR-------------------------
A0A8C3KIN9_BMF-01      ---------------------G-QR-------------------------
A0A8C4XVG9_BMF-01      ---------------------G-QR-------------------------
A0A3P8RKY9_BMF-01      ---------------------G-RR-------------------------
A0A8B9VI07_BMF-01      ---------------------G-QR-------------------------
A0A8B9BPF5_BMF-01      ---------------------G-QR-------------------------
A0A8B9EVW2_BMF-01      ---------------------G-QR-------------------------
A0A8C3GPS7_BMF-01      ---------------------G-QR-------------------------
A0A3Q3C5V2_BMF-01      ---------------------G-RR-------------------------
A0A3P9DPJ5_BMF-01      ---------------------G-RR-------------------------
A0A3P9DPJ5_BMF-02      ---------------------G-RR-------------------------
A0A3B4ETH0_BMF-01      ---------------------G-RR-------------------------
A0A8B9LSW6_BMF-02      ---------------------D-RR-------------------------
A0A8C8B299_BMF-01      ---------------------G-QR-------------------------
A0A8D0FU29_BMF-01      ---------------------G-QR-------------------------
A0A8C0JZ72_BMF-01      ---------------------G-PR-------------------------
A0A8C0RSS3_BMF-03      ---------------------G-PSFQ--LVP------------------
A0A8C0TVZ9_BMF-02      ---------------------G-PSFQ--LVP------------------
A0A8I3PRV2_BMF-03      ---------------------G-PSFQ--LVP------------------
A0A8C0TVZ9_BMF-01      ---------------------G-PSQS--LQIR-----------------
A0A8I3PRV2_BMF-02      ---------------------G-PSQS--LQI------------------
A0A8I3PRV2_BMF-01      ---------------------G-PSQS--LQIR-----------------
A0A452F2E0_BMF-01      ---------------------G-PR-------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      ---------------------G-PR-------------------------
A0A2K6B5F6_BMF-01      ---------------------G-PR-------------------------
A0A2K6B5F6_BMF-04      ---------------------G-PR-------------------------
A0A2K6B5F6_BMF-02      ---------------------G-PR-------------------------
A0A2K5Z4A9_BMF-01      ---------------------G-PR-------------------------
A0A2K6L919_BMF-01      ---------------------G-PR-------------------------
A0A2K6L919_BMF-03      ---------------------G-PR-------------------------
A0A2K6RAW1_BMF-01      ---------------------G-PR-------------------------
A0A8D2E2Z1_BMF-01      ---------------------G-PR-------------------------
A0A8C3P5Z9_BMF-01      ---------------------G-QR-------------------------
A0A669PL85_BMF-01      ---------------------G-QR-------------------------
A0A8C5THT3_BMF-01      ---------------------G-QR-------------------------
A0A8C2TYD3_BMF-02      ---------------------G-QREM--ESWG------HS---------
A0A8C3N153_BMF-01      ---------------------G-QR-------------------------
A0A3P8UA78_BMF-03      ---------------------G-RR-------------------------
A0A3P8UA78_BMF-02      ---------------------G-RR-------------------------
A0A8C1P2N8_BMF-03      ---------------------N-RR-------------------------
A0A8C1P2N8_BMF-01      ---------------------M-KV-------------------------
A0A3Q2PJX9_BMF-02      ---------------------G-RR-------------------------
A0A803YBD7_BMF-02      ---------------------G-QR-------------------------
A0A8C4W1J6_BMF-01      ---------------------G-QR-------------------------
A0A2R9BS98_BMF-01      ---------------------G-PR-------------------------
A0A2J8QDD5_BMF-02      ---------------------G-PR-------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      ------------------------K-------------------------
Q96LC9_BMF-01          ---------------------G-PR-------------------------
Q96LC9_BMF-02          ---------------------G-PR-------------------------
Q96LC9_BMF-04          ---------------------G-PR-------------------------
A0A8C6A5T3_BMF-01      ---------------------G-PR-------------------------
A0A8D2HTN1_BMF-03      ---------------------G-PR-------------------------
A0A8C5IIR3_BMF-02      ---------------------G-QR-------------------------
A0A8D2MHD7_BMF-01      ---------------------G-QR-------------------------
A0A8D2MHD7_BMF-02      ---------------------G-QR-------------------------
A0A8C8WD49_BMF-01      ---------------------G-PR-------------------------
A0A8C9IYS3_BMF-01      ---------------------G-PR-------------------------
A0A5F7ZML1_BMF-03      ---------------------G-PR-------------------------
A0A8C5UXV9_BMF-01      ---------------------G-PR-------------------------
A0A8C9BKQ1_BMF-01      ---------------------G-PR-------------------------
A0A2U4BC98_BMF-01      ---------------------G-PR-------------------------
A0A3Q3QZ16_BMF-01      ---------------------G-RR-------------------------
A0A8C6GZK8_BMF-02      ---------------------G-PW-------------------------
A0A8C6GZK8_BMF-03      ---------------------G-PW-------------------------
A0A670XMZ5_BMF-01      ---------------------G-QR-------------------------
A0A3B3HAU1_BMF-02      ---------------------G-QR-------------------------
A0A3B3HAU1_BMF-03      ---------------------G-QR-------------------------
A0A3P9ICE1_BMF-03      ---------------------G-QR-------------------------
A0A3P9ICE1_BMF-05      ---------------------G-QR-------------------------
A0A3P9ICE1_BMF-02      ---------------------G-QR-------------------------
A0A3B3WU80_BMF-01      ---------------------G-RR-------------------------
A0A2K6TW78_BMF-01      ---------------------G-PR-------------------------
A0A671M0H4_BMF-01      ---------------------T-VS-------------------------
A0A8D0WCZ8_BMF-02      ---------------------G-PR-------------------------
A0A8D0WCZ8_BMF-01      ---------------------G-PR-------------------------
A0A384D070_BMF-01      ---------------------G-PR-------------------------
A0A3B5QK08_BMF-01      ---------------------G-RR-------------------------
                                                                         

A0A8C9QDA0_BMF-01      ------------------LSSA-SLVE----PL---G-------------
A0A673JJ10_BMF-01      --------------------------I----IF---G-------------
A0A803SZ00_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      --------------------------------------------------
A0A8C0U4T1_BMF-01      --------------------------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      ------------------FTEPPVCFP----F------------------
A0A8C9F3R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A8B9NX34_BMF-01      ------------------LQNPAWSYW----W------------------
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      --------------------------------------------------
A0A8C6JG54_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-01      --------------------------------------------------
A0A663MPI8_BMF-01      --------------------------------------------------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      --------------------------------------------------
A0A8C2TYD3_BMF-04      --------------------------------------------------
A0AA35JSQ3_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-01      --------------------------------------------------
A0A6I8NF73_BMF-01      --------------------------------------------------
A0A8D2L6A0_BMF-01      --------------------------------------------------
A0A669PL85_BMF-02      --------------------------------------------------
A0A8C2TYD3_BMF-05      ------------------LQESIITDS----SA---P-V---FI--RLLW
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      ------------------LSSALLSAS----LL---S-H---HLHHSASS
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      ERVESTRSR--KTSAA--AAQL-ARQG----VC--ES-VLQPRLEEAAES
G1PAU1_BMF-01          --------------------------------------------------
A0A8C2DDJ7_BMF-01      -------------------------------SC--S--------------
A0A8C0PT40_BMF-02      -------------------------GI----SC--SG-A-----------
A0A8I3W4Q3_BMF-03      -------------------------RA----GL--FS-A-----------
A0A8C0RSS3_BMF-02      ---R--------------FWRL-SRNL----PC--SL-R-----------
A0A8C2SHH9_BMF-01      GV-S--------------PWNL-LRARTSRSFC--HQ-------------
A0A8C0PT40_BMF-03      -------------------------AL----SELQVG-Y-----------
A0A2K6L919_BMF-02      -------------------------GG----RC--QT-L-----------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A337ST43_BMF-05      --------------------------------------------------
A0A7N5JI49_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-02      --------------------------------------------------
A0A8C2VBL6_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-01      ------------------LWNPAGSRL----PL---H-V-----------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-01      --------------------------------------------------
A0A8C0XK68_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
G3T7Z4_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-05      ------------------F-------------E---G-V-----------
A0A8C5R6G2_BMF-01      --------------------------------------------------
A0A7N5JI49_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-03      --------------------------------------------------
A0A3Q2HR24_BMF-01      ------------------LWKSAGLQL----PL---SEL-----------
A0A8C0RSS3_BMF-01      ------------------FWRL-SRNL----PC---S-L-----------
A0A3Q2HR24_BMF-06      ------------------VWPS-EKRI----SF---G-I-----------
A0A7N5JI49_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-01      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-04      --------------------------------------------------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      ------------------VRELETSDL----FL---S-C-----------
A0A2K5VLA3_BMF-03      --------------------------------------------------
A0A673TA87_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      --------------------------------------------------
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      ---GSGEAWSKPQAAKTIIWLLLGVEG----RL---S----------AND
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      ---GPQ--NRASS-----------VER----TV-----------------
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      ---GSGEAWSKPQAAKTIIWLLLGVEG----RL---S----------AND
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      ---SSHTAV--PAAAT----------------------------------
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      --------------------------------------------------
A0A8B9FZ48_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A803SZ00_BMF-03      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A663DZQ4_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A8C0EML4_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      --------------------------------------------------
A0A8C0PT40_BMF-01      ------------------FWRL-SRNL----PC---S-L-----------
A0A8C0TVZ9_BMF-05      -------------------------AL----SELQVG-Y-----------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A8C0XK68_BMF-02      --------------------------------------------------
A0A8C3WX89_BMF-01      --------------------------------------------------
A0A8C3VHE5_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A286XXB0_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A8C0GH19_BMF-01      --------------------------------------------------
A0A8C3XI05_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-02      --------------------------------------------------
A0A8C3LTE5_BMF-01      --------------------------------------------------
A0A8C3EY31_BMF-02      --------------------------------------------------
A0A8C3EY31_BMF-01      --------------------------------------------------
A0A8C2MZN7_BMF-02      --------------------------------------------------
A0A8C2MZN7_BMF-01      --------------------------------------------------
A0A7M4FPU2_BMF-01      --------------------------------------------------
A0A8C3QVS1_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      -------------------------------SC--S--------------
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      ------------------LWKSAGLQL----PL---SEL-----------
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-04      --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A8C5K765_BMF-01      --------------------------------------------------
A0A8C5K765_BMF-02      --------------------------------------------------
A0A8C5IIR3_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      --------------------------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------------------------------
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A8C6B0J8_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          --------------------------------------------------
Q91ZE9_BMF-02          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      --------------------------------------------------
A0A8C6VCH5_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A8C8WD49_BMF-02      --------------------------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A0A8C8RL12_BMF-01      --------------------------------------------------
A0A6I9LHF8_BMF-01      --------------------------------------------------
A0A8C9LTX9_BMF-01      -------------------------GG----RC--QT-L-----------
A0AA35JSQ3_BMF-04      --------------------------------------------------
A0A670JUU6_BMF-05      --------------------------------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      --------------------------------------------------
A0A8C8ZAV1_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------------------
A0A8I6GLK7_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A8D2AYP3_BMF-01      --------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      --------------------------------------------------
A0A672V891_BMF-01      --------------------------------------------------
A0A287BML0_BMF-01      --------------------------------------------------
A0A287BML0_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-03      --------------------------------------------------
A0A674GIP8_BMF-02      --------------------------------------------------
A0A674GIP8_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-01      --------------------------------------------------
A0A8C4XVG9_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      --------------------------------------------------
A0A8B9BPF5_BMF-01      --------------------------------------------------
A0A8B9EVW2_BMF-01      --------------------------------------------------
A0A8C3GPS7_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      --------------------------------------------------
A0A8D0FU29_BMF-01      --------------------------------------------------
A0A8C0JZ72_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-03      -------------------------GI----SC--SG-A-----------
A0A8C0TVZ9_BMF-02      -------------------------GI----SC--SG-A-----------
A0A8I3PRV2_BMF-03      -------------------------GI----SC--SG-A-----------
A0A8C0TVZ9_BMF-01      ------------------FWRL-SRNL----PC---S-L-----------
A0A8I3PRV2_BMF-02      ---R--------------FWRL-SRNL----PC--SL-R-----------
A0A8I3PRV2_BMF-01      ------------------FWRL-SRNL----PC---S-L-----------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A8D2E2Z1_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-01      --------------------------------------------------
A0A669PL85_BMF-01      --------------------------------------------------
A0A8C5THT3_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-02      ------------------LSSALLSAS----LL---S-H---HLHHSASS
A0A8C3N153_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A8C6A5T3_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-03      --------------------------------------------------
A0A8C5IIR3_BMF-02      --------------------------------------------------
A0A8D2MHD7_BMF-01      --------------------------------------------------
A0A8D2MHD7_BMF-02      --------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-01      --------------------------------------------------
A0A8C9BKQ1_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A670XMZ5_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      -------------------------------------AGM-A-----P--
A0A673JJ10_BMF-01      ---------------------------------L---PEL-Y-----C--
A0A803SZ00_BMF-01      --------------------------------------------------
A0AA35JSQ3_BMF-05      --------------------------------------------------
A0A8B9NX34_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-02      --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
A0A670JUU6_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-02      --------------------------------------------------
A0A670JUU6_BMF-04      --------------------------------------------------
A0A8C0U4T1_BMF-01      --------------------------------------------------
A0A8C5ST95_BMF-01      --------------------------------------------------
A0A803SZ00_BMF-02      -------------------------------------SEM-L-----P--
A0A8C9F3R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A8B9NX34_BMF-01      -------------------------------------LFS-V-----C--
A0A803JQ26_BMF-01      --------------------------------------------------
A0A674GIP8_BMF-03      --------------------------------------------------
A0A8B9VI07_BMF-03      --------------------------------------------------
A0A8C4J3Z9_BMF-02      --------------------------------------------------
A0A8C6JG54_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-01      --------------------------------------------------
A0A663MPI8_BMF-01      --------------------------------------------------
A0A8C9F3R5_BMF-02      --------------------------------------------------
A0A8C4J3Z9_BMF-04      -----------------------------------------I-----D--
A0A8C2TYD3_BMF-04      --------------------------------------------------
A0AA35JSQ3_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-01      --------------------------------------------------
A0A6I8NF73_BMF-01      --------------------------------------------------
A0A8D2L6A0_BMF-01      --------------------------------------------------
A0A669PL85_BMF-02      --------------------------------------------------
A0A8C2TYD3_BMF-05      G--ETGVT---------------------------------Q-----R--
A3KND0_BMF-01          --------------------------------------------------
A0A8C2TYD3_BMF-01      GHCCSLAT-----------------------QRCSLGAEMPS-----A--
A0A8C1UAR1_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-03      --LCVLAR-TLG----GRPRRPHSFQ-----EGV---NLS-AC-VGSWGH
G1PAU1_BMF-01          --------------------------------------------------
A0A8C2DDJ7_BMF-01      -----------------------------------------------Q--
A0A8C0PT40_BMF-02      -----------------------------------------------Q--
A0A8I3W4Q3_BMF-03      -----------------------------------------------F--
A0A8C0RSS3_BMF-02      ---------S-------------------------------------K--
A0A8C2SHH9_BMF-01      --------------------------------------------------
A0A8C0PT40_BMF-03      -----------------------------------------------L--
A0A2K6L919_BMF-02      -----------------------------------------------L--
A0A096NTE9_BMF-02      --------------------------------------------------
A0A337ST43_BMF-05      --------------------------------------------------
A0A7N5JI49_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-02      --------------------------------------------------
A0A8C2VBL6_BMF-01      --------------------------------------------------
A0A8I3W4Q3_BMF-01      ---------------------------------F---PSL-PA-------
A0A803JQ26_BMF-02      --------------------------------------------------
A0A8D2HTN1_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-01      --------------------------------------------------
A0A8C0XK68_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
G3T7Z4_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-05      ---------------------------------Y---P------------
A0A8C5R6G2_BMF-01      --------------------------------------------------
A0A7N5JI49_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-03      -------------------------------------LRL-HF-------
A0A3Q2HR24_BMF-01      ---------------------------------L---PFS-PC-CGTNGE
A0A8C0RSS3_BMF-01      --------------------------------------RR-PA-------
A0A3Q2HR24_BMF-06      ---------------------------------E---PG-----------
A0A7N5JI49_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-01      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-03      --------------------------------------------------
A0A8C0TVZ9_BMF-04      --------------------------------------------------
A0A4W3JXA1_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-04      ---------------------------------H---PEL-PPAPGFC--
A0A2K5VLA3_BMF-03      --------------------------------------------------
A0A673TA87_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-02      --------------------------------------------------
A0A668TQU8_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A672JWL9_BMF-02      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
A0A673HDR4_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-02      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A8C4SHZ6_BMF-02      --------------------------------------------------
A0A8C9VER0_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-02      --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A8C7XJP0_BMF-02      --NNSLINQEGGGAMKDSE------------L-G---VEM-FISFGLS--
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A673YQV3_BMF-01      --------------------------------------------------
A0A9J7Y9L1_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A4W4DZH9_BMF-01      --------------------------------------------------
A0A6F9BGV6_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A2U9CJH3_BMF-01      ---QAMTNQF-------TS------------L-P---PQQ-LPPPANG--
A0A8C2DDJ7_BMF-02      --------------------------------------------------
A0A8C7XJP0_BMF-01      --NNSLINQEGGGAMKDKPQRPQALRLVSFLF-Q---VDT-FILV-FM--
A0A9J7Y9L1_BMF-02      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A8C4C2E0_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A8C6U3U8_BMF-01      --------------------------------------------------
A0A8C1XUF5_BMF-01      --------------------------------------------------
A0A8C6PNJ4_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-01      --------------------------------------------------
A0A674EF64_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A8C4DD37_BMF-02      ----------------SSQ------------L-S---VSL-HADW-----
A0A672HG10_BMF-01      --------------------------------------------------
A0A6F9B4C5_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A672RK14_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A8B9MY06_BMF-02      --------------------------------------------------
A0A8B9FZ48_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A803SZ00_BMF-03      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A663DZQ4_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A8C0CL26_BMF-01      --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A8C0EML4_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-02      --------------------------------------------------
A0A8C0JZ72_BMF-02      --------------------------------------------------
A0A8C0PT40_BMF-01      --------------------------------------R-----------
A0A8C0TVZ9_BMF-05      -----------------------------------------------L--
A0A452F2E0_BMF-02      --------------------------------------------------
A0A8C0XK68_BMF-02      --------------------------------------------------
A0A8C3WX89_BMF-01      --------------------------------------------------
A0A8C3VHE5_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A286XXB0_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A8C0GH19_BMF-01      --------------------------------------------------
A0A8C3XI05_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-02      --------------------------------------------------
A0A8C3LTE5_BMF-01      --------------------------------------------------
A0A8C3EY31_BMF-02      --------------------------------------------------
A0A8C3EY31_BMF-01      --------------------------------------------------
A0A8C2MZN7_BMF-02      --------------------------------------------------
A0A8C2MZN7_BMF-01      --------------------------------------------------
A0A7M4FPU2_BMF-01      --------------------------------------------------
A0A8C3QVS1_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-01      --------------------------------------------------
A0A9J7Z5T7_BMF-02      -----------------------------------------------Q--
A0A9J7Z5T7_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-02      --------------------------------------------------
A0A8C1UAR1_BMF-02      --------------------------------------------------
A0A8C4DD37_BMF-01      --------------------------------------------------
A0A8C4J3Z9_BMF-03      -----------------------------------------L--------
A0A8C4J3Z9_BMF-01      --------------------------------------------------
A0A665VG08_BMF-01      --------------------------------------------------
A0A8C4MCB2_BMF-01      ---------------------------------L---PFS-PC-CGTNGE
A0A8C4SHZ6_BMF-01      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A8C5HAH2_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-01      --------------------------------------------------
A0A0N8EUV8_BMF-04      --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
A0A4W5N3A7_BMF-01      --------------------------------------------------
A0A4W5N721_BMF-01      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A8C5K765_BMF-01      --------------------------------------------------
A0A8C5K765_BMF-02      --------------------------------------------------
A0A8C5IIR3_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A4W6DUL1_BMF-01      --------------------------------------------------
A0A8C5R6G2_BMF-02      --------------------------------------------------
A0A667H967_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-01      --------------------------------------------------
A0A2K5VLA3_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-02      --------------------------------------------------
A0A5F7ZML1_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-01      --------------------------------------------------
A0A8C6JG54_BMF-01      --------------------------------------------------
A0A8C5UXV9_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-02      --------------------------------------------------
A0A5F8GKJ8_BMF-01      --------------------------------------------------
A0A8C6B0J8_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A8C6CWP8_BMF-01      --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          --------------------------------------------------
Q91ZE9_BMF-02          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A667YNR9_BMF-01      --------------------------------------------------
A0A8C6VCH5_BMF-03      --------------------------------------------------
A0A8C6VCH5_BMF-02      --------------------------------------------------
A0A8C6R2L6_BMF-02      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A8C6Z034_BMF-01      --------------------------------------------------
A0A8C7FH91_BMF-01      --------------------------------------------------
A0A8C7G467_BMF-01      --------------------------------------------------
A0A8C7JEQ7_BMF-01      --------------------------------------------------
A0A8C7RCY3_BMF-01      --------------------------------------------------
A0A8C7SCN2_BMF-01      --------------------------------------------------
A0A8K9UY13_BMF-02      --------------------------------------------------
A0A8C8CQZ6_BMF-01      --------------------------------------------------
A0A8C8F9Y2_BMF-02      --------------------------------------------------
A0A8C8F9Y2_BMF-01      --------------------------------------------------
A0A8C8FNK5_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
A0A8C8WD49_BMF-02      --------------------------------------------------
A0A8C9IYS3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A0A8C8RL12_BMF-01      --------------------------------------------------
A0A6I9LHF8_BMF-01      --------------------------------------------------
A0A8C9LTX9_BMF-01      -----------------------------------------------L--
A0AA35JSQ3_BMF-04      --------------------------------------------------
A0A670JUU6_BMF-05      --------------------------------------------------
A0A670JUU6_BMF-03      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A6D2XBX1_BMF-01      --------------------------------------------------
A0A8C8ZAV1_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A8I6GLK7_BMF-02      --------------------------------------------------
A0A8I6GLK7_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
A0A671DWL6_BMF-01      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A8D0CFD0_BMF-01      --------------------------------------------------
A0A8C9XRX5_BMF-01      --------------------------------------------------
A0A7N4PJP2_BMF-01      --------------------------------------------------
A0A8D2AYP3_BMF-01      --------------------------------------------------
A0A8D3CAL2_BMF-01      --------------------------------------------------
A0A8C9NB87_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A671MNR9_BMF-01      --------------------------------------------------
A0A672JWL9_BMF-01      --------------------------------------------------
A0A671X848_BMF-01      --------------------------------------------------
A0A8C9UST6_BMF-01      --------------------------------------------------
A0A673C8N3_BMF-01      --------------------------------------------------
A0A8D0LCG8_BMF-01      --------------------------------------------------
A0A672V891_BMF-01      --------------------------------------------------
A0A287BML0_BMF-01      --------------------------------------------------
A0A287BML0_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-03      --------------------------------------------------
A0A674GIP8_BMF-02      --------------------------------------------------
A0A674GIP8_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-02      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-03      --------------------------------------------------
A0A674IPL3_BMF-01      --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A4X2KLG2_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A8D2PG36_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A8C0AW70_BMF-01      --------------------------------------------------
A0A8C3KIN9_BMF-01      --------------------------------------------------
A0A8C4XVG9_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A8B9VI07_BMF-01      --------------------------------------------------
A0A8B9BPF5_BMF-01      --------------------------------------------------
A0A8B9EVW2_BMF-01      --------------------------------------------------
A0A8C3GPS7_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A8B9LSW6_BMF-02      --------------------------------------------------
A0A8C8B299_BMF-01      --------------------------------------------------
A0A8D0FU29_BMF-01      --------------------------------------------------
A0A8C0JZ72_BMF-01      --------------------------------------------------
A0A8C0RSS3_BMF-03      -----------------------------------------------Q--
A0A8C0TVZ9_BMF-02      -----------------------------------------------Q--
A0A8I3PRV2_BMF-03      -----------------------------------------------Q--
A0A8C0TVZ9_BMF-01      --------------------------------------R-----------
A0A8I3PRV2_BMF-02      ---------S-------------------------------------K--
A0A8I3PRV2_BMF-01      --------------------------------------RR-PA-------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A8D2E2Z1_BMF-01      --------------------------------------------------
A0A8C3P5Z9_BMF-01      --------------------------------------------------
A0A669PL85_BMF-01      --------------------------------------------------
A0A8C5THT3_BMF-01      --------------------------------------------------
A0A8C2TYD3_BMF-02      GHCCSLAT-----------------------QRCSLGAEMPS-----A--
A0A8C3N153_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A8C1P2N8_BMF-03      --------------------------------------------------
A0A8C1P2N8_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A803YBD7_BMF-02      --------------------------------------------------
A0A8C4W1J6_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A8C6A5T3_BMF-01      --------------------------------------------------
A0A8D2HTN1_BMF-03      --------------------------------------------------
A0A8C5IIR3_BMF-02      --------------------------------------------------
A0A8D2MHD7_BMF-01      --------------------------------------------------
A0A8D2MHD7_BMF-02      --------------------------------------------------
A0A8C8WD49_BMF-01      --------------------------------------------------
A0A8C9IYS3_BMF-01      --------------------------------------------------
A0A5F7ZML1_BMF-03      --------------------------------------------------
A0A8C5UXV9_BMF-01      --------------------------------------------------
A0A8C9BKQ1_BMF-01      --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A8C6GZK8_BMF-02      --------------------------------------------------
A0A8C6GZK8_BMF-03      --------------------------------------------------
A0A670XMZ5_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-03      --------------------------------------------------
A0A3P9ICE1_BMF-05      --------------------------------------------------
A0A3P9ICE1_BMF-02      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A671M0H4_BMF-01      --------------------------------------------------
A0A8D0WCZ8_BMF-02      --------------------------------------------------
A0A8D0WCZ8_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
                                                                         

A0A8C9QDA0_BMF-01      --TGFSSLC
A0A673JJ10_BMF-01      --VFVVVKN
A0A803SZ00_BMF-01      --PFQLYAS
A0AA35JSQ3_BMF-05      ---GVLVVE
A0A8B9NX34_BMF-02      ---APQQKE
A0A670JUU6_BMF-02      --TLWCISE
A0A493T7X1_BMF-01      --QERQVLG
A0A670JUU6_BMF-01      --FIHGHSA
A0A8C2TYD3_BMF-03      --SGTGLNH
A0A8B9VI07_BMF-02      --EAAGCQQ
A0A670JUU6_BMF-04      --TEHVIPK
A0A8C0U4T1_BMF-01      --VLTLLVV
A0A8C5ST95_BMF-01      --HPSVTLG
A0A803SZ00_BMF-02      --RFCLEAI
A0A8C9F3R5_BMF-01      ---------
A0A337ST43_BMF-02      ---------
A0A337ST43_BMF-04      ---------
A0A8B9NX34_BMF-01      --NCLLPVQ
A0A803JQ26_BMF-01      ---------
A0A674GIP8_BMF-03      ------TWP
A0A8B9VI07_BMF-03      ----EGLFL
A0A8C4J3Z9_BMF-02      ---------
A0A8C6JG54_BMF-02      ---------
A0A8B9MY06_BMF-01      ---------
A0A663MPI8_BMF-01      ---------
A0A8C9F3R5_BMF-02      ---------
A0A8C4J3Z9_BMF-04      --QQIKAAS
A0A8C2TYD3_BMF-04      ----TPEKS
A0AA35JSQ3_BMF-01      ---------
A0A8C6VCH5_BMF-01      ---------
A0A6I8NF73_BMF-01      ---------
A0A8D2L6A0_BMF-01      ---------
A0A669PL85_BMF-02      ---------
A0A8C2TYD3_BMF-05      --QRGKIHP
A3KND0_BMF-01          ---------
A0A8C2TYD3_BMF-01      --ASCGLAM
A0A8C1UAR1_BMF-01      ---------
A0A8I3W4Q3_BMF-02      -----TIIC
A0A3Q2HR24_BMF-03      CGQQAPRGW
G1PAU1_BMF-01          ---------
A0A8C2DDJ7_BMF-01      --TNLSSSN
A0A8C0PT40_BMF-02      --Q-DCSCL
A0A8I3W4Q3_BMF-03      --PDFLPPL
A0A8C0RSS3_BMF-02      --TTTPQDG
A0A8C2SHH9_BMF-01      ---LLKTTR
A0A8C0PT40_BMF-03      --PPLGSGF
A0A2K6L919_BMF-02      --KGRLMCL
A0A096NTE9_BMF-02      ---------
A0A337ST43_BMF-05      ---------
A0A7N5JI49_BMF-01      ---------
A0A0N8EUV8_BMF-02      ---------
A0A8C2VBL6_BMF-01      ---------
A0A8I3W4Q3_BMF-01      --AVLMERI
A0A803JQ26_BMF-02      ---------
A0A8D2HTN1_BMF-01      ---------
A0A287CXH0_BMF-01      ---------
A0A8C0XK68_BMF-01      ---------
A0A3Q2HR24_BMF-02      ---------
G3T7Z4_BMF-01          ---------
A0A671DWL6_BMF-02      ---------
A0A8C6GZK8_BMF-01      ---------
A0A3Q2HR24_BMF-05      -----SMPQ
A0A8C5R6G2_BMF-01      ---------
A0A7N5JI49_BMF-03      ---------
A0A8C0TVZ9_BMF-03      --KSVSLCT
A0A3Q2HR24_BMF-01      NLKQPVWLL
A0A8C0RSS3_BMF-01      --TRIRSLG
A0A3Q2HR24_BMF-06      --FKCFFCH
A0A7N5JI49_BMF-02      ---------
A0A8C6R2L6_BMF-01      ---------
A0A2K5KGP2_BMF-01      ---------
A0A337ST43_BMF-01      ----FVKHC
A0A0N8EUV8_BMF-03      ---------
A0A8C0TVZ9_BMF-04      ---------
A0A4W3JXA1_BMF-01      ---------
A0A3Q2HR24_BMF-04      -QDFVLSWS
A0A2K5VLA3_BMF-03      ----VVKPC
A0A673TA87_BMF-01      ---------
A0A8D2HTN1_BMF-02      ---------
A0A668TQU8_BMF-01      ---------
A0A8B9LSW6_BMF-01      ---------
A0A671M0H4_BMF-02      ---------
A0A3Q2CXC4_BMF-02      ---------
A0A672JWL9_BMF-02      ---------
A0A3P8NFE2_BMF-02      ---------
A0A673HDR4_BMF-01      ---------
A0A8C7G467_BMF-02      ---------
W5N4P7_BMF-01          ---------
A0A8C4SHZ6_BMF-02      ---------
A0A8C9VER0_BMF-01      ---------
A0A8C4C2E0_BMF-02      ---------
A0A3B3RH63_BMF-01      ---------
W5UAU7_BMF-01          ---------
Q0GKC7_BMF-01          ---------
A0A8C7XJP0_BMF-02      -LLPHQCLI
A0A3Q2PJX9_BMF-01      ---------
A0A9J7Y9L1_BMF-01      ---------
A0A3Q2YCX7_BMF-02      ---------
A0A673YQV3_BMF-01      ---------
A0A9J7Y9L1_BMF-03      ---------
A0A3P8UA78_BMF-01      ---------
A0A3Q2CXC4_BMF-01      ---------
A0A4W4DZH9_BMF-01      ---------
A0A6F9BGV6_BMF-01      ---------
A0A3P9K487_BMF-02      -----VMSD
A0A2U9CJH3_BMF-01      -RLPCALIG
A0A8C2DDJ7_BMF-02      ---------
A0A8C7XJP0_BMF-01      -IISIITND
A0A9J7Y9L1_BMF-02      ---------
A0A3P9ICE1_BMF-01      ---------
A0A3Q3RVI2_BMF-01      ---------
A0A8C4C2E0_BMF-01      ---------
A0A3Q3VLX6_BMF-01      ---------
A0A3B5B8F6_BMF-01      ---------
A0A8C6U3U8_BMF-01      ---------
A0A8C1XUF5_BMF-01      ---------
A0A8C6PNJ4_BMF-01      ---------
A0A8K9UY13_BMF-01      ---------
A0A674EF64_BMF-01      ---------
A0A3B4B6Y3_BMF-01      ---------
A0A8C4DD37_BMF-02      -LMRLPRGL
A0A672HG10_BMF-01      ---------
A0A6F9B4C5_BMF-01      ---------
A0A8C7JEQ7_BMF-02      ---------
A0A3B4UNJ0_BMF-01      ---------
A0A672RK14_BMF-01      ---------
A0A3Q1FVH7_BMF-02      ---------
A0A8B9MY06_BMF-02      ---------
A0A8B9FZ48_BMF-01      ---------
A0A3Q1D1K3_BMF-01      ---------
A0A3Q1IPR4_BMF-01      ---------
A0A493T7X1_BMF-02      ---------
A0A803SZ00_BMF-03      ---------
A0A2K5E1Q4_BMF-02      ---------
A0A2K5E1Q4_BMF-01      ---------
A0A663DZQ4_BMF-01      ---------
A0A3P8NFE2_BMF-01      ---------
A0A3B1K1X5_BMF-01      ---------
A0A8C0CL26_BMF-01      ---------
L8IXF5_BMF-01          ---------
A0A8C0EML4_BMF-01      ---------
A0A8C3KIN9_BMF-02      --KAA---D
A0A8C0JZ72_BMF-02      ---------
A0A8C0PT40_BMF-01      ---------
A0A8C0TVZ9_BMF-05      --PPLGSGF
A0A452F2E0_BMF-02      ---------
A0A8C0XK68_BMF-02      ---------
A0A8C3WX89_BMF-01      ---------
A0A8C3VHE5_BMF-01      ---------
A0A286XXB0_BMF-01      ---------
A0A286XXB0_BMF-03      ---------
A0A286XXB0_BMF-02      ---------
A0A2K5RN49_BMF-01      ---------
A0A2K5RN49_BMF-02      ---------
A0A2K5MJW4_BMF-01      ---------
A0A2K5MJW4_BMF-02      ---------
A0A8C0GH19_BMF-01      ---------
A0A8C3XI05_BMF-01      ---------
A0A0D9R4R5_BMF-01      ---------
A0A8C3P5Z9_BMF-02      ---------
A0A8C3LTE5_BMF-01      ---------
A0A8C3EY31_BMF-02      ---------
A0A8C3EY31_BMF-01      -------LK
A0A8C2MZN7_BMF-02      ---------
A0A8C2MZN7_BMF-01      ---------
A0A7M4FPU2_BMF-01      ---------
A0A8C3QVS1_BMF-01      ---------
A0A9J7Z5T7_BMF-01      ---------
A0A9J7Z5T7_BMF-02      --TNLSSSN
A0A9J7Z5T7_BMF-03      ---------
A0A8C1P2N8_BMF-02      ---------
A0A8C1UAR1_BMF-02      ---------
A0A8C4DD37_BMF-01      ---------
A0A8C4J3Z9_BMF-03      ---------
A0A8C4J3Z9_BMF-01      ---------
A0A665VG08_BMF-01      ---------
A0A8C4MCB2_BMF-01      NLKQPVWQL
A0A8C4SHZ6_BMF-01      ---------
A0A3P8ZIE7_BMF-01      ---------
A0A337ST43_BMF-03      ---------
U3JS06_BMF-01          --DNGNLHS
A0A3Q2PJX9_BMF-03      ---------
A9XRG9_BMF-01          ---------
A9XRH0_BMF-01          ---------
A0A452H3N6_BMF-01      ---------
A0A2I2Z168_BMF-01      ---------
A0A2I2Z168_BMF-02      ---------
A0A8C5HAH2_BMF-01      ---------
A0A0N8EUV8_BMF-01      ---------
A0A0N8EUV8_BMF-04      ---------
Q96LC9_BMF-03          ---------
Q96LC9_BMF-06          ---------
Q96LC9_BMF-09          ---------
Q96LC9_BMF-08          ---------
A0A4W5N3A7_BMF-01      ---------
A0A4W5N721_BMF-01      ---------
A0A287CXH0_BMF-02      ---------
A0A8C5K765_BMF-01      ---------
A0A8C5K765_BMF-02      ---------
A0A8C5IIR3_BMF-01      ---------
A0A3Q2ZA20_BMF-01      ---------
A0A3Q3GUU5_BMF-01      ---------
A0A4W6DUL1_BMF-01      ---------
A0A8C5R6G2_BMF-02      ---------
A0A667H967_BMF-01      ---------
A0A2K5VLA3_BMF-01      ---------
A0A2K5VLA3_BMF-02      ---------
A0A5F7ZML1_BMF-02      ---------
A0A5F7ZML1_BMF-01      ----VVKPC
A0A3Q3RVI2_BMF-02      ---------
A0A803YBD7_BMF-01      ---------
A0A8C6JG54_BMF-01      ---------
A0A8C5UXV9_BMF-03      ---------
A0A8C5UXV9_BMF-02      ---------
A0A5F8GKJ8_BMF-01      ---------
A0A8C6B0J8_BMF-01      ---------
A0A3Q3QZ16_BMF-02      ---------
A0A8C6CWP8_BMF-01      ---------
Q91ZE9_BMF-06          ---------
Q91ZE9_BMF-01          ---------
Q91ZE9_BMF-02          ---------
M3YAD5_BMF-01          ---------
A0A667YNR9_BMF-01      ---------
A0A8C6VCH5_BMF-03      ---------
A0A8C6VCH5_BMF-02      ---------
A0A8C6R2L6_BMF-02      ---------
A0A3Q4G1I4_BMF-01      ---------
U6CSY8_BMF-01          ---------
A0A2I3HD83_BMF-01      ---------
A0A8C6Z034_BMF-01      ---------
A0A8C7FH91_BMF-01      ---------
A0A8C7G467_BMF-01      ---------
A0A8C7JEQ7_BMF-01      ---------
A0A8C7RCY3_BMF-01      ---------
A0A8C7SCN2_BMF-01      ---------
A0A8K9UY13_BMF-02      ---------
A0A8C8CQZ6_BMF-01      ---------
A0A8C8F9Y2_BMF-02      ---------
A0A8C8F9Y2_BMF-01      ---------
A0A8C8FNK5_BMF-01      ---------
I3K2D6_BMF-01          ---------
G1SR62_BMF-01          ---------
A0A3B3HAU1_BMF-01      ---------
A0A3B3HAU1_BMF-04      -----VVSD
A0A3P9ICE1_BMF-04      -----VLSD
A0A3P9K487_BMF-01      ---------
A0A3B3CGR9_BMF-01      ---------
H0WYH6_BMF-01          ---------
W5QFV1_BMF-01          ---------
A0A8C8WD49_BMF-02      ---------
A0A8C9IYS3_BMF-02      ---------
A0A096NTE9_BMF-01      ----VVKPC
K7FRX2_BMF-01          ---------
A0A8C8RL12_BMF-01      ---------
A0A6I9LHF8_BMF-01      ---------
A0A8C9LTX9_BMF-01      --KGRLMSL
A0AA35JSQ3_BMF-04      ---------
A0A670JUU6_BMF-05      ---------
A0A670JUU6_BMF-03      --TLWCISE
A0A096LRV0_BMF-01      ---------
A0A3P9Q8E2_BMF-01      ---------
A0A6D2XBX1_BMF-01  &