Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

149 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A493T7X1_BMF-01      --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A1U8CPE0_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A1S3EQA2_BMF-02      --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
H9GL49_BMF-01          --------------------------------------------------
A0A3Q2UCA0_BMF-02      --------------------------------------------------
A0A3Q2UCA0_BMF-01      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A3Q2UCA0_BMF-03      --------------------------------------------------
A0A3Q2UCA0_BMF-04      --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
A0A337ST43_BMF-05      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-04      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A2AV74_BMF-01          --------MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPL
A0A286XXB0_BMF-02      ------------------------------------------MPGAGVFW
G3WDQ2_BMF-01          --------------------------------------------------
G3T7Z4_BMF-01          ----------MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPA
A0A287CXH0_BMF-01      --------------------MPRAGVFWKQYRAVRSGLLRRPPESAAAAG
A0A1S3WU31_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A1U8CPE0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
F7CM09_BMF-01          --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K5VLE9_BMF-02      --------------------------------------------------
F7CM09_BMF-03          --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
J9PB65_BMF-04          --------------------------------------------------
J9PB65_BMF-03          --------------------------------------------------
J9PB65_BMF-02          --------------------------------------------------
J9PB65_BMF-01          --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A493T7X1_BMF-01      --------------------------------------------MDRPSY
A0A452H3N6_BMF-01      --------------------------------------------MDPPNY
A0A287AIU8_BMF-02      --------------------------------------------MEPPQC
G1PAU1_BMF-01          --------------------------------------------MEPPQC
A0A287AIU8_BMF-01      --------------------------------------------MEPPQC
A0A1U8CPE0_BMF-02      ---------------------------------------IFPGEMEPPQC
A0A286XXB0_BMF-03      ---------------------------------------VFPREMEPPQC
A0A287CXH0_BMF-02      ---------------------------------------VFPEEMEPPQC
A0A1S3EQA2_BMF-02      ---------------------------------------IVPGEMEPPQC
A2AV74_BMF-02          ---------------------------------------MSPGEMEPPQC
H9GL49_BMF-01          --------------------------------------------MDPPGY
A0A3Q2UCA0_BMF-02      --------------------------------------------MDRPSY
A0A3Q2UCA0_BMF-01      --------------------------------------------MDRPSY
K7FRX2_BMF-01          --------------------------------------------MDPPSY
U3JS06_BMF-01          --------------------------------------------MDRPSY
A0A493T7X1_BMF-02      --------------------------------------------MDRPSY
A0A3Q2UCA0_BMF-03      --------------------------------------------MDRPSY
A0A3Q2UCA0_BMF-04      --------------------------------------------MDRPSY
G1NHG8_BMF-01          --------------------------------------------MDRPSY
A0A337ST43_BMF-02      --------------------------------------------MEPPQC
A0A2K5KGP2_BMF-01      --------------------------------------------MEPSRC
A0A2K6FFN3_BMF-02      --------------------------------------------MEPSHC
A0A2K5E1Q4_BMF-02      --------------------------------------------MEPSQC
A0A2K5RN49_BMF-02      --------------------------------------------MEPSQC
A0A2K6TW78_BMF-03      --------------------------------------------MEPSQC
A0A2K6RAW1_BMF-02      --------------------------------------------MEPSRC
A0A2I2Z168_BMF-02      --------------------------------------------MEPSQC
A0A2R9BS98_BMF-02      --------------------------------------------MEPSQC
A0A2J8QDD5_BMF-01      --------------------------------------------MEPSQC
A0A2K5MJW4_BMF-01      --------------------------------------------MEPSRC
A0A2K5VLE9_BMF-01      --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-03      --------------------------------------------MEPSRC
A0A2K5Z4A9_BMF-02      --------------------------------------------MEPSRC
A0A096NTE9_BMF-03      --------------------------------------------MEPSRC
A0A2I3HD83_BMF-01      --------------------------------------------MEPSQC
A0A1S3EQA2_BMF-01      --------------------------------------------MEPPQC
Q8K589_BMF-01          --------------------------------------------MEPPQC
A0A337ST43_BMF-05      FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-04      FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A2AV74_BMF-01          EFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQC
A0A286XXB0_BMF-02      KQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQC
G3WDQ2_BMF-01          --------------------------------------------MESPHY
G3T7Z4_BMF-01          ELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQC
A0A287CXH0_BMF-01      PASGSRLPGSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC
A0A1S3WU31_BMF-01      --------------------------------------------MELPQC
A0A337ST43_BMF-03      --------------------------------------------MEPPQC
A0A337ST43_BMF-01      --------------------------------------------MEPPQC
A0A1U8CPE0_BMF-01      --------------------------------------------MEPPQC
G1SR62_BMF-01          --------------------------------------------MEPPQC
M3YAD5_BMF-01          --------------------------------------------MEPPQC
U6CSY8_BMF-01          --------------------------------------------MEPPQC
A0A452SED0_BMF-01      --------------------------------------------MEPPQC
A0A384D070_BMF-01      --------------------------------------------MEPPQC
W5QFV1_BMF-01          ----------------------------------------LTGEMEPPQC
L8IXF5_BMF-01          --------------------------------------------MEPPQC
A0A452F2E0_BMF-01      --------------------------------------------MEPPQC
A0A452F2E0_BMF-02      --------------------------------------------MEPPQC
Q05KI3_BMF-02          --------------------------------------------MEPPQC
Q05KI3_BMF-01          --------------------------------------------MEPPQC
A0A2K6FFN3_BMF-01      --------------------------------------------MEPSHC
H0WYH6_BMF-01          --------------------------------------------MEPSQC
A0A096NTE9_BMF-01      --------------------------------------------MEPSRC
A0A2K6L919_BMF-02      --------------------------------------------MEPSRC
A0A2K5E1Q4_BMF-01      --------------------------------------------MEPSQC
A0A2K6TW78_BMF-01      --------------------------------------------MEPSQC
A0A2K6TW78_BMF-02      --------------------------------------------MEPSQC
A0A2K5RN49_BMF-01      --------------------------------------------MEPSQC
A0A2I2Z168_BMF-01      --------------------------------------------MEPSQC
A0A2R9BS98_BMF-01      --------------------------------------------MEPSQC
A0A2J8QDD5_BMF-02      --------------------------------------------MEPSQC
A0A2J8T301_BMF-01      --------------------------------------------MEPSQC
F7CM09_BMF-01          --------------------------------------------MEPSRC
A0A2K5MJW4_BMF-02      --------------------------------------------MEPSRC
A0A2K5KGP2_BMF-02      --------------------------------------------MEPSRC
A0A2K5VLE9_BMF-02      --------------------------------------------MEPSRC
F7CM09_BMF-03          --------------------------------------------MEPSRC
F7CM09_BMF-02          --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-01      --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-02      --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-04      --------------------------------------------MEPSRC
A0A2K5Z4A9_BMF-01      --------------------------------------------MEPSRC
A0A2K6L919_BMF-01      --------------------------------------------MEPSRC
A0A2K6L919_BMF-03      --------------------------------------------MEPSRC
A0A2K6RAW1_BMF-01      --------------------------------------------MEPSRC
A0A0D9R4R5_BMF-01      --------------------------------------------MEPSRC
J9PB65_BMF-04          ----------MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQC
J9PB65_BMF-03          --------------------------------------------MEPPQC
J9PB65_BMF-02          --------------------------------------------MEPPQC
J9PB65_BMF-01          --------------------------------------------MEPPQC
A0A3Q2HR24_BMF-01      --------------------------------------------MEPPQC
A0A3Q2HR24_BMF-02      --------------------------------------------MEPPQC
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      ---------------------------------MCLSGISGHSSYSAPPR
Q0GKC7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------MDRPSY
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A493T7X1_BMF-01      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A452H3N6_BMF-01      LEDDYSSLDGLDDDVFHSDFGLTG-QPGEMTPPGIFTQNQSYSCLLGRFQ
A0A287AIU8_BMF-02      VEE-------LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQ
G1PAU1_BMF-01          VEE-------LEDDVFQPED-ELGTQPGSLPSADLFAQSQ-LDCPLSRLQ
A0A287AIU8_BMF-01      VEE-------LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQ
A0A1U8CPE0_BMF-02      VEE-------LEDDVFQSEDGEPGTQPGSLLSADPFAQSQ-LDCPLSRLQ
A0A286XXB0_BMF-03      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLH
A0A287CXH0_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQ
A0A1S3EQA2_BMF-02      VEE-------LEDDVFQAEDGEPGTQPGSLLSATLFAQSQ-LDCPLSRLQ
A2AV74_BMF-02          VEE-------LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQ
H9GL49_BMF-01          LDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQ
A0A3Q2UCA0_BMF-02      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3Q2UCA0_BMF-01      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
K7FRX2_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQ
U3JS06_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQ
A0A493T7X1_BMF-02      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3Q2UCA0_BMF-03      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3Q2UCA0_BMF-04      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
G1NHG8_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A337ST43_BMF-02      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A2K5KGP2_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6FFN3_BMF-02      VEE-------LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQ
A0A2K5E1Q4_BMF-02      VEE-------LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K5RN49_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6TW78_BMF-03      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6RAW1_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2I2Z168_BMF-02      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2R9BS98_BMF-02      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2J8QDD5_BMF-01      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K5MJW4_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5VLE9_BMF-01      VEE-------LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-03      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5Z4A9_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A096NTE9_BMF-03      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2I3HD83_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A1S3EQA2_BMF-01      VEE-------LEDDVFQAEDGEPGTQPGSLLSATLFAQSQ-LDCPLSRLQ
Q8K589_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQ
A0A337ST43_BMF-05      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A337ST43_BMF-04      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A2AV74_BMF-01          VEE-------LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQ
A0A286XXB0_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLH
G3WDQ2_BMF-01          VEE-------LEDDVFHPEDSEPGAQPGGLTSPALFAQSQ-PDYMLDGLQ
G3T7Z4_BMF-01          VEE-------LEDDVFQPEEGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQ
A0A287CXH0_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQ
A0A1S3WU31_BMF-01      VDE-------LEDDVFQPEDGEPGTTPGSLLSSDLFAQSP-MDCSLSRLQ
A0A337ST43_BMF-03      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A337ST43_BMF-01      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A1U8CPE0_BMF-01      VEE-------LEDDVFQSEDGEPGTQPGSLLSADPFAQSQ-LDCPLSRLQ
G1SR62_BMF-01          VEE-------LEDDVFQPEDGEPGTQPQSLLSADPFAQSQ-LDCPLGRLH
M3YAD5_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
U6CSY8_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
A0A452SED0_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
A0A384D070_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
W5QFV1_BMF-01          VEE-------LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQ
L8IXF5_BMF-01          VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQ
A0A452F2E0_BMF-01      VEE-------LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQ
A0A452F2E0_BMF-02      VEE-------LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQ
Q05KI3_BMF-02          VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQ
Q05KI3_BMF-01          VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQ
A0A2K6FFN3_BMF-01      VEE-------LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQ
H0WYH6_BMF-01          VEE-------LEDDVFQPEDGELGT--GNVLSADLFAQSQ-LDCPLSRLQ
A0A096NTE9_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6L919_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5E1Q4_BMF-01      VEE-------LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6TW78_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6TW78_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K5RN49_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2I2Z168_BMF-01      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2R9BS98_BMF-01      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2J8QDD5_BMF-02      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2J8T301_BMF-01      VEE-------LEDDVFQPEDGEPGTQSGSLLSADLFAQSL-LDCPLSRLQ
F7CM09_BMF-01          VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5MJW4_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5KGP2_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5VLE9_BMF-02      VEE-------LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQ
F7CM09_BMF-03          VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
F7CM09_BMF-02          VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-04      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5Z4A9_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6L919_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6L919_BMF-03      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6RAW1_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A0D9R4R5_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
J9PB65_BMF-04          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
J9PB65_BMF-03          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
J9PB65_BMF-02          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
J9PB65_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
A0A3Q2HR24_BMF-01      VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLR
A0A3Q2HR24_BMF-02      VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLR
A0A3B4UNJ0_BMF-01      MDD-------EEEDMSQPI-------------------------------
A0A3B4B6Y3_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3P9ICE1_BMF-01      MDD-------EEDDVFEPD-------------------------------
Q0GKC7_BMF-01          MDE-------DEDDVFRKG-------------------------------
A0A3B3RH63_BMF-01      MDD-------DDDDVFHTD-------------------------------
W5N4P7_BMF-01          MEE-------DEDDVFHPSH------------------------------
A0A3B1K1X5_BMF-01      MDD-------EEDDVFVTD-------------------------------
A0A3B4CNJ8_BMF-01      MDE-------DEDDVFVMD-------------------------------
A0A2U9CJH3_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q2YCX7_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2YCX7_BMF-02      MED-------EEDDVFEPD-------------------------------
A0A3P8ZIE7_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2PJX9_BMF-02      MED-------EEDDVFEPD-------------------------------
A0A3Q3QZ16_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3QZ16_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3Q2PJX9_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2PJX9_BMF-03      MED-------EEDDVFEPD-------------------------------
A0A3B5QK08_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3B5QK08_BMF-02      MED-------EEDDVFEPD-------------------------------
A0A096LRV0_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3B3WU80_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3P9Q8E2_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2CXC4_BMF-02      MEE-------EEDDVFEPD-------------------------------
A0A3Q2CXC4_BMF-01      MEE-------EEDDVFEPD-------------------------------
A0A3Q3GUU5_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B5B8F6_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3VLX6_BMF-01      MDD-------DEDDVFEPE-------------------------------
A0A3P8UA78_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3P8UA78_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8UA78_BMF-03      MDD-------EEDDVFEPD-------------------------------
A0A3B3CGR9_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P9K487_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3P9K487_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-03      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-04      MDD-------EEDDVFEPD-------------------------------
A0A3P9ICE1_BMF-04      MDD-------EEDDVFEPD-------------------------------
A0A3Q2ZA20_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8NFE2_BMF-02      MDD-------EEDDVFEPK-------------------------------
I3K2D6_BMF-01          MDD-------EEDDVFEPK-------------------------------
A0A3P8NFE2_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3Q3C5V2_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3P9DPJ5_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3P9DPJ5_BMF-02      MDD-------EEDDVFEPK-------------------------------
A0A3B4ETH0_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3Q4G1I4_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3Q1FVH7_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3Q1FVH7_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3RVI2_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q1D1K3_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8RKY9_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3RVI2_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3Q1IPR4_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B4U5H8_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B4WM88_BMF-01      MDD-------EEDDVFEPD-------------------------------
A9XRH0_BMF-01          LEEDYSSLDGLDDDVFHSD--DFGLAGNA-----------GY-----RLH
A3KND0_BMF-01          -------MDELDDDVFYPD--AFGYPDQTITSSSLFNQSQSYTCLLGRFH
                                  ::*:                                   

A0A493T7X1_BMF-01      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYA
A0A452H3N6_BMF-01      LFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYG
A0A287AIU8_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
G1PAU1_BMF-01          LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A287AIU8_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1U8CPE0_BMF-02      LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A286XXB0_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYG
A0A287CXH0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1S3EQA2_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A2AV74_BMF-02          LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
H9GL49_BMF-01          LFPLTHCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYG
A0A3Q2UCA0_BMF-02      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3Q2UCA0_BMF-01      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
K7FRX2_BMF-01          LFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYG
U3JS06_BMF-01          LFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A493T7X1_BMF-02      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3Q2UCA0_BMF-03      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3Q2UCA0_BMF-04      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
G1NHG8_BMF-01          LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A337ST43_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5KGP2_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6FFN3_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5E1Q4_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5RN49_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6TW78_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6RAW1_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2I2Z168_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2R9BS98_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2J8QDD5_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5MJW4_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5VLE9_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6B5F6_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5Z4A9_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A096NTE9_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2I3HD83_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A1S3EQA2_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
Q8K589_BMF-01          LFPLTHCCGPGLRPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-05      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-04      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A2AV74_BMF-01          LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A286XXB0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYG
G3WDQ2_BMF-01          LFPLTHCCGPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYG
G3T7Z4_BMF-01          LFPLTHCCGPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A287CXH0_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1S3WU31_BMF-01      LFPLTHCCGPGLRPASQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1U8CPE0_BMF-01      LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
G1SR62_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
M3YAD5_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
U6CSY8_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A452SED0_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A384D070_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
W5QFV1_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
L8IXF5_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A452F2E0_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A452F2E0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
Q05KI3_BMF-02          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
Q05KI3_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6FFN3_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
H0WYH6_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A096NTE9_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6L919_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5E1Q4_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6TW78_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6TW78_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5RN49_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2I2Z168_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2R9BS98_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2J8QDD5_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2J8T301_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
F7CM09_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5MJW4_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5KGP2_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5VLE9_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
F7CM09_BMF-03          LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
F7CM09_BMF-02          LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6B5F6_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6B5F6_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6B5F6_BMF-04      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5Z4A9_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6L919_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6L919_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6RAW1_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A0D9R4R5_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-04          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-03          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-02          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A3Q2HR24_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A3Q2HR24_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A3B4UNJ0_BMF-01      ----SHLWGTSFRDVKYEDRATPIAA-------GQALTAVTAAPLILF--
A0A3B4B6Y3_BMF-01      ----LHCWHTTFRQIKCEDRATQTPGPALAPNKGMLPCGVAEEPRPLFY-
A0A3P9ICE1_BMF-01      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
Q0GKC7_BMF-01          ----LQHWPPPHLQIK----QTELAGRPAGSRNGMLLCRHLQQHGHFLYG
A0A3B3RH63_BMF-01      ----PLTYQPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYG
W5N4P7_BMF-01          ---FSHCWGTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYG
A0A3B1K1X5_BMF-01      ----PEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYG
A0A3B4CNJ8_BMF-01      ----TQYWRSSIREIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYG
A0A2U9CJH3_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYG
A0A3Q2YCX7_BMF-01      ----PHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYG
A0A3Q2YCX7_BMF-02      ----PHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYG
A0A3P8ZIE7_BMF-01      ----SYCWHTASREIKYEDRGTQTPTTALALLNDMLPCRLDQDPRPLFYG
A0A3Q2PJX9_BMF-02      ----PNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYG
A0A3Q3QZ16_BMF-01      ----PHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYG
A0A3Q3QZ16_BMF-02      ----PHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYG
A0A3Q2PJX9_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYG
A0A3Q2PJX9_BMF-03      ----PNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYG
A0A3B5QK08_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYG
A0A3B5QK08_BMF-02      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYG
A0A096LRV0_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYG
A0A3B3WU80_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYG
A0A3P9Q8E2_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYG
A0A3Q2CXC4_BMF-02      ----PNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYR
A0A3Q2CXC4_BMF-01      ----PNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYR
A0A3Q3GUU5_BMF-01      ----PHSWRTYFQEIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRPLFYG
A0A3B5B8F6_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q3VLX6_BMF-01      ----AHCWRTTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFY-
A0A3P8UA78_BMF-02      ----PHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYG
A0A3P8UA78_BMF-01      ----PHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYG
A0A3P8UA78_BMF-03      ----PHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYG
A0A3B3CGR9_BMF-01      ----PNNWRTAVRKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3P9K487_BMF-02      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYG
A0A3P9K487_BMF-01      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYG
A0A3B3HAU1_BMF-03      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3B3HAU1_BMF-02      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3B3HAU1_BMF-01      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3B3HAU1_BMF-04      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3P9ICE1_BMF-04      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3Q2ZA20_BMF-01      ----PSCWRTTFREIKCEDRGTQTPGPALVPHSGMLPCGVAEEPRPLFYG
A0A3P8NFE2_BMF-02      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
I3K2D6_BMF-01          ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3P8NFE2_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3Q3C5V2_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3P9DPJ5_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3P9DPJ5_BMF-02      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3B4ETH0_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3Q4G1I4_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3Q1FVH7_BMF-02      ----THCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q1FVH7_BMF-01      ----THCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q3RVI2_BMF-01      ----PHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYG
A0A3Q1D1K3_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3P8RKY9_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q3RVI2_BMF-02      ----PHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYG
A0A3Q1IPR4_BMF-01      ----PHCWRTTFREIKCQDRGTQTPGPALPQNNGMLPCGVAEEPRPLFYG
A0A3B4U5H8_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYG
A0A3B4WM88_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYG
A9XRH0_BMF-01          VPPVGFALDPNLQ-EEPQEGQREART--EVQIARKLQC-IADQFHRLHI-
A3KND0_BMF-01          LFPFSHCCGPGCRGTDNEDKATQTLG--SPSQDIMLPCGVSETPQRLFY-
                                .                                    :   

A0A493T7X1_BMF-01      SAEQKSSV-V-AAFSLSTQLGLKRGG------------------------
A0A452H3N6_BMF-01      NAGYRLHVPP-VGFALNPHLQEEPRE------------------------
A0A287AIU8_BMF-02      -----------------LPLGEQPPE------------------------
G1PAU1_BMF-01          NAGYRLPL-P-ASFPAGSPLGEQPPE------------------------
A0A287AIU8_BMF-01      NAGYRLPL-P-AGFPAGLPLGEQPPE------------------------
A0A1U8CPE0_BMF-02      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A286XXB0_BMF-03      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A287CXH0_BMF-02      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A1S3EQA2_BMF-02      SAGYRLPL-P-AGFPA----AQQPPE------------------------
A2AV74_BMF-02          NAGYRLPL-P-ASFPAGSPLGEQPPE------------------------
H9GL49_BMF-01          NAGYRLHVSP-IGFSLNPHFQEEPQE------------------------
A0A3Q2UCA0_BMF-02      NAGYRLHVPP-VGFALDPNLQEEPQE------------------------
A0A3Q2UCA0_BMF-01      NAGYRLHVPP-VGFALDPNLQEEPQE------------------------
K7FRX2_BMF-01          NAGYRLHEPP-VGFALNPHLQEEPRE------------------------
U3JS06_BMF-01          SAGYRLHVPP-AGFVLDPHLQEEPQE------------------------
A0A493T7X1_BMF-02      NAGYRLHVPP-VGFALDPHLQEEPQE------------------------
A0A3Q2UCA0_BMF-03      NAGYRLHVPP-VGFALDPNLQEEPQE------------------------
A0A3Q2UCA0_BMF-04      NAGYRLHVPP-VGFALDPNLQEEPQE------------------------
G1NHG8_BMF-01          NAGYRLHVPP-VGFALDPNLQEEPQE------------------------
A0A337ST43_BMF-02      PAKPPSSV-V-ADSPL-------PTQ------------------------
A0A2K5KGP2_BMF-01      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A2K6FFN3_BMF-02      PAEPKSHV-V-ADPPL-------PTQ------------------------
A0A2K5E1Q4_BMF-02      SAEPKSRV-V-AGPPL-------SAQ------------------------
A0A2K5RN49_BMF-02      PAEPKSRV-V-AGPPL-------PAQ------------------------
A0A2K6TW78_BMF-03      PAEPKSCV-V-AGPPL-------PAQ------------------------
A0A2K6RAW1_BMF-02      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A2I2Z168_BMF-02      PAEPKSCV-V-ADPPL-------PAQ------------------------
A0A2R9BS98_BMF-02      PAEPKSCV-V-ADPPL-------PAQ------------------------
A0A2J8QDD5_BMF-01      PAEPKSCV-V-ADPPL-------PAQ------------------------
A0A2K5MJW4_BMF-01      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A2K5VLE9_BMF-01      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A2K6B5F6_BMF-03      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A2K5Z4A9_BMF-02      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A096NTE9_BMF-03      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A2I3HD83_BMF-01      PAEPKSRV-V-ADPPL-------PAQ------------------------
A0A1S3EQA2_BMF-01      SAGYRLPL-P-AGFPA----AQQPPE------------------------
Q8K589_BMF-01          NAGYRLPL-P-ASFPAGSALGEQPPE------------------------
A0A337ST43_BMF-05      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A337ST43_BMF-04      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A2AV74_BMF-01          NAGYRLPL-P-ASFPAGSPLGEQPPE------------------------
A0A286XXB0_BMF-02      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
G3WDQ2_BMF-01          NAGYRLPL-P-ANFPSSLRLGAEPPE------------------------
G3T7Z4_BMF-01          NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A287CXH0_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A1S3WU31_BMF-01      NAGYRLPL-P-NSFPAGSPFAEQRRE------------------------
A0A337ST43_BMF-03      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A337ST43_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A1U8CPE0_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
G1SR62_BMF-01          NAGYRLPL-P-ASFPANFALGEQPPE------------------------
M3YAD5_BMF-01          NAGYRLPL-P-ASFPAGLPLGDQPPE------------------------
U6CSY8_BMF-01          NAGYRLPL-P-ASFPAGLPLGDQPPE------------------------
A0A452SED0_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A384D070_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
W5QFV1_BMF-01          NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
L8IXF5_BMF-01          NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A452F2E0_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A452F2E0_BMF-02      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
Q05KI3_BMF-02          HAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
Q05KI3_BMF-01          HAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A2K6FFN3_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPAE------------------------
H0WYH6_BMF-01          NVGYRLPL-P-ASFPAGLPIGEQPPE------------------------
A0A096NTE9_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6L919_BMF-02      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K5E1Q4_BMF-01      NAGYRLPL-P-ASFPAVLPLGEQPPE------------------------
A0A2K6TW78_BMF-01      NAGYRLPL-P-ASFPAVLPLGEQPPE------------------------
A0A2K6TW78_BMF-02      NAGYRLPL-P-ASFPAVLPLGEQPPE------------------------
A0A2K5RN49_BMF-01      NAGYRLPL-P-ASFPAVLPLGEQPPE------------------------
A0A2I2Z168_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2R9BS98_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2J8QDD5_BMF-02      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2J8T301_BMF-01      NAGYRLPL-P-ASFPAVLPTGEQPPE------------------------
F7CM09_BMF-01          NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K5MJW4_BMF-02      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K5KGP2_BMF-02      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K5VLE9_BMF-02      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
F7CM09_BMF-03          NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
F7CM09_BMF-02          NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6B5F6_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6B5F6_BMF-02      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6B5F6_BMF-04      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K5Z4A9_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6L919_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6L919_BMF-03      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A2K6RAW1_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
A0A0D9R4R5_BMF-01      NAGYRLPL-P-ASFPAVLPIGEQPPE------------------------
J9PB65_BMF-04          NAGYRLPL-P-ASFPAGLPLLEQPPE------------------------
J9PB65_BMF-03          NAGYRLPL-P-ASFPAGLPLLEQPPE------------------------
J9PB65_BMF-02          NAGYRLPL-P-ASFPAGLPLLEQPPE------------------------
J9PB65_BMF-01          NAGYRLPL-P-ASFPAGLPLLEQPPE------------------------
A0A3Q2HR24_BMF-01      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A3Q2HR24_BMF-02      NAGYRLPL-P-ASFPAGLPLGEQPPE------------------------
A0A3B4UNJ0_BMF-01      -----VWW-V-PHWELSPSTKMNMLRFSENR------------------P
A0A3B4B6Y3_BMF-01      -----------AHFELGEDQEASESLQEGEMQNGREPLP----------R
A0A3P9ICE1_BMF-01      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
Q0GKC7_BMF-01          NAELLVLA-A-SSRAQPPDVVLRQNV------SPMER------------P
A0A3B3RH63_BMF-01      SAGLRLHF-P-ALSVPGGHPPQEERQ-----------------------P
W5N4P7_BMF-01          NAAFRLHF-P-AHFEQGGDEEEETGE-----------------------A
A0A3B1K1X5_BMF-01      SAGLLLLA-PSARSERVGDAMFREEH--------RAVEP----------R
A0A3B4CNJ8_BMF-01      SAGLLLLA-PSVRPEHVEGAMLQEDQ--------LAMEP----------R
A0A2U9CJH3_BMF-01      NAGFRLHF-P-AHFELFGDQEVRGHE-SEEERSGMEQLPR---------Q
A0A3Q2YCX7_BMF-01      NAGFRLHF-P-AHFELVGEQEERLQESDDGMEQQLQQQQ----------Q
A0A3Q2YCX7_BMF-02      NAGFRLHF-P-AHFELVGEQEERLQESDDGMEQQLQQQQ----------Q
A0A3P8ZIE7_BMF-01      NAGFRLHF-P-AQFECVGDPGPQQRP--QAVRGGMEH------------P
A0A3Q2PJX9_BMF-02      NAGFRLHF-P-AHFELVGDFDARRQE----EQNRMEPLP----------L
A0A3Q3QZ16_BMF-01      NAGFRLHF-P-AHFELVGDQEARRQE----DQNGMEHLP----------R
A0A3Q3QZ16_BMF-02      NAGFRLHF-P-AHFELVGDQEARRQE----DQNGMEHLP----------R
A0A3Q2PJX9_BMF-01      NAGFRLHF-P-AHFELVGDFDARRQE----EQNRMEPLP----------L
A0A3Q2PJX9_BMF-03      NAGFRLHF-P-AHFELVGDFDARRQE----EQNRMEPLP----------L
A0A3B5QK08_BMF-01      NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP----------L
A0A3B5QK08_BMF-02      NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP----------L
A0A096LRV0_BMF-01      NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP----------L
A0A3B3WU80_BMF-01      NAGFRLHF-P-AHFELVGDFDARQQE----EQNRMEQLP----------L
A0A3P9Q8E2_BMF-01      NAGFRLHF-P-AHFELVRDFDARQQE----EQNRMEQLP----------L
A0A3Q2CXC4_BMF-02      NAGFRLHF-P-AHFELVGDFDVRRQA----EHNRMEQLP----------L
A0A3Q2CXC4_BMF-01      NAGFRLHF-P-AHFELVGDFDVRRQA----EHNRMEQLP----------L
A0A3Q3GUU5_BMF-01      NAGFRLHF-P-ANFELVGDQEESGQE-SELQQIGMEQ-------------
A0A3B5B8F6_BMF-01      NAGFRLHF-P-ARFELIGDHQARQQQGSEMEQNGMEQLP----------R
A0A3Q3VLX6_BMF-01      ---------------VTSSLAPDSRD-NCRERNGMERLP----------R
A0A3P8UA78_BMF-02      NAGFRLHF-P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQ
A0A3P8UA78_BMF-01      NAGFRLHF-P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQ
A0A3P8UA78_BMF-03      NAGFRLHF-P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQ
A0A3B3CGR9_BMF-01      NAGFRLHF-P-ARFELAGDLEARRHD-REAERGGMERLP----------R
A0A3P9K487_BMF-02      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3P9K487_BMF-01      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-03      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-02      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-01      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3B3HAU1_BMF-04      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3P9ICE1_BMF-04      NAGFRLHF-P-ARFELAGDLEVRRHD-REAERRGMERLP----------R
A0A3Q2ZA20_BMF-01      NAGFRLHF-P-ARFELIRDLEARQQD-REEEPNRMERLP----------R
A0A3P8NFE2_BMF-02      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
I3K2D6_BMF-01          NAGFRLHF-P-ARFELVGDHRARRQE-IAEQQNSMERLP----------R
A0A3P8NFE2_BMF-01      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
A0A3Q3C5V2_BMF-01      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
A0A3P9DPJ5_BMF-01      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
A0A3P9DPJ5_BMF-02      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
A0A3B4ETH0_BMF-01      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
A0A3Q4G1I4_BMF-01      NAGFRLHF-P-ARFELVGDHRASRQG-STEQQNSMERLP----------R
A0A3Q1FVH7_BMF-02      NAGFRLHF-P-AHFELI----ARQQG-SEMEQNGMEQLP----------R
A0A3Q1FVH7_BMF-01      NAGFRLHF-P-AHFELI----ARQQG-SEMEQNGMEQLP----------R
A0A3Q3RVI2_BMF-01      NAGFRLHF-P-AHFELVGDQEVRQQE-REEEQNRMEQLP----------R
A0A3Q1D1K3_BMF-01      NAGFRLHF-P-ARFELIGNHQARQQG-SEMEQNGMEQLP----------R
A0A3P8RKY9_BMF-01      NAGFRLHF-P-ARFELIGNHQARQQG-SEMEQNGMEQLP----------R
A0A3Q3RVI2_BMF-02      NAGFRLHF-P-AHFELVGDQEVRQQE-REEEQNRMEQLP----------R
A0A3Q1IPR4_BMF-01      NAGFRLHF-P-AHFELVGDLEVRQQD-SEEEQNGMEIPP----------R
A0A3B4U5H8_BMF-01      NAGFRLHF-P-AHFELVGDQEARRQG-SGEERNGMEQLP----------R
A0A3B4WM88_BMF-01      NAGFRLHF-P-AHFELVGDQEARRQG-SGEERNGMEQLP----------R
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A493T7X1_BMF-01      EQE-PHWAEVSFTHLFQATSSLQGALNKHWFGGETCTPPAGCEDSEILLL
A0A452H3N6_BMF-01      GQRE-ALAEVQIARKLQ------------------------CIADQFHRL
A0A287AIU8_BMF-02      GQWQ-HRAEVQIARKLQ------------------------CIADQFHRL
G1PAU1_BMF-01          GQWQHHRAEIQIARKLQ------------------------SIADQFHRL
A0A287AIU8_BMF-01      GQWQ-HRAEVQIARKLQ------------------------CIADQFHRL
A0A1U8CPE0_BMF-02      GQWQ-HRAEVQIARKLQ------------------------CIADQFHRL
A0A286XXB0_BMF-03      GQWQ-HRAEVQIARKLQ------------------------CIADQFHRL
A0A287CXH0_BMF-02      GQWQ-HRAEVQIARKLQ------------------------CIADQFHRL
A0A1S3EQA2_BMF-02      G----HRVEVQIARKLQ------------------------CIADQFHRL
A2AV74_BMF-02          GQFLQHRAEVQIARKLQ------------------------CIADQFHRL
H9GL49_BMF-01          SPQ-ELRTEVQIARKLQ------------------------CIADQFHRL
A0A3Q2UCA0_BMF-02      GQR-EARTEVQIARKLQ------------------------CIADQFHRL
A0A3Q2UCA0_BMF-01      GQR-EARTEVQIARKLQ------------------------CIADQFHRL
K7FRX2_BMF-01          GHQ-EARAEVQIARKLQ------------------------CIADQFHRL
U3JS06_BMF-01          GQR-EARAEVQIARKLQ------------------------CIADQFHRL
A0A493T7X1_BMF-02      GQQ-EARAEVQIARKLQ------------------------CIADQFHRL
A0A3Q2UCA0_BMF-03      GQR-EARTEVQIARKLQ------------------------CIADQFHRL
A0A3Q2UCA0_BMF-04      GQR-EARTEVQIARKLQ------------------------CIADQFHRL
G1NHG8_BMF-01          GQR-EARTEVQIARKLQ------------------------CIADQFHRL
A0A337ST43_BMF-02      PGF-ECRREQEWGRSQV------------------------RLGCPPRMG
A0A2K5KGP2_BMF-01      PCF-EWRREQERGGPQV------------------------RLGCPLHMG
A0A2K6FFN3_BMF-02      PCF-ERRREQERGRSQ----------------------------------
A0A2K5E1Q4_BMF-02      PGF-EWRREQEWGRPE----------------------------------
A0A2K5RN49_BMF-02      PGF-EWRREQEWGRPE----------------------------------
A0A2K6TW78_BMF-03      PGF-EWRRKQEWGRSE----------------------------------
A0A2K6RAW1_BMF-02      PCF-EWRRE-----------------------------------------
A0A2I2Z168_BMF-02      PCF-EWRREQERGRP-----------------------------------
A0A2R9BS98_BMF-02      PCF-EWRREQERGRP-----------------------------------
A0A2J8QDD5_BMF-01      PCF-EWRREQERGRP-----------------------------------
A0A2K5MJW4_BMF-01      PCF-EWRREQERGGP-----------------------------------
A0A2K5VLE9_BMF-01      PCF-EWRREQERGGP-----------------------------------
A0A2K6B5F6_BMF-03      PCF-EWRREQERGGP-----------------------------------
A0A2K5Z4A9_BMF-02      PCF-EWRREQERGGP-----------------------------------
A0A096NTE9_BMF-03      PCF-EWRREQERGGP-----------------------------------
A0A2I3HD83_BMF-01      PCF-EWRREQEWGRP-----------------------------------
A0A1S3EQA2_BMF-01      G----HRVEVQIARKLQ------------------------CIADQFHRL
Q8K589_BMF-01          GQFLQHRAEVQIARKLQ------------------------CIADQFHRL
A0A337ST43_BMF-05      GHW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A337ST43_BMF-04      GHW-QHRAEVQIARKLQ------------------------CIADQFHRL
A2AV74_BMF-01          GQFLQHRAEVQIARKLQ------------------------CIADQFHRL
A0A286XXB0_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
G3WDQ2_BMF-01          EQW-EHRAEVQIARKLQ------------------------CIADQFHRL
G3T7Z4_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADHFHRL
A0A287CXH0_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A1S3WU31_BMF-01      GQW-QQRVEVQIARKLQ------------------------CIADQFHHL
A0A337ST43_BMF-03      GHW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A337ST43_BMF-01      GHW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A1U8CPE0_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
G1SR62_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
M3YAD5_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
U6CSY8_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A452SED0_BMF-01      GPW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A384D070_BMF-01      GPW-QHRAEVQIARKLQ------------------------CIADQFHRL
W5QFV1_BMF-01          GQW-QHRAEIQIARKLQ------------------------CIADQFHRL
L8IXF5_BMF-01          GQW-QHRAEIQIARKLQ------------------------CIADQFHRL
A0A452F2E0_BMF-01      GQW-QHRAEIQIARKLQ------------------------CIADQFHRL
A0A452F2E0_BMF-02      GQW-QHRAEIQIARKLQ------------------------CIADQFHRL
Q05KI3_BMF-02          GQW-QHRAEIQIARKLQ------------------------CIADQFHRL
Q05KI3_BMF-01          GQW-QHRAEIQIARKLQ------------------------CIADQFHRL
A0A2K6FFN3_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
H0WYH6_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A096NTE9_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6L919_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K5E1Q4_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6TW78_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6TW78_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K5RN49_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHQL
A0A2I2Z168_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2R9BS98_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2J8QDD5_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2J8T301_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
F7CM09_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K5MJW4_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K5KGP2_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K5VLE9_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
F7CM09_BMF-03          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
F7CM09_BMF-02          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6B5F6_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6B5F6_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6B5F6_BMF-04      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K5Z4A9_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6L919_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6L919_BMF-03      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A2K6RAW1_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A0D9R4R5_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
J9PB65_BMF-04          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
J9PB65_BMF-03          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
J9PB65_BMF-02          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
J9PB65_BMF-01          GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A3Q2HR24_BMF-01      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A3Q2HR24_BMF-02      GQW-QHRAEVQIARKLQ------------------------CIADQFHRL
A0A3B4UNJ0_BMF-01      EEQAGVSVEAQIGRKLR------------------------EIGDKFQQD
A0A3B4B6Y3_BMF-01      HPVAVRSMEACIGHKLQ------------------------LIGDQFHRD
A0A3P9ICE1_BMF-01      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
Q0GKC7_BMF-01          EPRPAQSVETLIGQKLQ------------------------LIGDQFYQE
A0A3B3RH63_BMF-01      DDRPQPSAEVRIGQKLQ------------------------MIGDQFHQD
W5N4P7_BMF-01          EEQPVRSAEVRIGQKLQ------------------------RIGDQFHRD
A0A3B1K1X5_BMF-01      RRP-AHSVEARIGQKLQ------------------------MIGDQFYQE
A0A3B4CNJ8_BMF-01      RRP-PHSVEARIGQKLQ------------------------MIGDQFYQE
A0A2U9CJH3_BMF-01      QQPVAHSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q2YCX7_BMF-01      QQPVARSIEACVGQKLQ------------------------LIGDQFHRE
A0A3Q2YCX7_BMF-02      QQPVARSIEACVGQKLQ------------------------LIGDQFHRE
A0A3P8ZIE7_BMF-01      QQLPQQPVARCIGQKLQ------------------------LIGDQFHEE
A0A3Q2PJX9_BMF-02      HQPAALSLEACIGQKLQ------------------------LIGDQFHRE
A0A3Q3QZ16_BMF-01      QQRVARSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q3QZ16_BMF-02      QQRVARSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q2PJX9_BMF-01      HQPAALSLEACIGQKLQ------------------------LIGDQFHRE
A0A3Q2PJX9_BMF-03      HQPAALSLEACIGQKLQ------------------------LIGDQFHRE
A0A3B5QK08_BMF-01      HQPAALSLEASIGQKLQ------------------------LIGDQFHRE
A0A3B5QK08_BMF-02      HQPAALSLEASIGQKLQ------------------------LIGDQFHRE
A0A096LRV0_BMF-01      HQPAALSLEACIGQKLQ------------------------LIGDQFHRE
A0A3B3WU80_BMF-01      HQPAALSLEACIGQKLQ------------------------LIGDQFHRE
A0A3P9Q8E2_BMF-01      HQPAALSLEACIGQKLQ------------------------LIGDQFHRE
A0A3Q2CXC4_BMF-02      QQPAALSLEACIGQKLQ------------------------IIGDQFHRE
A0A3Q2CXC4_BMF-01      QQPAALSLEACIGQKLQ------------------------IIGDQFHRE
A0A3Q3GUU5_BMF-01      QQPVAHSVEASIGLKLQ------------------------LIGDQFHRE
A0A3B5B8F6_BMF-01      QQPVARSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q3VLX6_BMF-01      QQPVAHSVEACIGQKLQ------------------------LIGDQFHRE
A0A3P8UA78_BMF-02      QQPVQRSVEVRIGQKLQ------------------------LIGDQFHRD
A0A3P8UA78_BMF-01      QQPVQRSVEVRIGQKLQ------------------------LIGDQFHRD
A0A3P8UA78_BMF-03      QQPVQRSVEVRIGQKLQ------------------------LIGDQFHRD
A0A3B3CGR9_BMF-01      QQPAARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3P9K487_BMF-02      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3P9K487_BMF-01      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3B3HAU1_BMF-03      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3B3HAU1_BMF-02      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3B3HAU1_BMF-01      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3B3HAU1_BMF-04      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3P9ICE1_BMF-04      QQPVARSTEACIAQKLQ------------------------LIGDQFHRE
A0A3Q2ZA20_BMF-01      QLPVARSLEVCIGQKLQ------------------------LIGDQFHRE
A0A3P8NFE2_BMF-02      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
I3K2D6_BMF-01          QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3P8NFE2_BMF-01      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3Q3C5V2_BMF-01      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3P9DPJ5_BMF-01      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3P9DPJ5_BMF-02      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3B4ETH0_BMF-01      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3Q4G1I4_BMF-01      QRPAARSVEACIGQKLQ------------------------LIGDQFHWE
A0A3Q1FVH7_BMF-02      QQPMAHSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q1FVH7_BMF-01      QQPMAHSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q3RVI2_BMF-01      QQPLVHSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q1D1K3_BMF-01      QQPVARSMEACIGQKLQ------------------------LIGDQFHRE
A0A3P8RKY9_BMF-01      QQPVARSMEACIGQKLQ------------------------LIGDQFHRE
A0A3Q3RVI2_BMF-02      QQPLVHSVEACIGQKLQ------------------------LIGDQFHRE
A0A3Q1IPR4_BMF-01      QQPLMQSVEACIGQKLQ------------------------LIGDQFHRE
A0A3B4U5H8_BMF-01      QQPVARSVEACIGQKLQ------------------------LIGDQFHRE
A0A3B4WM88_BMF-01      QQPVARSVEACIGQKLQ------------------------LIGDQFHRE
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A493T7X1_BMF-01      VFKF-------------------------------------------G--
A0A452H3N6_BMF-01      HIQR-----------------------------H------QQNR---N--
A0A287AIU8_BMF-02      HMQQ-----------------------------H------QQNQ---N--
G1PAU1_BMF-01          QMQQ-----------------------------H------QQNR---N--
A0A287AIU8_BMF-01      HMQQ-----------------------------H------QQNQ---N--
A0A1U8CPE0_BMF-02      HIQQ-----------------------------H------QQNR---D--
A0A286XXB0_BMF-03      HIQQ-----------------------------H------QQNR---N--
A0A287CXH0_BMF-02      HMQQ-----------------------------H------QQNR---N--
A0A1S3EQA2_BMF-02      HTQR-----------------------------H------QQHR---D--
A2AV74_BMF-02          HTQQ-----------------------------H------QQNR---D--
H9GL49_BMF-01          HLQR-----------------------------H------QQNR---N--
A0A3Q2UCA0_BMF-02      HIQR-----------------------------V------GCFH---R--
A0A3Q2UCA0_BMF-01      HIQR-----------------------------V------GCFH---R--
K7FRX2_BMF-01          HIQR-----------------------------H------QQNR---N--
U3JS06_BMF-01          HIQR-----------------------------H------QQNR---N--
A0A493T7X1_BMF-02      HIQR-----------------------------H------QQNR---N--
A0A3Q2UCA0_BMF-03      HIQR-----------------------------H------QQNR---N--
A0A3Q2UCA0_BMF-04      HIQR-----------------------------H------QQNR---N--
G1NHG8_BMF-01          HIQR-----------------------------H------QQNR---N--
A0A337ST43_BMF-02      HHRK-----------------------------D------ISED------
A0A2K5KGP2_BMF-01      HQEH-----------------------------R------QEGHRAGL--
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      HTQR-----------------------------H------QQHR---D--
Q8K589_BMF-01          HMQQ-----------------------------H------QQNR---D--
A0A337ST43_BMF-05      HMQQVGMGAWGGGRVCWGWGARTCLSNSVSARLY------QDMV---P--
A0A337ST43_BMF-04      HMQQ-----------------------------H------QQNR---R--
A2AV74_BMF-01          HTQQ-----------------------------H------QQNR---D--
A0A286XXB0_BMF-02      HIQQ-----------------------------H------QQNR---N--
G3WDQ2_BMF-01          HMQR-----------------------------H------QQNQ---N--
G3T7Z4_BMF-01          HMQR-----------------------------H------QQNR---N--
A0A287CXH0_BMF-01      HMQQ-----------------------------H------QQNR---N--
A0A1S3WU31_BMF-01      HMQQ-----------------------------H------QQNR---N--
A0A337ST43_BMF-03      HMQQ-----------------------------V------GMGAWGGG--
A0A337ST43_BMF-01      HMQQ-----------------------------H------QQNR---R--
A0A1U8CPE0_BMF-01      HIQQ-----------------------------H------QQNR---D--
G1SR62_BMF-01          HLQQ-----------------------------H------QQNR---N--
M3YAD5_BMF-01          HMQQ-----------------------------H------QQNQ---N--
U6CSY8_BMF-01          HMQQ-----------------------------H------QQNQ---N--
A0A452SED0_BMF-01      HMQQ-----------------------------H------QQNQ---N--
A0A384D070_BMF-01      HMQQ-----------------------------H------QQNQ---N--
W5QFV1_BMF-01          HMQQ-----------------------------H------QQNR---N--
L8IXF5_BMF-01          HMQQ-----------------------------Y------QQNR---N--
A0A452F2E0_BMF-01      HMQQ-----------------------------H------QQNR---N--
A0A452F2E0_BMF-02      HMQQ-----------------------------H------QQNR---N--
Q05KI3_BMF-02          HMQQ-----------------------------Y------QQNR---N--
Q05KI3_BMF-01          HMQQ-----------------------------Y------QQNR---N--
A0A2K6FFN3_BMF-01      HVQQ-----------------------------H------QQNQ---N--
H0WYH6_BMF-01          HVQQ-----------------------------H------QQNQ---N--
A0A096NTE9_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2K6L919_BMF-02      HVQQ-----------------------------H------QQNR---N--
A0A2K5E1Q4_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2K6TW78_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2K6TW78_BMF-02      HVQQ-----------------------------H------QQNR---N--
A0A2K5RN49_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2I2Z168_BMF-01      HVQQ-----------------------------H------QQNQ---N--
A0A2R9BS98_BMF-01      HVQQ-----------------------------H------QQNQ---N--
A0A2J8QDD5_BMF-02      HVQQ-----------------------------H------QQNQ---N--
A0A2J8T301_BMF-01      HVQQ-----------------------------H------QQNR---N--
F7CM09_BMF-01          HVQQ-----------------------------H------QQNR---N--
A0A2K5MJW4_BMF-02      HVQQ-----------------------------H------QQNR---N--
A0A2K5KGP2_BMF-02      HVQQ-----------------------------H------QQNR---N--
A0A2K5VLE9_BMF-02      HVQQ-----------------------------H------QQNR---N--
F7CM09_BMF-03          HVQQ-----------------------------H------QQNR---N--
F7CM09_BMF-02          HVQQ-----------------------------H------QQNR---N--
A0A2K6B5F6_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2K6B5F6_BMF-02      HVQQ-----------------------------H------QQNR---N--
A0A2K6B5F6_BMF-04      HVQQ-----------------------------H------QQNR---N--
A0A2K5Z4A9_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2K6L919_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A2K6L919_BMF-03      HVQQ-----------------------------H------QQNR---N--
A0A2K6RAW1_BMF-01      HVQQ-----------------------------H------QQNR---N--
A0A0D9R4R5_BMF-01      HVQQ-----------------------------H------QQNR---N--
J9PB65_BMF-04          HMQQ-----------------------------H------QQNQ---N--
J9PB65_BMF-03          HMQQ-----------------------------H------QQNQ---N--
J9PB65_BMF-02          HMQQ-----------------------------H------QQNQ---N--
J9PB65_BMF-01          HMQQ-----------------------------H------QQNQ---N--
A0A3Q2HR24_BMF-01      HMQQ-----------------------------H------QQNR---N--
A0A3Q2HR24_BMF-02      HMQQ-----------------------------H------QQNR---N--
A0A3B4UNJ0_BMF-01      HF--------------------------------------MRHQRQNL--
A0A3B4B6Y3_BMF-01      HLQR-----------------------------V------REH-------
A0A3P9ICE1_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
Q0GKC7_BMF-01          HI--------------------------------------MHHQRPQD--
A0A3B3RH63_BMF-01      QLQL-----------------------------Y------HRNQRNQQ--
W5N4P7_BMF-01          YLHM-----------------------------Y------RRNQRNHQ--
A0A3B1K1X5_BMF-01      HMLQ------------------------------------HRNQRNQQ--
A0A3B4CNJ8_BMF-01      HMLQ------------------------------------HRNQRNQQ--
A0A2U9CJH3_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q2YCX7_BMF-01      HLQL-----------------------------V------SRNQHKHK--
A0A3Q2YCX7_BMF-02      HLQL-----------------------------V------SRNQHKHK--
A0A3P8ZIE7_BMF-01      HLQL-----------------------------Y------HRNQRNLR--
A0A3Q2PJX9_BMF-02      HLQQ-----------------------------R------GSFRSSLAAG
A0A3Q3QZ16_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q3QZ16_BMF-02      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q2PJX9_BMF-01      HLQQ-----------------------------Y------HQNQRNQG--
A0A3Q2PJX9_BMF-03      HLQQ-----------------------------Y------HQNQRNQG--
A0A3B5QK08_BMF-01      HLQQ-----------------------------Y------QQNQRNQG--
A0A3B5QK08_BMF-02      HLQQ-----------------------------Y------QQNQRNQG--
A0A096LRV0_BMF-01      HLQQ-----------------------------Y------QQNQRNQG--
A0A3B3WU80_BMF-01      HLQQ-----------------------------Y------QQNQRNQG--
A0A3P9Q8E2_BMF-01      HLQQ-----------------------------Y------QQNQRNQG--
A0A3Q2CXC4_BMF-02      HLQQ-----------------------------IPGQPFPHLVHQHQALT
A0A3Q2CXC4_BMF-01      HLQQ-----------------------------Y------HQNQRNQG--
A0A3Q3GUU5_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3B5B8F6_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q3VLX6_BMF-01      HMQL-----------------------------Y------HRNQRNQG--
A0A3P8UA78_BMF-02      HLQL-----------------------------Y------HRNQRNHG--
A0A3P8UA78_BMF-01      HLQL-----------------------------Y------HRNQRNHG--
A0A3P8UA78_BMF-03      HLQL-----------------------------Y------HRNQRNHG--
A0A3B3CGR9_BMF-01      RLQL-----------------------------Y------HQNQRNQG--
A0A3P9K487_BMF-02      RLQL-----------------------------Y------HRNQRNQG--
A0A3P9K487_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
A0A3B3HAU1_BMF-03      RLQL-----------------------------Y------HRNQRNQG--
A0A3B3HAU1_BMF-02      RLQL-----------------------------Y------HRNQRNQG--
A0A3B3HAU1_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
A0A3B3HAU1_BMF-04      RLQL-----------------------------Y------HRNQRNQG--
A0A3P9ICE1_BMF-04      RLQL-----------------------------Y------HRNQRNQG--
A0A3Q2ZA20_BMF-01      HLQQ-----------------------------Y------HRNQRNQG--
A0A3P8NFE2_BMF-02      RLQL-----------------------------V------KASRIQTC--
I3K2D6_BMF-01          RLQL-----------------------------Y------HRNQRNQG--
A0A3P8NFE2_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
A0A3Q3C5V2_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
A0A3P9DPJ5_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
A0A3P9DPJ5_BMF-02      RLQL-----------------------------Y------HRNQRNQG--
A0A3B4ETH0_BMF-01      RLQL-----------------------------Y------HRNQRNQG--
A0A3Q4G1I4_BMF-01      RLQL-----------------------------Y------QRNQRNQG--
A0A3Q1FVH7_BMF-02      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q1FVH7_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q3RVI2_BMF-01      HLQL----------------------------------------------
A0A3Q1D1K3_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3P8RKY9_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3Q3RVI2_BMF-02      HLQL-----------------------------Y------HLNQRNQG--
A0A3Q1IPR4_BMF-01      HLQL-----------------------------Y------HRNQRNQG--
A0A3B4U5H8_BMF-01      HLQL-----------------------------Y------HQNQRNQG--
A0A3B4WM88_BMF-01      HLQL-----------------------------Y------HQNQRNHG--
A9XRH0_BMF-01          ----------------------------------------QRHQQNRN--
A3KND0_BMF-01          ----------------------------------------GKEALS----
                                                                         

A0A493T7X1_BMF-01      ----VLWT-----------------PLCCSLPCEAGSSCPTLSKESQNVG
A0A452H3N6_BMF-01      ----QVWW-----------------QILLFI------HNLALNVEVNRNH
A0A287AIU8_BMF-02      ----RVWW-----------------QILLFL------HNLALHGDENRNG
G1PAU1_BMF-01          ----RMWW-----------------QFLLFL------HNLALNGDENRNG
A0A287AIU8_BMF-01      ----RVWW-----------------QILLFL------HNLALHGDENRNG
A0A1U8CPE0_BMF-02      ----RAWW-----------------QVFLFL------QNLALNREENREG
A0A286XXB0_BMF-03      ----RAWW-----------------QVLLFM------HNLGLNGEENREG
A0A287CXH0_BMF-02      ----RVWW-----------------QILLFL------HNLALNGDENRDR
A0A1S3EQA2_BMF-02      ----RAWG-----------------QVLLFL------HNLALNR-ENRDR
A2AV74_BMF-02          ----RAWW-----------------QVFLFL------QNLALNRQENREG
H9GL49_BMF-01          ----QVWW-----------------QIFFFL------HNVALNMEANRHR
A0A3Q2UCA0_BMF-02      ----GRWG-----------------LSYLRVVLQKTGSRLRLSRLLPKAA
A0A3Q2UCA0_BMF-01      ----GRWG-----------------LSYLRVVLQKTGSRLRLSRLLPKAA
K7FRX2_BMF-01          ----QVWW-----------------QILLFL------HNLALNVEANRNH
U3JS06_BMF-01          ----QVWW-----------------QLFLFL------HNLALNTEVNRNH
A0A493T7X1_BMF-02      ----QVWW-----------------QLFLFL------HNLALNVEANRNH
A0A3Q2UCA0_BMF-03      ----QVWW-----------------QLFLFL------HNLALNVEANRNR
A0A3Q2UCA0_BMF-04      ----QVWW-----------------QLFLFL------HNLALNVEANRNR
G1NHG8_BMF-01          ----QVWW-----------------QLFLFL------HNLALNVEANRNR
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      ----TLCL-----------------VKLFFC------CYFAF--------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      ----RAWG-----------------QVLLFL------HNLALN-RENRDR
Q8K589_BMF-01          ----RAWR-----------------QVFLFL------QNLALNRRENREG
A0A337ST43_BMF-05      ----EFWP-----------------RLL----------------------
A0A337ST43_BMF-04      ----RVWW-----------------QILLFL------HNLALNAEENRNG
A2AV74_BMF-01          ----RAWW-----------------QVFLFL------QNLALNRQENREG
A0A286XXB0_BMF-02      ----RAWW-----------------QVLLFM------HNLGLNGEENREG
G3WDQ2_BMF-01          ----HVWW-----------------QILLFL------HNLALNREENRNG
G3T7Z4_BMF-01          ----PAWR-----------------QILQFL------HHLAVNGEENRNG
A0A287CXH0_BMF-01      ----RVWW-----------------QILLFL------HNLALNGDENRDR
A0A1S3WU31_BMF-01      ----PVWW-----------------PFLLFL------HNLALNEGENRNR
A0A337ST43_BMF-03      ----RVCW-----------------------------------------G
A0A337ST43_BMF-01      ----RVWW-----------------QILLFL------HNLALNAEENRNG
A0A1U8CPE0_BMF-01      ----RAWW-----------------QVFLFL------QNLALNREENREG
G1SR62_BMF-01          ----RVWW-----------------QILLFL------HNLALNGDENRDG
M3YAD5_BMF-01          ----RVWW-----------------QILLFL------HNLALNADENRNG
U6CSY8_BMF-01          ----RVWW-----------------QILLFL------HNLALNADGNRNG
A0A452SED0_BMF-01      ----RVWW-----------------QILLFL------HNLALNADENRDG
A0A384D070_BMF-01      ----RVWW-----------------QILLFL------HNLALNADENRDG
W5QFV1_BMF-01          ----RMWW-----------------QILLFL------HNVALNGDENRNG
L8IXF5_BMF-01          ----RMWW-----------------QILLFL------HNVALNGDENRNG
A0A452F2E0_BMF-01      ----RMWW-----------------QILLFL------HNVALNGDENRNG
A0A452F2E0_BMF-02      ----RMWW-----------------QILLFL------HNVALNGDENRNG
Q05KI3_BMF-02          ----RMWW-----------------QILLFL------HNVALNGDENRNG
Q05KI3_BMF-01          ----RMWW-----------------QILLFL------HNVALNGDENRNG
A0A2K6FFN3_BMF-01      ----RMWW-----------------QILLFL------HNLALNGEENRNG
H0WYH6_BMF-01          ----RVWW-----------------QVLFFL------HNLALNGEENRNG
A0A096NTE9_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K6L919_BMF-02      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K5E1Q4_BMF-01      ----RVWW-----------------QVLLFL------HNLALNGEENRNG
A0A2K6TW78_BMF-01      ----RVWW-----------------QVLLFL------HNLALNGEENRNG
A0A2K6TW78_BMF-02      ----RVWW-----------------QVLLFL------HNLALNGEENRNG
A0A2K5RN49_BMF-01      ----RVWW-----------------QVLLFL------HNLALNGEENRNG
A0A2I2Z168_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2R9BS98_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2J8QDD5_BMF-02      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2J8T301_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
F7CM09_BMF-01          ----RVWW-----------------QILLFL------HNLALNGEQNRNG
A0A2K5MJW4_BMF-02      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K5KGP2_BMF-02      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K5VLE9_BMF-02      ----RVWW-----------------QILLFL------HNLALNGEENRNG
F7CM09_BMF-03          ----RVWW-----------------QILLFL------HNLALNGEQNRNG
F7CM09_BMF-02          ----RVWW-----------------QILLFL------HNLALNGEQNRNG
A0A2K6B5F6_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K6B5F6_BMF-02      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K6B5F6_BMF-04      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K5Z4A9_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K6L919_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K6L919_BMF-03      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A2K6RAW1_BMF-01      ----RVWW-----------------QILLFL------HNLALNGEENRNG
A0A0D9R4R5_BMF-01      ----RMWW-----------------QILLFL------HNLALNGEENRNG
J9PB65_BMF-04          ----RVWW-----------------QILLFL------HNLALNADENRNG
J9PB65_BMF-03          ----RVWW-----------------QILLFL------HNLALNADENRNG
J9PB65_BMF-02          ----RVWW-----------------QILLFL------HNLALNADENRNG
J9PB65_BMF-01          ----RVWW-----------------QILLFL------HNLALNADENRNG
A0A3Q2HR24_BMF-01      ----RVWW-----------------QTLLFL------HNLALNGDENRNG
A0A3Q2HR24_BMF-02      ----RVWW-----------------QTLLFL------HNLALNGDENRNG
A0A3B4UNJ0_BMF-01      ----PAWM-----------------RLTMAL------FGFLFPRQALVPR
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
Q0GKC7_BMF-01          ----PLWR-----------------RVATAV------LTLLF-------G
A0A3B3RH63_BMF-01      ----PVWW-----------------RLVMAL------CGLLFER-----R
W5N4P7_BMF-01          ----PMWW-----------------RLALAL------FTFLFERQGNRNQ
A0A3B1K1X5_BMF-01      ----PLWL-----------------RLASAL------YTLLFEREPAAHG
A0A3B4CNJ8_BMF-01      ----PFWL-----------------RLASAL------YTLLFEREPVANG
A0A2U9CJH3_BMF-01      ----PLWW-----------------RLAAAL------LSLLFDRGFLAGG
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      ----PLWW-----------------RLASAL------LTLLWEQEAVAGG
A0A3Q2PJX9_BMF-02      EVGKPMYYTNVYSQCPTCWLANCLSRLAAEL------LILCEFPTLL---
A0A3Q3QZ16_BMF-01      ----PLWW-----------------RLATTL------LSLLFDRGFIAGG
A0A3Q3QZ16_BMF-02      ----PLWW-----------------RLATTL------LSLLFDRGFIAGG
A0A3Q2PJX9_BMF-01      ----PLWW-----------------RMTAAL------LSLLLDRGFVAGR
A0A3Q2PJX9_BMF-03      ----PLWW-----------------RMTAAL------LSLLLDRGFVAGR
A0A3B5QK08_BMF-01      ----PLWW-----------------RMTAAL------LSLLFDRGFIAGG
A0A3B5QK08_BMF-02      ----PLWW-----------------RMTAAL------LSLLFDRGFIAGG
A0A096LRV0_BMF-01      ----PLWW-----------------RMTAAL------LSLLFHRGFIAGG
A0A3B3WU80_BMF-01      ----PLWW-----------------RMTAAL------LSLLFHRGFIAGG
A0A3P9Q8E2_BMF-01      ----PLWW-----------------RMTAAL------LSLLFDRGFIAGG
A0A3Q2CXC4_BMF-02      LPPLPVYF-----------------SLLSPV------VPL------CCGG
A0A3Q2CXC4_BMF-01      ----PLWW-----------------RMTAAL------LSLLFDRGLIGGA
A0A3Q3GUU5_BMF-01      ----PLWW-----------------RLGAAL------LSLLFDRGFIA--
A0A3B5B8F6_BMF-01      ----PLWW-----------------RLAAAL------LSLLFDRGFIAGG
A0A3Q3VLX6_BMF-01      ----PLWW-----------------RLGSAL------LSLLFDRGFFAGG
A0A3P8UA78_BMF-02      ----PLWW-----------------RLTTTL------LSLLFNRGFFAGG
A0A3P8UA78_BMF-01      ----PLWW-----------------RLTTTL------LSLLFNRGFFAGG
A0A3P8UA78_BMF-03      ----PLWW-----------------RLTTTL------LSLLFNRGFFAGG
A0A3B3CGR9_BMF-01      ----PLWW-----------------RLTTAL------VSLLLDRGFIAGG
A0A3P9K487_BMF-02      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3P9K487_BMF-01      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3B3HAU1_BMF-03      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3B3HAU1_BMF-02      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3B3HAU1_BMF-01      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3B3HAU1_BMF-04      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3P9ICE1_BMF-04      ----PVWW-----------------RLATAL------VSLLFDRGFIAGA
A0A3Q2ZA20_BMF-01      ----PLWW-----------------RLTAAL------LSLLFDRGFIAGG
A0A3P8NFE2_BMF-02      -------W---------------LETAEAYA------TPCKVHHSVITVW
I3K2D6_BMF-01          ----PMWW-----------------RLAAAL------LSLLFDRGFIAGG
A0A3P8NFE2_BMF-01      ----PMWW-----------------RLAAAI------LSLLFDRGFIAGG
A0A3Q3C5V2_BMF-01      ----PMWW-----------------RLAAAI------LSLLFDRGFIAGG
A0A3P9DPJ5_BMF-01      ----PMWW-----------------RLAAAI------LSLLFDRGFIAGG
A0A3P9DPJ5_BMF-02      ----PMWW-----------------RLAAAI------LSLLFDRGFIAGG
A0A3B4ETH0_BMF-01      ----PMWW-----------------RLAAAI------LSLLFDRGFIAGG
A0A3Q4G1I4_BMF-01      ----PMWW-----------------RLAAAI------LSLLFDRGFIAGG
A0A3Q1FVH7_BMF-02      ----PLWW-----------------RLVAAI------LSLLFDGGFIAGG
A0A3Q1FVH7_BMF-01      ----PLWW-----------------RLVAAI------LSLLFDGGFIAGG
A0A3Q3RVI2_BMF-01      ----QVGW---------------APETSGSL------PVLLACLTLITGV
A0A3Q1D1K3_BMF-01      ----PLWW-----------------RLAAAV------LSLLFDRGFIAGG
A0A3P8RKY9_BMF-01      ----PLWW-----------------RLAAAV------LSLLFDRGFIAGG
A0A3Q3RVI2_BMF-02      ----LLWW-----------------RLATAL------LSLLFDRGFIAGG
A0A3Q1IPR4_BMF-01      ----PLWW-----------------RLAAAM------LSLLFDRGLIAGG
A0A3B4U5H8_BMF-01      ----PLWW-----------------RLAVAL------LSLLFDRGLIAGG
A0A3B4WM88_BMF-01      ----PLWW-----------------RLAAAL------LSLLFDRGLIAGG
A9XRH0_BMF-01          ----QVWW-----------------QLFLFL------HNLALNVEANRNR
A3KND0_BMF-01          -------------------------EIYRMF------NASIPHESHRFHR
                                                                         

A0A493T7X1_BMF-01      VFGKACCWVPAPVTSVQERQVLG---------------------------
A0A452H3N6_BMF-01      VGQR----------------------------------------------
A0A287AIU8_BMF-02      AGPR----------------------------------------------
G1PAU1_BMF-01          AGPR----------------------------------------------
A0A287AIU8_BMF-01      AGPR----------------------------------------------
A0A1U8CPE0_BMF-02      VGPW----------------------------------------------
A0A286XXB0_BMF-03      AGPR----------------------------------------------
A0A287CXH0_BMF-02      AGPR----------------------------------------------
A0A1S3EQA2_BMF-02      AGPR----------------------------------------------
A2AV74_BMF-02          VGPW----------------------------------------------
H9GL49_BMF-01          AGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI-----------------
A0A3Q2UCA0_BMF-02      AGYRQ---------------------------------------------
A0A3Q2UCA0_BMF-01      AGYRQ---------------------------------------------
K7FRX2_BMF-01          IGQR----------------------------------------------
U3JS06_BMF-01          TGQR----------------------------------------------
A0A493T7X1_BMF-02      TGQR----------------------------------------------
A0A3Q2UCA0_BMF-03      TGQR----------------------------------------------
A0A3Q2UCA0_BMF-04      TGQR----------------------------------------------
G1NHG8_BMF-01          TGQR----------------------------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      AGPR----------------------------------------------
Q8K589_BMF-01          VGPW----------------------------------------------
A0A337ST43_BMF-05      --------------------------------------------------
A0A337ST43_BMF-04      AGPR----------------------------------------------
A2AV74_BMF-01          VGPW----------------------------------------------
A0A286XXB0_BMF-02      AGPR----------------------------------------------
G3WDQ2_BMF-01          AGPR----------------------------------------------
G3T7Z4_BMF-01          AGPR----------------------------------------------
A0A287CXH0_BMF-01      AGPR----------------------------------------------
A0A1S3WU31_BMF-01      EAPR----------------------------------------------
A0A337ST43_BMF-03      WGARTCLSNSVSARLYQDMVPEFWPRLL----------------------
A0A337ST43_BMF-01      AGPRTSPGMRAFVKHC----------------------------------
A0A1U8CPE0_BMF-01      VGPW----------------------------------------------
G1SR62_BMF-01          AGPR----------------------------------------------
M3YAD5_BMF-01          AGPR----------------------------------------------
U6CSY8_BMF-01          AGPR----------------------------------------------
A0A452SED0_BMF-01      AGPR----------------------------------------------
A0A384D070_BMF-01      AGPR----------------------------------------------
W5QFV1_BMF-01          AGPR----------------------------------------------
L8IXF5_BMF-01          AGPR----------------------------------------------
A0A452F2E0_BMF-01      AGPR----------------------------------------------
A0A452F2E0_BMF-02      AGPR----------------------------------------------
Q05KI3_BMF-02          AGPR----------------------------------------------
Q05KI3_BMF-01          AGPR----------------------------------------------
A0A2K6FFN3_BMF-01      AGPR----------------------------------------------
H0WYH6_BMF-01          AGPR----------------------------------------------
A0A096NTE9_BMF-01      VDPRYKNARRSVRKLKASSFLSCQPE------------------------
A0A2K6L919_BMF-02      AGPRPLTWNGGRCQTLLKGRLMCL--------------------------
A0A2K5E1Q4_BMF-01      AGPR----------------------------------------------
A0A2K6TW78_BMF-01      AGPR----------------------------------------------
A0A2K6TW78_BMF-02      AGPR----------------------------------------------
A0A2K5RN49_BMF-01      AGLR----------------------------------------------
A0A2I2Z168_BMF-01      AGPR----------------------------------------------
A0A2R9BS98_BMF-01      AGPR----------------------------------------------
A0A2J8QDD5_BMF-02      AGPR----------------------------------------------
A0A2J8T301_BMF-01      AGPR----------------------------------------------
F7CM09_BMF-01          AGPRPLTWNGAVVKPC----------------------------------
A0A2K5MJW4_BMF-02      AGPR----------------------------------------------
A0A2K5KGP2_BMF-02      AGPR----------------------------------------------
A0A2K5VLE9_BMF-02      AGPR----------------------------------------------
F7CM09_BMF-03          AGPR----------------------------------------------
F7CM09_BMF-02          AGPR----------------------------------------------
A0A2K6B5F6_BMF-01      AGPR----------------------------------------------
A0A2K6B5F6_BMF-02      AGPR----------------------------------------------
A0A2K6B5F6_BMF-04      AGPR----------------------------------------------
A0A2K5Z4A9_BMF-01      AGPR----------------------------------------------
A0A2K6L919_BMF-01      AGPR----------------------------------------------
A0A2K6L919_BMF-03      AGPR----------------------------------------------
A0A2K6RAW1_BMF-01      AGPR----------------------------------------------
A0A0D9R4R5_BMF-01      AGPR----------------------------------------------
J9PB65_BMF-04          AGPR----------------------------------------------
J9PB65_BMF-03          AGPS-------------------FQLVPGISCSGAQQDCSCL--------
J9PB65_BMF-02          AGPS------------QSLQIRFWRLSRNLPCSLRSKTTTPQD-G-----
J9PB65_BMF-01          AGPS------------QSLQIRFWRLSRNLPCSLRRPATRIRSLG-----
A0A3Q2HR24_BMF-01      AGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL---
A0A3Q2HR24_BMF-02      AGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLS--WS----
A0A3B4UNJ0_BMF-01      LRGEQR--------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      GGAGQR--------------------------------------------
Q0GKC7_BMF-01          ARENRR--------------------------------------------
A0A3B3RH63_BMF-01      QRAEQR--------------------------------------------
W5N4P7_BMF-01          LRGDQR--------------------------------------------
A0A3B1K1X5_BMF-01      RREDRR--------------------------------------------
A0A3B4CNJ8_BMF-01      RRVDQR--------------------------------------------
A0A2U9CJH3_BMF-01      GGAGRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPAN
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      GRAGWR--------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q3QZ16_BMF-01      GGAGRR--------------------------------------------
A0A3Q3QZ16_BMF-02      GGAGRR--------------------------------------------
A0A3Q2PJX9_BMF-01      GGAGRR--------------------------------------------
A0A3Q2PJX9_BMF-03      GGAGRR--------------------------------------------
A0A3B5QK08_BMF-01      GGAGRR--------------------------------------------
A0A3B5QK08_BMF-02      GGAGRR--------------------------------------------
A0A096LRV0_BMF-01      GGAGRR--------------------------------------------
A0A3B3WU80_BMF-01      GGAGRR--------------------------------------------
A0A3P9Q8E2_BMF-01      GGAGRR--------------------------------------------
A0A3Q2CXC4_BMF-02      KWH-----------------------------------------------
A0A3Q2CXC4_BMF-01      GWR-----------------------------------------------
A0A3Q3GUU5_BMF-01      -GAGRR--------------------------------------------
A0A3B5B8F6_BMF-01      GGAGRR--------------------------------------------
A0A3Q3VLX6_BMF-01      GGAGRR--------------------------------------------
A0A3P8UA78_BMF-02      GAAGRR--------------------------------------------
A0A3P8UA78_BMF-01      GAAGRR--------------------------------------------
A0A3P8UA78_BMF-03      GAAGRR--------------------------------------------
A0A3B3CGR9_BMF-01      GGAGQR--------------------------------------------
A0A3P9K487_BMF-02      GGAGQRLSVMSD--------------------------------------
A0A3P9K487_BMF-01      GGAGQR--------------------------------------------
A0A3B3HAU1_BMF-03      GGAGQR--------------------------------------------
A0A3B3HAU1_BMF-02      GGAGQR--------------------------------------------
A0A3B3HAU1_BMF-01      GGAGQR--------------------------------------------
A0A3B3HAU1_BMF-04      GGAGQRQSVVSD--------------------------------------
A0A3P9ICE1_BMF-04      GGAGQRLSVLSD--------------------------------------
A0A3Q2ZA20_BMF-01      GGAGRR--------------------------------------------
A0A3P8NFE2_BMF-02      KPRGLSQWQFLTVN------------------------------------
I3K2D6_BMF-01          GGGGRR--------------------------------------------
A0A3P8NFE2_BMF-01      GGGGRR--------------------------------------------
A0A3Q3C5V2_BMF-01      GGGGRR--------------------------------------------
A0A3P9DPJ5_BMF-01      GGGGRR--------------------------------------------
A0A3P9DPJ5_BMF-02      GGGGRR--------------------------------------------
A0A3B4ETH0_BMF-01      GGGGRR--------------------------------------------
A0A3Q4G1I4_BMF-01      GGGGRR--------------------------------------------
A0A3Q1FVH7_BMF-02      GGAGRR--------------------------------------------
A0A3Q1FVH7_BMF-01      GGAGRR--------------------------------------------
A0A3Q3RVI2_BMF-01      WREG----------------------------------------------
A0A3Q1D1K3_BMF-01      GGAGRR--------------------------------------------
A0A3P8RKY9_BMF-01      GGAGRR--------------------------------------------
A0A3Q3RVI2_BMF-02      GRAGRR--------------------------------------------
A0A3Q1IPR4_BMF-01      GGAGRR--------------------------------------------
A0A3B4U5H8_BMF-01      GGAGRR--------------------------------------------
A0A3B4WM88_BMF-01      GGAGRR--------------------------------------------
A9XRH0_BMF-01          TGQR----------------------------------------------
A3KND0_BMF-01          LFQV----------------------------------------------
                                                                         

A0A493T7X1_BMF-01      ---------
A0A452H3N6_BMF-01      ---------
A0A287AIU8_BMF-02      ---------
G1PAU1_BMF-01          ---------
A0A287AIU8_BMF-01      ---------
A0A1U8CPE0_BMF-02      ---------
A0A286XXB0_BMF-03      ---------
A0A287CXH0_BMF-02      ---------
A0A1S3EQA2_BMF-02      ---------
A2AV74_BMF-02          ---------
H9GL49_BMF-01          ---------
A0A3Q2UCA0_BMF-02      ---------
A0A3Q2UCA0_BMF-01      ---------
K7FRX2_BMF-01          ---------
U3JS06_BMF-01          ---------
A0A493T7X1_BMF-02      ---------
A0A3Q2UCA0_BMF-03      ---------
A0A3Q2UCA0_BMF-04      ---------
G1NHG8_BMF-01          ---------
A0A337ST43_BMF-02      ---------
A0A2K5KGP2_BMF-01      ---------
A0A2K6FFN3_BMF-02      ---------
A0A2K5E1Q4_BMF-02      ---------
A0A2K5RN49_BMF-02      ---------
A0A2K6TW78_BMF-03      ---------
A0A2K6RAW1_BMF-02      ---------
A0A2I2Z168_BMF-02      ---------
A0A2R9BS98_BMF-02      ---------
A0A2J8QDD5_BMF-01      ---------
A0A2K5MJW4_BMF-01      ---------
A0A2K5VLE9_BMF-01      ---------
A0A2K6B5F6_BMF-03      ---------
A0A2K5Z4A9_BMF-02      ---------
A0A096NTE9_BMF-03      ---------
A0A2I3HD83_BMF-01      ---------
A0A1S3EQA2_BMF-01      ---------
Q8K589_BMF-01          ---------
A0A337ST43_BMF-05      ---------
A0A337ST43_BMF-04      ---------
A2AV74_BMF-01          ---------
A0A286XXB0_BMF-02      ---------
G3WDQ2_BMF-01          ---------
G3T7Z4_BMF-01          ---------
A0A287CXH0_BMF-01      ---------
A0A1S3WU31_BMF-01      ---------
A0A337ST43_BMF-03      ---------
A0A337ST43_BMF-01      ---------
A0A1U8CPE0_BMF-01      ---------
G1SR62_BMF-01          ---------
M3YAD5_BMF-01          ---------
U6CSY8_BMF-01          ---------
A0A452SED0_BMF-01      ---------
A0A384D070_BMF-01      ---------
W5QFV1_BMF-01          ---------
L8IXF5_BMF-01          ---------
A0A452F2E0_BMF-01      ---------
A0A452F2E0_BMF-02      ---------
Q05KI3_BMF-02          ---------
Q05KI3_BMF-01          ---------
A0A2K6FFN3_BMF-01      ---------
H0WYH6_BMF-01          ---------
A0A096NTE9_BMF-01      ---------
A0A2K6L919_BMF-02      ---------
A0A2K5E1Q4_BMF-01      ---------
A0A2K6TW78_BMF-01      ---------
A0A2K6TW78_BMF-02      ---------
A0A2K5RN49_BMF-01      ---------
A0A2I2Z168_BMF-01      ---------
A0A2R9BS98_BMF-01      ---------
A0A2J8QDD5_BMF-02      ---------
A0A2J8T301_BMF-01      ---------
F7CM09_BMF-01          ---------
A0A2K5MJW4_BMF-02      ---------
A0A2K5KGP2_BMF-02      ---------
A0A2K5VLE9_BMF-02      ---------
F7CM09_BMF-03          ---------
F7CM09_BMF-02          ---------
A0A2K6B5F6_BMF-01      ---------
A0A2K6B5F6_BMF-02      ---------
A0A2K6B5F6_BMF-04      ---------
A0A2K5Z4A9_BMF-01      ---------
A0A2K6L919_BMF-01      ---------
A0A2K6L919_BMF-03      ---------
A0A2K6RAW1_BMF-01      ---------
A0A0D9R4R5_BMF-01      ---------
J9PB65_BMF-04          ---------
J9PB65_BMF-03          ---------
J9PB65_BMF-02          ---------
J9PB65_BMF-01          ---------
A0A3Q2HR24_BMF-01      ---------
A0A3Q2HR24_BMF-02      ---------
A0A3B4UNJ0_BMF-01      ---------
A0A3B4B6Y3_BMF-01      ---------
A0A3P9ICE1_BMF-01      ---------
Q0GKC7_BMF-01          ---------
A0A3B3RH63_BMF-01      ---------
W5N4P7_BMF-01          ---------
A0A3B1K1X5_BMF-01      ---------
A0A3B4CNJ8_BMF-01      ---------
A0A2U9CJH3_BMF-01      GRLPCALIG
A0A3Q2YCX7_BMF-01      ---------
A0A3Q2YCX7_BMF-02      ---------
A0A3P8ZIE7_BMF-01      ---------
A0A3Q2PJX9_BMF-02      ---------
A0A3Q3QZ16_BMF-01      ---------
A0A3Q3QZ16_BMF-02      ---------
A0A3Q2PJX9_BMF-01      ---------
A0A3Q2PJX9_BMF-03      ---------
A0A3B5QK08_BMF-01      ---------
A0A3B5QK08_BMF-02      ---------
A0A096LRV0_BMF-01      ---------
A0A3B3WU80_BMF-01      ---------
A0A3P9Q8E2_BMF-01      ---------
A0A3Q2CXC4_BMF-02      ---------
A0A3Q2CXC4_BMF-01      ---------
A0A3Q3GUU5_BMF-01      ---------
A0A3B5B8F6_BMF-01      ---------
A0A3Q3VLX6_BMF-01      ---------
A0A3P8UA78_BMF-02      ---------
A0A3P8UA78_BMF-01      ---------
A0A3P8UA78_BMF-03      ---------
A0A3B3CGR9_BMF-01      ---------
A0A3P9K487_BMF-02      ---------
A0A3P9K487_BMF-01      ---------
A0A3B3HAU1_BMF-03      ---------
A0A3B3HAU1_BMF-02      ---------
A0A3B3HAU1_BMF-01      ---------
A0A3B3HAU1_BMF-04      ---------
A0A3P9ICE1_BMF-04      ---------
A0A3Q2ZA20_BMF-01      ---------
A0A3P8NFE2_BMF-02      ---------
I3K2D6_BMF-01          ---------
A0A3P8NFE2_BMF-01      ---------
A0A3Q3C5V2_BMF-01      ---------
A0A3P9DPJ5_BMF-01      ---------
A0A3P9DPJ5_BMF-02      ---------
A0A3B4ETH0_BMF-01      ---------
A0A3Q4G1I4_BMF-01      ---------
A0A3Q1FVH7_BMF-02      ---------
A0A3Q1FVH7_BMF-01      ---------
A0A3Q3RVI2_BMF-01      ---------
A0A3Q1D1K3_BMF-01      ---------
A0A3P8RKY9_BMF-01      ---------
A0A3Q3RVI2_BMF-02      ---------
A0A3Q1IPR4_BMF-01      ---------
A0A3B4U5H8_BMF-01      ---------
A0A3B4WM88_BMF-01      ---------
A9XRH0_BMF-01          ---------
A3KND0_BMF-01          ---------
                                

© 1998-2020Legal notice