Dataset for protein Bim of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
        p    g              v       r l   r p     g   r    lg g     p        a r
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
g ggrra rgtrrg prlylsepar sgc ag  ag sspr g  r  agsg a  g glg  s s a  l    f  r 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
            r r rr r    r   rll valrv  spg  l          dc      mfpaaaagaarargaac
                                                                   p    hs p pw 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------------------mak
galgcpaecggglagrrglcaapgtlnpspqlctlrclrgdgqgapgrrrararrrgararartlrsmlktrtkkdqrpp
                        agpr  eclf         tl        g p         k egdlsrmhss---
                                                                   gstgtmrsqtlrq
                                                                     raal rp  qn
                                                                      n   e   gs
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qpsdvssecdr-----egrqlqpaer-----------p--pq-lrpgaptslqte---pqgn------------------
nqangnt-vt-     --g----eqgfdfpq      tggdppsggataraaehqersr---pegnhgrgggegdscphg
-rp-lgaglsa     g -rvpstg-           ssq--qpsarigsrskstd rqmppegdsqsassig grglqr
g--sa--fe-s     r  a lavrh           ktpgsh------agisiss n-ragqr aptseppm  g sg 
allerppi-it          ers-t           epdelavdt ssm-pr--r qycrs a qgd   ss    g  
 s g-acarkg            - e           -a adnr r  f-tnppr   stfa s ese   qf       
   p k r g             g              y qa g     i --gp   ne   p  rv    t       
         f             r                sr         g qc   a    d  l             
                                                   v ra                         
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------pp-aspgpfatrsplfif--------------s--lsrsssgyfsfd-tdr---sp---
rgepdsdspprsvsspqgpla-- ---------------           vrr-sl------------ ---lps--l  
g         ct  pavs flml n llvyqs   i rt           msp rvpr a     tve sesv g     
                     s  d  sg rk   v hp               ptfp        y  ci i       
                     l  t  d       f sl                 t            g          
                        s             y                              a          
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------ap--mscdkstqtpsppcqafnhylsam-----asmr----------------------------
               --rp------------------------g    v-r-qsgpgt lqlhgh dawpnspnpysprp
               s n vtaaqag ndevtsavms ahqrl     -vaeee     qrdy s el   plhhsrtqq
               m h lkenrd     lsg eit q vqi     geilgg     ngq           s  p hg
               p   i ds t      wf  pk   e       dreilp     h                    
                   a h         h   vi           si-hrd                          
                     v             l            tnwdvt                          
                                                 dfw r                          
                                                 qst a                          
                                                 lqq f                          
                                                 k a                            
                                                 a s                            

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qaepadmrpeiwiaqe--------lrrigdefnayy-prr----------------------------------------
--v-------------        ------------la--v     rmalrhrrgqvaqlflnnyqaaedalnnvaqlra
is-agllqgvmrvgrd         yg   dyhrllm-ptl     gv gggqnnvipaknvphllqepafmc       
vvaiegtfefqftllq         qa     ehssicdsr      l rsrl vil gflhkdhssssggg        
agpvsawgsltlpc            l     knhafqsge        a q  ag  lneqrrfhpvgtvv        
sldsrhhwa avf                   ywtfchg m                 vrvdqqireprkl         
pnilpevn  sa                     evv kq a                 pqqalsmpilnl          
rplth ih  vy                     dc  s  i                 eemmspvfddhv          
hetev q   l                          l                     a nilpe r h          
efg   c   e                          r                       wf a  h p          
 ir                                  y                          c  f i          
 hs                                  t                               e          

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pnehaiimhpqmvilrllryivlrlgriiyrrgntnshdhsqrlvwrmh             t s  e            
        plddilgqvvgllirlilqlmllqrs s q    vvi ilq                               
        qmcvlv   mhfflgvr    wm  g          l  r                                
        wsrppf    ci fh v     q                                                 
        lqhf      sh                                                            
         nw       qs                                                            
         fn                                                                     
          p                                                                     
          i                                                                     
          s                                                                     
          a                                                                     

       730     
....:....|....:
               
---------------
               
               
               
               
               
               
               
               
               
               
               
© 1998-2022Legal notice