Dataset for protein Bim of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
etpdiepglsgllrlsaggsggvwftlyserplcstrtprpplvgeeerlhfelgdgcalshpqpshsskharrgqggrr
mf a                                                                      aaa aa
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aqrgtrrgrprlylseparvsgc sggeaglssprggrglagaghavigrglgaaslswaaglrrfhfaprslqvsslqe
ra  a                   araal cpae a gdr as                                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rlvprrrrrrrrhhryrhhhrlltvalrvlasrgsilsrcwrsgg vrpapaaathsapfpwp lrpprp radsqg pp
                mfpaaacaalrprsfapalcgpdal     p r  sgdnqg lgrr   cla   a  g    g
                          aalg  a a ac  a     a    lc ap     s                  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------makqpsdvssecd---------reggqlqpaer---p---pqlrp-g---
rrv raglrprsprcrtltsglrgarkkdq-s-r-pnlldgstevtpae   gt-rdpas--sart-rssshters-   
    klrrgssgaqal rrlegknrtvtqms-s-t-vrn----tlketg   --s---p-vg-pgqagqtk--qacr   
      la rlpsp s mkaqmsdtslgmchtng v-aggresg  ag    tr stv-rtsgvdsstpp-rf--gc   
         ga          apmlirrltpptk rs--cprqf  rq    es qrtrqsnaswaqslkapsns s   
                     sdeea fi lll  arqat ppa        sg  gsedgaprtv aa q adq p   
                           e  qd    ewrp  n         ki  val r hfsf       cg e   
                                       n                m g   c a               
                                       a                                        
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--aptslqtepqg----------------sp-gp----lappaspgpfatrsplfif-r------rsssgyfsfd-tdrs
  ----g-s-q--npegnpggegdrcphg--q--rtk -------------------v-rsslls----------g--sl
  srqa-a-trgrgggdshe rrgspdqd epcs    vslgngldvyqsslgi rpmsifpvprt       ve se--
  qqsfiriqsv     ggd aqresess  src    irsst wsgsrk   f htp  nrtfp        a  cs v
  e lp dpd-p     ers     aspe  rdg    stm d mlnn a   v qlr   h           y  a  i
  n eq pglaa              l    l      p g i   r      m   l               l  g   
    ah nvpyr                   g      f                  t                      
     e haa s                                             s                      
       e                                                                        
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
P-aPms-----cd--------------kstQtpsppcqa-----fnhylsam---------------------asmrqsq
-ss-l-phpvta-             n-a------tg-v     m--a-qr-a vehgggpgtqlglhghspn-------
 g- -m rrl -n             is-v dgqlssv-     -sr-s--lt ear  aqrmeqqq psqdhvyrtegi
    vl k a vs              rta  a n-- l     ikehmeqig   q   a f hrp  ehhsdrswrav
           te              qe      de w     vt   rchs                qefppeiager
           pq              a                lr   h                   n a hveiivn
           hh                                                        k   ehqllqp
                                                                     d   r lc pl
                                                                         g g  mh
                                                                           a  de
                                                                               a
                                                                               s
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
aepadmrpeiwiaqe--------lrrigdefnayy-rrv-----------------------------------------
sv-------------  tr is ------------p---maflnnyqaaednlmhpqqqepvam                
n-agglqavmrvgrq        tqassgdyknslapgrvflrhhrppvpgtsvphihs  tfl                
fairltfshtftvld        dakl    drlfchalggevpqhnisqaqplqqlf   a i                
-dvpeipgfvyplhw         yg     aeh mltmavrkrrdagisllrpniv                       
vptehwneisv ivg         fs      lt lvpisrsdqpclelapgn ter                       
eissqqh  ll fe           n      d  sn alqgqgsvvvplv a r h                       
wl ma    ee c                      rg grlhnydnrlfht   i a                       
gg       ac                        ie fnmyhlclhhd h   c                         
pt       q                         fc e kwgfgwfqn     a                         
l        n                         y    cvfeyad m                               
t                                  t     pacl c h                               
                                          s f   g                               

       570       580       590       600       610  
....:....|....:....|....:....|....:....|....:....|..
                                                    
------ll--------------------------------------------
 mvilr--ryivrlvwrmqntsshdhsqvg v     v              
 livglvillliqiiymlhsrn wgn                          
 fclcqfshvvghfmllrg it q g                          
 vwmpiyksrnlnrcvpqr                                 
 inhkfi gf s  fr ey                                 
  lfsd   s f     g                                  
  hnrp   c a                                        
  g n                                               
  f                                                 
                                                    
                                                    
                                                    
© 1998-2020Legal notice