Dataset for protein Bim of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

134 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
C1KGB6_BCL2L11-02       ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
C1KGB6_BCL2L11-03       ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
C1KGB6_BCL2L11-01       ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
J9NWV6_BCL2L11-01       TRPA----------------------------------------------
A0A3Q2GRS5_BCL2L11      MFPA----------------------------------------------
A0A3Q2GRS5_BCL2L11      MFPA----------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
C1KGB6_BCL2L11-02       HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
C1KGB6_BCL2L11-03       HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
C1KGB6_BCL2L11-01       HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
J9NWV6_BCL2L11-01       ------------------------GGRAGGARRGTRPGHPRLYLLEPERA
A0A3Q2GRS5_BCL2L11      ------------------------AAAGAARARGA---------------
A0A3Q2GRS5_BCL2L11      ------------------------AAAGAARARGA---------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
C1KGB6_BCL2L11-02       SGC-SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAP
C1KGB6_BCL2L11-03       SGC-SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAP
C1KGB6_BCL2L11-01       SGC-SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAP
J9NWV6_BCL2L11-01       SRCGAAGRGGASGPRGGAGPGGGG--------------------------
A0A3Q2GRS5_BCL2L11      ----ARGALGCPAERGGGGRAASG--------------------------
A0A3Q2GRS5_BCL2L11      ----ARGALGCPAERGGGGRAASG--------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
C1KGB6_BCL2L11-02       RSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDC
C1KGB6_BCL2L11-03       RSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDC
C1KGB6_BCL2L11-01       RSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDC
J9NWV6_BCL2L11-01       -------------ARGDWLRARGRQSERSCRAVQVSLRSAQPPGLGLARG
A0A3Q2GRS5_BCL2L11      ------------------------------RLCAVLAPLSASPGLCLPRC
A0A3Q2GRS5_BCL2L11      ------------------------------RLCAVLAPLSASPGLCLPRC
A0A2R8M6L7_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       ----------------------------------------MGRAGRGPGA
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------MFPAAATRAARARGAARGAVGCPA
M3YDI3_BCL2L11-01       --------------------------MFPAAAAGAARARGAARGALGCRT
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      ----------------------------------------------LLSA
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
C1KGB6_BCL2L11-02       W-----VRPAPAAATHSAPFPW---------------------------P
C1KGB6_BCL2L11-03       W-----VRPAPAAATHSAPFPW---------------------------P
C1KGB6_BCL2L11-01       W-----VRPAPAAATHSAPFPW---------------------------P
J9NWV6_BCL2L11-01       LRPASPPPPPPPPDSHSRPTRPSPLRPASPRAARFAPLPPPPLWRPFLGP
A0A3Q2GRS5_BCL2L11      L----------SGDNQGAPGRR----------------------KARAGR
A0A3Q2GRS5_BCL2L11      L----------SGDNQGAPGRR----------------------KARAGR
A0A2R8M6L7_BCL2L11      -------------------------MPARVCAPVSQAVDIVTVFCLGLRS
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       AQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERRGLAEELLLEPDS
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      ERSGGLAGRRGLCAAPGTLNPSPGLCLLHCLRGDGQGPPGRRKARVGRRG
M3YDI3_BCL2L11-01       ARGGGRAASGRLCAAPGALKASPRLCLPRFFRAEGQGAPGRRRTRAGRRG
F7CXT2_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-02       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-03       --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A250YBV9_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A1S3FFM9_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------MPLSVRSYLWIW
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      ---------------------ANRTPSLVGPEQKKRNGGNLRGGGADPEP
A0A3B1JXK6_BCL2L11      ---------------------MSRPSNRATRPPFLKEQG---ERGQ----
A0A3B4BVX1_BCL2L11      RKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQG---ESGQ----
A0A3P8XIA2_BCL2L11      ------------------MFDSSRPQNRSNGTTTLIGRG---KIGESHPC
A0A3Q1ICY2_BCL2L11      --------------------MDPRQPNRSDGSTAVTATG---ESGGDPPP
A0A3Q3K6I5_BCL2L11      -------------------MHLSRPPNRSDGSTAVTATE---ES-GDPPS
A0A3B4V919_BCL2L11      -------MKAQADGAALFIQQTTKPVRWLDRSNG-KRGE---RRGSTTRR
A0A3B4XZH1_BCL2L11      -------MKAQADGAALFIQQTTKPVRWLDRSNG-KRGE---RRGSTTRR
A0A3Q3ESW6_BCL2L11      ------------------MHRPSRPPNRLDGSPTVTESH---GTRGDPPQ
A0A3Q2SZH6_BCL2L11      ---------------MVTLCSSNRPPNLRDGSTEVTPPE---GTGGDPAS
A0A3B3VNE0_BCL2L11      -------------------MHSSRPPNLLDGSTEVTPAE---GTGGDPAS
A0A3B3YII5_BCL2L11      -------------------MHSLRPPNLLDGSTEVTPAE---GTGGDPAS
A0A3B3YII5_BCL2L11      -------------------MHSLRPPNLLDGSTEVTPAE---GTGGDPAS
A0A3P9N073_BCL2L11      ----------------------------------------------DPAS
A0A3Q3B113_BCL2L11      ------------------MRSPSRPPNLRDGSTEVKATE---GSSGGAPP
A0A3B5M375_BCL2L11      -------------MLTVTLCSSNRPPNLLDGSTEVTPAE---GTGGDPAS
A0A3B5QAM1_BCL2L11      -------------MLTVTLCSSNRPPNLLDGSTEVTPAE---GTGGDPAS
A0A3B5QAM1_BCL2L11      -------------------MHSLRPPNLLDGSTEVTPAE---GTGGDPAS
M3XHJ5_BCL2L11-01       ----------MPTEESLQFDKDQGTSDVISEC-------------GHLHP
A0A3G3M2M0_BCL2L11      --------------------MSDTSREQTPGNV---------PASRGSGE
A0A3Q1ELG4_BCL2L11      --------------------SSSAASPAAPHAD---------TTEGGGAD
A0A3Q1CI15_BCL2L11      --------------------PTKSGPDAAARCF---------TSGSRCRD
A0A3Q3SYA1_BCL2L11      -----------MATEESGDPPAGDPRVSAQTSR---------SNGGTDQS
B2KKY9_BCL2L11-01       -----------MSDTSREQTLANGPASQGSGES---------TGGGVVLP
B8JK68_BCL2L11-01       -----------MSDTSREQTLANGPASQGSGES---------TGGGVVLP
R4G9R5_BCL2L11-01       ----------------------------------------------MLVV
A0A3B3QC78_BCL2L11      ----------------MGQILLTIPCSVCSAED---------KITRMAES
F7CXT2_BCL2L11-01       --------------------MAKQPSDLNSECD---------REGGQLQP
F7FTC8_BCL2L11-01       --------------------MAKQPSDLNSECD---------SEGGRLEP
C1KGB6_BCL2L11-02       SSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD---------REGGQLQP
C1KGB6_BCL2L11-03       SSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD---------REGGQLQP
C1KGB6_BCL2L11-01       SSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD---------REGGQLQP
J9NWV6_BCL2L11-01       RPPQCLTLTLGLRNARKKDQMAKQPSDVSSECD---------REGGQLQP
A0A3Q2GRS5_BCL2L11      RGARARTRRSEGKGRIKKDQMAKQPSDVSSECD---------REGGQLQP
A0A3Q2GRS5_BCL2L11      RGARARTRRSEGKGRIKKDQMAKQPSDVSSECD---------REGGQLQP
A0A2R8M6L7_BCL2L11      LVPPSTKQKLCLYYFRKRDQMAKQPSDVSSECD---------REGRQLQP
G3SU55_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
G3W979_BCL2L11-01       --------------------MAKQPSDLNSECD---------REGGQLQP
U3IW89_BCL2L11-01       --------------------GGAGKHGAGTGRD---------GRGGQRQP
A0A3Q2U844_BCL2L11      --------------------MAKQPPEAKAPRD---------RRAGRLPP
A0A3B4BVX1_BCL2L11      -------------------------MQNSNYCC---------FEQGESGQ
A0A3P8XIA2_BCL2L11      -----------------------RESSCEGNQQ---------SRGGIMMP
K7GA86_BCL2L11-01       LLFRQSLSASYSLDAGKGDQMAKQPSDLNSECD---------GEGGQFQS
O43521_BCL2L11-20       --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2R8M6L7_BCL2L11      APSRARTLRSEGKARTKRDQMAKQPSDVSSECD---------REGRQLQP
M3YDI3_BCL2L11-01       A--RARTRRSEGKGRTKKDQMAKQPSDVSSECD---------REGGQLQP
F7CXT2_BCL2L11-02       --------------------MAKQPSDLNSECD---------REGGQLQP
G1SSY0_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
J9NWV6_BCL2L11-06       --------------------MAKQPSDVSSECD---------REGGQLQP
C1KGB8_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A3Q2GRS5_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
U6CTE3_BCL2L11-04       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A1U7T0R1_BCL2L11      --------------------MAKQPSVVSSECD---------REGGQLQP
J9NWV6_BCL2L11-02       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A2K6TRU4_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5NU92_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2I2YQ13_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5X1Y3_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6QIL2_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5HZI5_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2I3GVB2_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2R9C366_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2I3SN61_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5HZI5_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2I2YQ13_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6QIL2_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5Q1Y0_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6GE31_BCL2L11      --------------------MAKQPSDVGSECD---------REGGQLQS
A0A1U7T0R1_BCL2L11      --------------------MAKQPSVVSSECD---------REGGQLQP
A0A1U7T0R1_BCL2L11      --------------------MAKQPSVVSSECD---------REGGQLQP
O54918_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
O88498_BCL2L11-01       --------------------MAKQPSDVNSECD---------REGGQLQP
A0A2K5Z7V3_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A096NYC3_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5X1Y3_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6E212_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5NU92_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A096NYC3_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6KJP8_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2I3SN61_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2R8M6L7_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5CA89_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5Q1Y0_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A1U7T0R1_BCL2L11      --------------------MAKQPSVVSSECD---------REGGQLQP
A0A1U7T0R1_BCL2L11      --------------------MAKQPSVVSSECD---------REGGQLQP
A0A3Q2GRS5_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
J9NWV6_BCL2L11-04       --------------------MAKQPSDVSSECD---------REGGQLQP
U6CTE3_BCL2L11-02       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A1U8BW10_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A1U7T0R1_BCL2L11      --------------------MAKQPSVVSSECD---------REGGQLQP
A0A2K6GE31_BCL2L11      --------------------MAKQPSDVGSECD---------REGGQLQS
A0A287DFJ0_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A452FCR6_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
W5PY58_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
L8IVA4_BCL2L11-02       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A286XJN2_BCL2L11      --------------------MAKQPSDVSCECD---------REGGQLQP
A0A286XJN2_BCL2L11      --------------------MAKQPSDVSCECD---------REGGQLQP
G1SSY0_BCL2L11-02       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A250YBV9_BCL2L11      --------------------MAKQPSDASSECD---------REGGQLQP
H0XW23_BCL2L11-01       --------------------MAKQPSDVGSECD---------REGGQLQP
A0A1S3FFM9_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
U6CTE3_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
G1LDR8_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
J9NWV6_BCL2L11-03       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A2I2UX96_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
O54918_BCL2L11-03       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A1U8BW10_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
J9NWV6_BCL2L11-05       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A3Q2GRS5_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A452U4S4_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A2R9C366_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2I3GVB2_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6TRU4_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A0D9RWE0_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
U6CTE3_BCL2L11-03       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A2K6E212_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
H2P5E2_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGRQLQP
A0A250YBV9_BCL2L11      --------------------MAKQPSDASSECD---------REGGQLQP
A0A286XJN2_BCL2L11      --------------------MAKQPSDVSCECD---------REGGQLQP
A0A2I2UX96_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A1S3FFM9_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A452SBG5_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A3Q1MV27_BCL2L11      LGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECD---------REGGQLQP
A0A1U8BW10_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A287DFJ0_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
L8IVA4_BCL2L11-01       --------------------MAKQPSDVSSECD---------REGGQLQP
A0A3Q1MV27_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A452FCR6_BCL2L11      --------------------MAKQPSDVSSECD---------REGGQLQP
A0A2K5CA89_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K5Z7V3_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
A0A2K6KJP8_BCL2L11      --------------------MAKQPSDVSSECD---------REGRQLQP
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       ----------FLLCA-----------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      VGAAGVSAKTSRLNST--------------------------GGEPDSPS
A0A3B1JXK6_BCL2L11      --SGGGGGTLSRAEQCE-----QPEPGDGDPVRGP---------------
A0A3B4BVX1_BCL2L11      --SSGAASSRA-AEQCE-----QPEPGEGDPVRGG---------------
A0A3P8XIA2_BCL2L11      GGATSSSKLSDYPQSC---------EGNQQSRGGI---------------
A0A3Q1ICY2_BCL2L11      VGAAGVSTPTSRSNDGG-----ERRFGRPDSSGGG-----------EPES
A0A3Q3K6I5_BCL2L11      VGAAGTSAQSSRSNGGS-----ERSFGHPGSAGGG-----------EPVS
A0A3B4V919_BCL2L11      --CRWSPSAKPQFER---------------------------QRRAEPWP
A0A3B4XZH1_BCL2L11      --CRWSPGAKPQFER---------------------------QRRAETIA
A0A3Q3ESW6_BCL2L11      --TSRS-------DNSG-----GRNFGRTDSTGGG-----------EPDS
A0A3Q2SZH6_BCL2L11      --SARTPRLSKHREGSC-----AQPPGAVTAAGGGG-------GEPDSDS
A0A3B3VNE0_BCL2L11      --SARTPRSSKHTERSC-----APQTGASTAGGGGGGGGGG-GGEPDADS
A0A3B3YII5_BCL2L11      --SARTPRSSKHTERSC-----APQAGASTAGGGGGGGGGG-RGEPDSDS
A0A3B3YII5_BCL2L11      --SARTPRSSKHTERSC-----APQAGASTAGGGGGGGGGG-RGEPDSDS
A0A3P9N073_BCL2L11      --SARTPRSSKHTERSC-----APQAGASTAGGGGGGG----RGEPDSDS
A0A3Q3B113_BCL2L11      --SAGAARGSAHATR--------PVRGRAPSAAGG-----------EPES
A0A3B5M375_BCL2L11      --SARTPRSSKHTERSR-----APQAGASTAGGGGGGEGEGRRGEPDSDS
A0A3B5QAM1_BCL2L11      --SARTPRSSKHTERSR-----APQAGASTAGGGGGGEGGGRRGEPDSDS
A0A3B5QAM1_BCL2L11      --SARTPRSSKHTERSR-----APQAGASTAGGGGGGEGGGRRGEPDSDS
M3XHJ5_BCL2L11-01       TQRPDQP---PFVKQEGCYCIISPLSKVIALV--------RWRDRSLLST
A0A3G3M2M0_BCL2L11      SAGVGAALRPGHFDF-P-----QPSDGDPLRG------------------
A0A3Q1ELG4_BCL2L11      PEPVGAAGVSAKTSR-S-----NSTGGEPDSP------------------
A0A3Q1CI15_BCL2L11      SERL----------P-P-----NPSHGSPDSP------------------
A0A3Q3SYA1_BCL2L11      SVS---P---SRGRT-R-----SIAHLDSLSV------------------
B2KKY9_BCL2L11-01       AGHFDFP------QP-G---------------------------------
B8JK68_BCL2L11-01       AGHFDFP------QP-G---------------------------------
R4G9R5_BCL2L11-01       GSS---Q---PQLCL-------LPKQLNVLSANA----------------
A0A3B3QC78_BCL2L11      RNPVAEQ---TPIQA-GPRTAKVPGQLQATPR------------------
F7CXT2_BCL2L11-01       TERPTQP---QQLRP-G-----APTSIQTQYQ------------------
F7FTC8_BCL2L11-01       AEGPAQP---PQLRP-G-----APTSIRTQYQ------------------
C1KGB6_BCL2L11-02       AER---P---PQLRP-G-----APTSLQTERQ------------------
C1KGB6_BCL2L11-03       AER---P---PQLRP-G-----APTSLQTERQGN----PEGEGDRCPQGS
C1KGB6_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTERQGN----PEGEGDRCPQGS
J9NWV6_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A3Q2GRS5_BCL2L11      AER---P---PQLRP-G-----APTSLQIEQQ------------------
A0A3Q2GRS5_BCL2L11      AER---P---PQLRP-G-----APTSLQIEQQGN----PGGEGDRCPQGS
A0A2R8M6L7_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
G3SU55_BCL2L11-01       AER---PPQPPQLRP-G-----APTSLLTEPQGN----PDGEGDSCPQGS
G3W979_BCL2L11-01       TER---PTQ-PQLRP-G-----APTSIQTQYQGN-----SGEGDSCSPSS
U3IW89_BCL2L11-01       RA------------------------------------------------
A0A3Q2U844_BCL2L11      GEG---PGPAVPLRP-G-----APAALPGAAR------------------
A0A3B4BVX1_BCL2L11      SSG---A---ASSRA-A-----EQCEQPEPGEGDPV--------------
A0A3P8XIA2_BCL2L11      TNS---L---LGFQS-R-----SPLFRTTSTS------------------
K7GA86_BCL2L11-01       IERPSQP---QHLRP-G-----APTSIQTQYQ------------------
O43521_BCL2L11-20       AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A2R8M6L7_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
M3YDI3_BCL2L11-01       VER---P---PQLRP-G-----APTSLQTEQQ------------------
F7CXT2_BCL2L11-02       TERPTQP---QQLRP-G-----APTSIQTQYQGN-----SGEGDSCSPSS
G1SSY0_BCL2L11-01       AER---P---PQLRP-G-----APTSLQSEPQ------------------
J9NWV6_BCL2L11-06       AER---P---PQLRP-G-----APTSLQTEQQ------------------
C1KGB8_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTERQ------------------
A0A3Q2GRS5_BCL2L11      AER---P---PQLRP-G-----APTSLQIEQQ------------------
U6CTE3_BCL2L11-04       VER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A1U7T0R1_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
J9NWV6_BCL2L11-02       AER---P---PQLRP-G-----APTSLQTEQQGNPE----GEGDRCPQGS
A0A2K6TRU4_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K5NU92_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2I2YQ13_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K5X1Y3_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K6QIL2_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEDNHGGEGDSCPHGS
A0A2K5HZI5_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2I3GVB2_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2R9C366_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2I3SN61_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K5HZI5_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2I2YQ13_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K6QIL2_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEDNHGGEGDSCPHGS
A0A2K5Q1Y0_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K6GE31_BCL2L11      VER---P---PQLRP-G-----APTSLQTEPQGNPEGSREGEGDRCSHGS
A0A1U7T0R1_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGSPGGEGDRCPHGS
A0A1U7T0R1_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGSPGGEGDRCPHGS
O54918_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTEPQGN----PDGEGDRCPHGS
O88498_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTESQGN----PDGEGDRCPHGS
A0A2K5Z7V3_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A096NYC3_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K5X1Y3_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K6E212_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K5NU92_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A096NYC3_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K6KJP8_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEDNHGGEGDSCPHGS
A0A2I3SN61_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2R8M6L7_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCLHGS
A0A2K5CA89_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A2K5Q1Y0_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGNHGGEGDSCPHGS
A0A1U7T0R1_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGSPGGEGDRCPHGS
A0A1U7T0R1_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGSPGGEGDRCPHGS
A0A3Q2GRS5_BCL2L11      AER---P---PQLRP-G-----APTSLQIEQQGNPG----GEGDRCPQGS
J9NWV6_BCL2L11-04       AER---P---PQLRP-G-----APTSLQTEQQGNPE----GEGDRCPQGS
U6CTE3_BCL2L11-02       VER---P---PQLRP-G-----APTSLQTEQQGNPE----GEGDRCPQGS
A0A1U8BW10_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQGN----PDGEGDRCPHGS
A0A1U7T0R1_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGNPEGSPGGEGDRCPHGS
A0A2K6GE31_BCL2L11      VER---P---PQLRP-G-----APTSLQTEPQGNPEGSREGEGDRCSHGS
A0A287DFJ0_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQGN----PEGEGDRCPHGS
A0A452FCR6_BCL2L11      AER---P---PQLRP-G-----APTSLQTERQGN----PEGEGDRCPQGS
W5PY58_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTERQGN----PEGEGDRCPQGS
L8IVA4_BCL2L11-02       AER---P---PQLRP-G-----APTSLQTERQGN----PEGEGDRCPQGS
A0A286XJN2_BCL2L11      AER---P---SQLRA-G-----APTSLQTEPQGN----PEGAGDRSPHGS
A0A286XJN2_BCL2L11      AER---P---SQLRA-G-----APTSLQTEPQGN----PEGAGDRSPHGS
G1SSY0_BCL2L11-02       AER---P---PQLRP-G-----APTSLQSEPQGNP------EGDRCAHGS
A0A250YBV9_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPPGNPEGSPAGEGDRCPHGS
H0XW23_BCL2L11-01       AER---P---PQLRP-G-----APTSLHTEPQGNPEGNPEVEGDRCPQGS
A0A1S3FFM9_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQGNPEGSPEGEGDRCPQGS
U6CTE3_BCL2L11-01       VER---P---PQLRP-G-----APTSLQTEQQGN----PEGEGDRCPQGS
G1LDR8_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTEQQGN----PEGEGDRCPQGS
J9NWV6_BCL2L11-03       AER---P---PQLRP-G-----APTSLQTEQQGN----PEGEGDRCPQGS
A0A2I2UX96_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQGN----PEGEGDRCPQGS
O54918_BCL2L11-03       AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A1U8BW10_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQ------------------
J9NWV6_BCL2L11-05       AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A3Q2GRS5_BCL2L11      AER---P---PQLRP-G-----APTSLQIEQQ------------------
A0A452U4S4_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A2R9C366_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A2I3GVB2_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A2K6TRU4_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A0D9RWE0_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
U6CTE3_BCL2L11-03       VER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A2K6E212_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
H2P5E2_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A250YBV9_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPP------------------
A0A286XJN2_BCL2L11      AER---P---SQLRA-G-----APTSLQTEPQ------------------
A0A2I2UX96_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A1S3FFM9_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A452SBG5_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A3Q1MV27_BCL2L11      AER---P---PQLRP-G-----APTSLQTERQ------------------
A0A1U8BW10_BCL2L11      AER---P---PQLRP-G-----APTSLQTEQQ------------------
A0A287DFJ0_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
L8IVA4_BCL2L11-01       AER---P---PQLRP-G-----APTSLQTERQ------------------
A0A3Q1MV27_BCL2L11      AER---P---PQLRP-G-----APTSLQTERQ------------------
A0A452FCR6_BCL2L11      AER---P---PQLRP-G-----APTSLQTERQ------------------
A0A2K5CA89_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A2K5Z7V3_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
A0A2K6KJP8_BCL2L11      AER---P---PQLRP-G-----APTSLQTEPQ------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      WSRA-------QASLGVFQTRS-IFHLPR------RSSSGYFSADGADSV
A0A3B1JXK6_BCL2L11      --------PALHNSLLGYQTRSPLFRTLS------RSSSGYFSFD-SE--
A0A3B4BVX1_BCL2L11      --------ITMPNSLLGYQSRSPLFRTLS------RSSSGYFSFE-SE--
A0A3P8XIA2_BCL2L11      --------MMPTNSLLGFQSRSPLFRTTS------TSSSGYFSFD-CDSI
A0A3Q1ICY2_BCL2L11      QSRCRTKSSSSSDGLGVF--RS-VFRLPR------RSSSGYFSYD-SDSQ
A0A3Q3K6I5_BCL2L11      PSRCRTKAIAPLDSLSVFHTRS-IFHLPR------RSSSGYFSND-SDSV
A0A3B4V919_BCL2L11      PRLHRRRRARLAAPVQNHSHLS-CQHFSR------RSSSGYFSFD-SDSL
A0A3B4XZH1_BCL2L11      --------TSPGNSLGVFQKRS-IFSYPR------RSSSGYFSFD-SDSL
A0A3Q3ESW6_BCL2L11      PSRCRFKPVSPVDSLGVFQKRS-IFHLPR------RASSGYFSYD-GDSL
A0A3Q2SZH6_BCL2L11      PPRS----IS-PNSLDVFQRRS-IF----------RKSSGYFSFD-CESL
A0A3B3VNE0_BCL2L11      PPCS----VS-PASLDVFRSRS-IFRPPR------RSSSGYFSFD-CDSL
A0A3B3YII5_BCL2L11      PPCS----VS-PASLDVFRSRS-IFRPPR------RSSSGYFSFD-CDSL
A0A3B3YII5_BCL2L11      PPCS----VS-PASLDVFRSRS-IFRPPR------RSSSGYFSFD-CDSL
A0A3P9N073_BCL2L11      PPCT----VS-PASLDVFRSRS-IFRPPR------RSSSGYFSFD-CDSL
A0A3Q3B113_BCL2L11      PACS----SNPPAGLDVFRSRS-IFRFPR------RSSSGYFSFE-GDSL
A0A3B5M375_BCL2L11      PPCS----VS-PASLDVFRSRS-IFRPTR------RSSSGYFSFD-CDSL
A0A3B5QAM1_BCL2L11      PPCS----VS-PASLDVFRSRS-IFRPPR------RSSSGYFSFD-CDSL
A0A3B5QAM1_BCL2L11      PPCS----VS-PASLDVFRSRS-IFRPPR------RSSSGYFSFD-CDSL
M3XHJ5_BCL2L11-01       LMGG----LLLPPSPCPFVTRSPFFIFMRRSLVLSTSSSGYFTFDSDIVH
A0A3G3M2M0_BCL2L11      -------------GIAMSNSHQSRSPMSRTFS---RSSSGYFSVD-SDSV
A0A3Q1ELG4_BCL2L11      -------------SWSR--ASLGVFQTRSIFHLPRRSSSGYFSADGSDSV
A0A3Q1CI15_BCL2L11      -------------SWSRAQASLGVFQTRSIFHLPRRSSSGYFSADGADSV
A0A3Q3SYA1_BCL2L11      ------------------------FHTRSIFQLPRRSSSGYFSSD-GDSL
B2KKY9_BCL2L11-01       EGDP----LRGGISMSNNQSRSPM------NRTFSRSSSGYFSVD-SDSV
B8JK68_BCL2L11-01       EGDP----LRGGISMSNNQSRSPM------NRTFSRSSSGYFSVD-SDSV
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      ------------------------------FSTLSASSSGYHSLD-ISLP
F7CXT2_BCL2L11-01       -----------------------------------------------DRS
F7FTC8_BCL2L11-01       -----------------------------------------------DRS
C1KGB6_BCL2L11-02       -----------------------------------------------DRS
C1KGB6_BCL2L11-03       PQGP----LAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
C1KGB6_BCL2L11-01       PQGP----LAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
J9NWV6_BCL2L11-01       -----------------------------------------------DRS
A0A3Q2GRS5_BCL2L11      -----------------------------------------------DRS
A0A3Q2GRS5_BCL2L11      PLGP----LAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A2R8M6L7_BCL2L11      -----------------------------------------------DRS
G3SU55_BCL2L11-01       PQGP----QAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
G3W979_BCL2L11-01       PQGP----FAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGYFSFD-TDRS
U3IW89_BCL2L11-01       -----------------------------RSPLLSRSSSGYFSFE-AERS
A0A3Q2U844_BCL2L11      --------PASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSFE-AERS
A0A3B4BVX1_BCL2L11      -RGG----ITMPNSLLGYQSRSPLF------RTLSRSSSGYFSFE-SEPS
A0A3P8XIA2_BCL2L11      -------------------------------------SSGYFSFD-CDSI
K7GA86_BCL2L11-01       -----------------------------------------------DRS
O43521_BCL2L11-20       ---------------------------------VSLCHPGWSALV-RSWL
A0A2R8M6L7_BCL2L11      -----------------------------------------------DRS
M3YDI3_BCL2L11-01       -----------------------------------------------DRS
F7CXT2_BCL2L11-02       PQGP----FAPPTSPSPFATRSPLFIFLRRSPLLPRSSSGYFSFD-TDRS
G1SSY0_BCL2L11-01       -----------------------------------------------DRS
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A2K6TRU4_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-TDRS
A0A2K5NU92_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2I2YQ13_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K5X1Y3_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K6QIL2_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K5HZI5_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2I3GVB2_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2R9C366_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2I3SN61_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K5HZI5_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2I2YQ13_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K6QIL2_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K5Q1Y0_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-TDRS
A0A2K6GE31_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A1U7T0R1_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A1U7T0R1_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
O54918_BCL2L11-01       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
O88498_BCL2L11-01       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A2K5Z7V3_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A096NYC3_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K5X1Y3_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K6E212_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K5NU92_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A096NYC3_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2K6KJP8_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2I3SN61_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD-TDRS
A0A2R8M6L7_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-TDRS
A0A2K5CA89_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-TDRS
A0A2K5Q1Y0_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD-TDRS
A0A1U7T0R1_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A1U7T0R1_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A3Q2GRS5_BCL2L11      PLGP----LAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-TDRS
J9NWV6_BCL2L11-04       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
U6CTE3_BCL2L11-02       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A1U8BW10_BCL2L11      PQGP----LAPPASPGPSATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A1U7T0R1_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A2K6GE31_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A287DFJ0_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A452FCR6_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
W5PY58_BCL2L11-01       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
L8IVA4_BCL2L11-02       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A286XJN2_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A286XJN2_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
G1SSY0_BCL2L11-02       PQGP----LAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A250YBV9_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
H0XW23_BCL2L11-01       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A1S3FFM9_BCL2L11      PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
U6CTE3_BCL2L11-01       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
G1LDR8_BCL2L11-01       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
J9NWV6_BCL2L11-03       PQGP----LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD-TDRS
A0A2I2UX96_BCL2L11      PQGP----LAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFD-TDRS
O54918_BCL2L11-03       -----------------------------------------------DRS
A0A1U8BW10_BCL2L11      -----------------------------------------------DRS
J9NWV6_BCL2L11-05       -----------------------------------------------DRS
A0A3Q2GRS5_BCL2L11      -----------------------------------------------DRS
A0A452U4S4_BCL2L11      -----------------------------------------------DRS
A0A2R9C366_BCL2L11      -----------------------------------------------DRS
A0A2I3GVB2_BCL2L11      -----------------------------------------------DRS
A0A2K6TRU4_BCL2L11      -----------------------------------------------DRS
A0A0D9RWE0_BCL2L11      -----------------------------------------------DRS
U6CTE3_BCL2L11-03       -----------------------------------------------DRS
A0A2K6E212_BCL2L11      -----------------------------------------------DRS
H2P5E2_BCL2L11-01       -----------------------------------------------DRS
A0A250YBV9_BCL2L11      -----------------------------------------------DRS
A0A286XJN2_BCL2L11      -----------------------------------------------DRS
A0A2I2UX96_BCL2L11      -----------------------------------------------DRS
A0A1S3FFM9_BCL2L11      -----------------------------------------------DRS
A0A452SBG5_BCL2L11      -----------------------------------------------DRS
A0A3Q1MV27_BCL2L11      -----------------------------------------------DRS
A0A1U8BW10_BCL2L11      -----------------------------------------------DRS
A0A287DFJ0_BCL2L11      -----------------------------------------------DRS
L8IVA4_BCL2L11-01       -----------------------------------------------DRS
A0A3Q1MV27_BCL2L11      -----------------------------------------------DRS
A0A452FCR6_BCL2L11      -----------------------------------------------DRS
A0A2K5CA89_BCL2L11      -----------------------------------------------DRS
A0A2K5Z7V3_BCL2L11      -----------------------------------------------DRS
A0A2K6KJP8_BCL2L11      -----------------------------------------------DRS
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      PSSPLSPKRLTAD--------------KATQTPSPSGQV-----IKHALE
A0A3B1JXK6_BCL2L11      PSSPL----LMHS--------------ASTQTPSPSSQV-----IIHALQ
A0A3B4BVX1_BCL2L11      PSSPL----VTHS--------------ASTQTPSPSSQV-----ITHALQ
A0A3P8XIA2_BCL2L11      PSSPL----LRNN--------------KSTQTPSPSSQV-----ITHAMR
A0A3Q1ICY2_BCL2L11      PSSPLSPRPVTFD--------------RATQTPSPTGQV-----MNHALQ
A0A3Q3K6I5_BCL2L11      PSSPLSPRPVTAD--------------KVTQTPSPSSQV-----MNHALQ
A0A3B4V919_BCL2L11      PSSPLSPRPATVE--------------RTTQTPSPTSQV-----MKHALQ
A0A3B4XZH1_BCL2L11      PTSPLSPRPATAE--------------RTTQTPSPTSQV-----MKHALQ
A0A3Q3ESW6_BCL2L11      PSSPLSPRPLTAD--------------KATQTPSPSGQV-----MQHALQ
A0A3Q2SZH6_BCL2L11      PSTPLSPHPLTAD--------------KATQTASPTGQV-----MNHALQ
A0A3B3VNE0_BCL2L11      PSSPLSPHPVTAD--------------KATQTPSPTGQV-----MNHALQ
A0A3B3YII5_BCL2L11      PSSPLSPHPVTAD--------------KATQTPSPTGQV-----MNHALQ
A0A3B3YII5_BCL2L11      PSSPLSPHPVTAD--------------KATQTPSPTGQV-----MNHALQ
A0A3P9N073_BCL2L11      PSSPLSPHPVTAD--------------KTTQTPSPTGQV-----MNHALQ
A0A3Q3B113_BCL2L11      PSSPLSPKPVTAE--------------KATQTPSPTGQV-----MNHALQ
A0A3B5M375_BCL2L11      PSSPLSPHPVTAD--------------KATQTPSLTGQV-----MNHALQ
A0A3B5QAM1_BCL2L11      PSSPLSPHPVTAD--------------KATQTPSLTGQV-----MNHALQ
A0A3B5QAM1_BCL2L11      PSSPLSPHPVTAD--------------KATQTPSLTGQV-----MNHALQ
M3XHJ5_BCL2L11-01       SPAPVS-----VH--------------KATQTPSPSSQL-----IVHVQH
A0A3G3M2M0_BCL2L11      PGSPLLPNISEAQDDQNDEVWFAEPSHQHVQMAAPVGAMGPEISVARELR
A0A3Q1ELG4_BCL2L11      PSSPLSPKRLTAD--------------KTTQTPSPSGQV-----IRHALE
A0A3Q1CI15_BCL2L11      PSSPLSPKRLTAD--------------KATQTPSPSGQV-----IKHALE
A0A3Q3SYA1_BCL2L11      PSSPLSPRPVTAD--------------KATQTPSLTSQV-----MNHALQ
B2KKY9_BCL2L11-01       PGSPLM-----PN-------------ISEAQDGQNDEVW-----LSEHSH
B8JK68_BCL2L11-01       PGSPLM-----PN-------------ISEAQDGQNDEVW-----LSEHSH
R4G9R5_BCL2L11-01       --FAIS-----CF----------------LYRDVPWRRT-----GRRWCE
A0A3B3QC78_BCL2L11      N-SPFM-----TH-------------NKSTQTPSPSNHL-----VCIYLS
F7CXT2_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
F7FTC8_BCL2L11-01       P-PPVS-----CD--------------KSTQTPSPHCQA-----FNHYLS
C1KGB6_BCL2L11-02       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
C1KGB6_BCL2L11-03       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
C1KGB6_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
J9NWV6_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A3Q2GRS5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A3Q2GRS5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2R8M6L7_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
G3SU55_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----INHYLS
G3W979_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
U3IW89_BCL2L11-01       P-APMS-----CD--------------KATQTPSPPCQA-----VSHYLS
A0A3Q2U844_BCL2L11      P-APMS-----CD--------------KATQTPSPPCQA-----VSHYLS
A0A3B4BVX1_BCL2L11      --SPLL-----TS-------------PSLSVCSTELWPL-----YNHHPP
A0A3P8XIA2_BCL2L11      PSSPLL-----RN-------------NKSTQTPSPSSQV-----ITHAMR
K7GA86_BCL2L11-01       P-VPMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
O43521_BCL2L11-20       T-ATSN-----SQ-------------VQAVLLPQPPK-------------
A0A2R8M6L7_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
M3YDI3_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
F7CXT2_BCL2L11-02       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
G1SSY0_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
J9NWV6_BCL2L11-06       --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6TRU4_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5NU92_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I2YQ13_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5X1Y3_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6QIL2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5HZI5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I3GVB2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2R9C366_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I3SN61_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5HZI5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I2YQ13_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6QIL2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5Q1Y0_BCL2L11      P-APMS-----CD--------------KSTQTPSPTCQA-----FNHYLS
A0A2K6GE31_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U7T0R1_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U7T0R1_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
O54918_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
O88498_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5Z7V3_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A096NYC3_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5X1Y3_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6E212_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5NU92_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A096NYC3_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6KJP8_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I3SN61_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2R8M6L7_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5CA89_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5Q1Y0_BCL2L11      P-APMS-----CD--------------KSTQTPSPTCQA-----FNHYLS
A0A1U7T0R1_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U7T0R1_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A3Q2GRS5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
J9NWV6_BCL2L11-04       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
U6CTE3_BCL2L11-02       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U8BW10_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U7T0R1_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6GE31_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A287DFJ0_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A452FCR6_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
W5PY58_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
L8IVA4_BCL2L11-02       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A286XJN2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A286XJN2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
G1SSY0_BCL2L11-02       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A250YBV9_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
H0XW23_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1S3FFM9_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
U6CTE3_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
G1LDR8_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
J9NWV6_BCL2L11-03       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I2UX96_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
O54918_BCL2L11-03       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U8BW10_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
J9NWV6_BCL2L11-05       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A3Q2GRS5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A452U4S4_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2R9C366_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I3GVB2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6TRU4_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A0D9RWE0_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
U6CTE3_BCL2L11-03       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6E212_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
H2P5E2_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A250YBV9_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A286XJN2_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2I2UX96_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1S3FFM9_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A452SBG5_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A3Q1MV27_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A1U8BW10_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A287DFJ0_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
L8IVA4_BCL2L11-01       P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A3Q1MV27_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A452FCR6_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5CA89_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K5Z7V3_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
A0A2K6KJP8_BCL2L11      P-APMS-----CD--------------KSTQTPSPPCQA-----FNHYLS
                                                                          

Q6JTU4_BCL2L11-01       ---------------------------MRQAEPADMRPEIWIAQE-----
G1MV54_BCL2L11-01       -----------------------ASRWRSHSLAEEIQPEIWIAQE-----
G1PDJ5_BCL2L11-01       ------------------------SMQQSQALPVDMRPEMWIAQE-----
A0A3P8RLE2_BCL2L11      RMTDEAHGGGPG------------------------------TQQ-----
A0A3B1JXK6_BCL2L11      RIS-EARGDAQSFELCPGPNHCPPHRA---AAAGDMQAHWYIAQE-----
A0A3B4BVX1_BCL2L11      RIA-EARGNAQTFELWPLYNHHPPHGA---APAGDMRPESYVAQE-----
A0A3P8XIA2_BCL2L11      RLS-KPQDTWRG--YEAWPTPHHPYRPRPPPIAGDMRPEILIGQE-----
A0A3Q1ICY2_BCL2L11      RLA-EANGSDLRT-HQQHGSDLSSSSTQQQNAAGDMQAVEV-GRE-----
A0A3Q3K6I5_BCL2L11      CMA-EAHGGRPGT-HRQDASSPSPSSARQQNAIRDMQAEAV-GRE-----
A0A3B4V919_BCL2L11      RMA-EAHGGGARMQQQH---------------------------------
A0A3B4XZH1_BCL2L11      RMA-EAHGGGARMQQQQHGEHRH-------FASGDMQAEAV-GQE-----
A0A3Q3ESW6_BCL2L11      RMT-EAHGGGPGT-QQQYGHSPSLTSRRQRTAAGDMQAEAI-GRD-----
A0A3Q2SZH6_BCL2L11      RMA-AEHGGQPARILGLHGHSFSARQG---NAARDMQPERF-GRQ-----
A0A3B3VNE0_BCL2L11      RMA-VEHGG-----LGLHGHSPNHYSTI--NAARDMQSETF-GRQ-----
A0A3B3YII5_BCL2L11      RMA-VEHGG-----LGLHGHSPNHYSTI--NAARDMQSENF-GRQ-----
A0A3B3YII5_BCL2L11      RMA-VEHGG-----LGLHGHSPNHYSTI--NAARDMQSENF-GRQ-----
A0A3P9N073_BCL2L11      RMA-VEHEIPKLN-VKGKEEKGGRGGAFVIIPKRETNQPIL-SC------
A0A3Q3B113_BCL2L11      RMA-VEQGGGPGT-HRLHGSSPNPSGTQARNAAGDMEAESF-GRH-----
A0A3B5M375_BCL2L11      RMA-VEHGG-----LGLQGEQT---SVL--PPPPSETSTTW-EQ------
A0A3B5QAM1_BCL2L11      RMA-VEHGG-----LGLHGQSPNHYSTI--NAARDMQSETY-GRQ-----
A0A3B5QAM1_BCL2L11      RMA-VEHGG-----LGLHGQSPNHYSTI--NAARDMQSETY-GRQ-----
M3XHJ5_BCL2L11-01       CL----------------------AQREQHPETHGKNPLNFT--------
A0A3G3M2M0_BCL2L11      RIG----------------DEFNRLYCQGAGAGGNNRAQL---HAPNEHA
A0A3Q1ELG4_BCL2L11      RMA----------------GEAHR---GGPETQRQQHGELNDCRSCGQRK
A0A3Q1CI15_BCL2L11      RMT----------------DEAHG---GGPGT--QQHGEL---RLTYTRE
A0A3Q3SYA1_BCL2L11      RL---------------------AEAHGGGAG------------------
B2KKY9_BCL2L11-01       QH------------------------LQMAAPVAALPPEMVVARE-----
B8JK68_BCL2L11-01       QH------------------------LQMAAPVAALPPEMVVARE-----
R4G9R5_BCL2L11-01       AE---------------------TSRWQSRPIPEDMQPEIWIAQE-----
A0A3B3QC78_BCL2L11      SV------------------------TRTLSMLPDMRPEMLVARE-----
F7CXT2_BCL2L11-01       AM---------------------ASMRQSQSIPADMRPEIWIAQE-----
F7FTC8_BCL2L11-01       AM---------------------ASIRQPQSVPEDMRPEIWIAQE-----
C1KGB6_BCL2L11-02       AM---------------------ASMRQSQAEPADMRPEIWIAQE-----
C1KGB6_BCL2L11-03       AM---------------------ASMRQSQAEPADMRPEIWIAQE-----
C1KGB6_BCL2L11-01       AM---------------------ASMRQSQAEPADMRPEIWIAQE-----
J9NWV6_BCL2L11-01       AM---------------------ASMRQSQAVPADMRPEIWIAQE-----
A0A3Q2GRS5_BCL2L11      AM---------------------ASMRQSQAVPADMRPEVWIAQE-----
A0A3Q2GRS5_BCL2L11      AM---------------------ASMRQSQAVPADMRPEVWIAQE-----
A0A2R8M6L7_BCL2L11      AM---------------------ASMRQSQAEPAGMRPEIWIAQE-----
G3SU55_BCL2L11-01       AM---------------------ASMRQSQALPADLRPEIWIARE-----
G3W979_BCL2L11-01       AM-------------------DTASMRQSQSIPADMRPEIWIAQE-----
U3IW89_BCL2L11-01       AM---------------------ASRWRSHSLAEEIQPEIWIAQE-----
A0A3Q2U844_BCL2L11      AM---------------------ASRWRSHSLAEEIQPEIWIAQE-----
A0A3B4BVX1_BCL2L11      HG---------------------------AAPAGDMRPESYVAQE-----
A0A3P8XIA2_BCL2L11      --------------------------------PGDMRPEILIGQE-----
K7GA86_BCL2L11-01       AMG----------------KQDHASRWESPSIREDMQPEIWIAQE-----
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      AM---------------------ASMRQSQAEPAGMRPEIWIAQE-----
M3YDI3_BCL2L11-01       AM---------------------ASRRQSQAVPADMRPEMWIAQE-----
F7CXT2_BCL2L11-02       AMG----------------KQDHASMRQSQSIPADMRPEIWIAQE-----
G1SSY0_BCL2L11-01       AM---------------------GKQSLGKTKPAYGCLHSCVCGVHVTCI
J9NWV6_BCL2L11-06       -----------------------ASMRQSQAVPADMRPEIWIAQE-----
C1KGB8_BCL2L11-01       -----------------------ASMRQSQAEPADMRPEIWIAQE-----
A0A3Q2GRS5_BCL2L11      -----------------------ASMRQSQAVPADMRPEVWIAQE-----
U6CTE3_BCL2L11-04       -----------------------ASRRQSQAVPADMRPEMWIAQE-----
A0A1U7T0R1_BCL2L11      -----------------------ESMRQSQAEPPDMRPEIWIAQE-----
J9NWV6_BCL2L11-02       AM--------------------------GLFE------------------
A0A2K6TRU4_BCL2L11      AM--------------------------ADWD------------------
A0A2K5NU92_BCL2L11      AM--------------------------GIFE------------------
A0A2I2YQ13_BCL2L11      AM--------------------------GIFE------------------
A0A2K5X1Y3_BCL2L11      AM--------------------------GIFE------------------
A0A2K6QIL2_BCL2L11      AM--------------------------GIFE------------------
A0A2K5HZI5_BCL2L11      AM--------------------------ANWD------------------
A0A2I3GVB2_BCL2L11      AM--------------------------ANWD------------------
A0A2R9C366_BCL2L11      AM--------------------------ANWD------------------
A0A2I3SN61_BCL2L11      AM--------------------------ANWD------------------
A0A2K5HZI5_BCL2L11      AM--------------------------GVFE------------------
A0A2I2YQ13_BCL2L11      AM---------------------VREIEEVVV------------------
A0A2K6QIL2_BCL2L11      AM---------------------VREIEEVVV------------------
A0A2K5Q1Y0_BCL2L11      AM---------------------VREIEEVVV------------------
A0A2K6GE31_BCL2L11      AM---------------------VREIEEVVV------------------
A0A1U7T0R1_BCL2L11      AM--------------------------GLFE------------------
A0A1U7T0R1_BCL2L11      AM---------------------VREIEEVVV------------------
O54918_BCL2L11-01       AM---------------------ASIRQSQEEPEDLRPEIRIAQE-----
O88498_BCL2L11-01       AM---------------------ASIRQSQEEPEDLRPEIRIAQE-----
A0A2K5Z7V3_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A096NYC3_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A2K5X1Y3_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A2K6E212_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A2K5NU92_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A096NYC3_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A2K6KJP8_BCL2L11      AM---------------------ASRR--QAEPADMRPEIRIAQE-----
A0A2I3SN61_BCL2L11      AM---------------------ASMR--QAEPADMRPEIWIAQE-----
A0A2R8M6L7_BCL2L11      AM---------------------ASMRQSQAEPAGMRPEIWIAQE-----
A0A2K5CA89_BCL2L11      AM---------------------ASMRQSQAEPAGMRPEIWIAQE-----
A0A2K5Q1Y0_BCL2L11      AM---------------------ASMRQSQAEPAGMRPEIWIAQE-----
A0A1U7T0R1_BCL2L11      AM---------------------ESMRQSQAEPPDMRPEIWIAQE-----
A0A1U7T0R1_BCL2L11      AM---------------------ESMRQSQAEPPDMRPEIWIAQE-----
A0A3Q2GRS5_BCL2L11      AM---------------------ASMRQSQAVPADMRPEVWIAQE-----
J9NWV6_BCL2L11-04       AM---------------------ASMRQSQAVPADMRPEIWIAQE-----
U6CTE3_BCL2L11-02       AM---------------------ASRRQSQAVPADMRPEMWIAQE-----
A0A1U8BW10_BCL2L11      AM---------------------ASIRQSQEEPADIRPEIWIAQE-----
A0A1U7T0R1_BCL2L11      AM---------------------ESMRQSQAEPPDMRPEIWIAQE-----
A0A2K6GE31_BCL2L11      AM---------------------ASMRQFQAEPADMRPEIWIAQE-----
A0A287DFJ0_BCL2L11      AM---------------------ASMRESQAEPADMRPEIWIAQE-----
A0A452FCR6_BCL2L11      AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
W5PY58_BCL2L11-01       AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
L8IVA4_BCL2L11-02       AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
A0A286XJN2_BCL2L11      AM---------------------ASMRQSQAGPPHLRPEIWIAQE-----
A0A286XJN2_BCL2L11      AM---------------------ASMRQSQAGPPHLRPEIWIAQE-----
G1SSY0_BCL2L11-02       AM---------------------ASMRQSQAEPADTRPETWIAQE-----
A0A250YBV9_BCL2L11      AM---------------------ASMRQSQVEPMDMRPEIWIAQE-----
H0XW23_BCL2L11-01       AM---------------------ASMRQSQAEPADLRPEMWIAQE-----
A0A1S3FFM9_BCL2L11      AM---------------------ASMRQSQEEPADLRPEIWIAQE-----
U6CTE3_BCL2L11-01       AM---------------------ASRRQSQAVPADMRPEMWIAQE-----
G1LDR8_BCL2L11-01       AM---------------------ASMRQSQAVPADMRPEIWIAQE-----
J9NWV6_BCL2L11-03       AM---------------------ASMRQSQAVPADMRPEIWIAQE-----
A0A2I2UX96_BCL2L11      AM---------------------ASMRQPQAVPADMRPEIWIAQE-----
O54918_BCL2L11-03       AM---------------------DQLENLNQ-------VAQNIHG-----
A0A1U8BW10_BCL2L11      AM---------------------D-LCENLK-------HEWQIHG-----
J9NWV6_BCL2L11-05       AM--------------------------VRA-------IEEGVV------
A0A3Q2GRS5_BCL2L11      AM--------------------------VRA-------IEEVVV------
A0A452U4S4_BCL2L11      AM---------------------D-LWTVER-------HLETAL------
A0A2R9C366_BCL2L11      AM---------------------DDSAGSSLRIALHREVQWPLKW-----
A0A2I3GVB2_BCL2L11      AM---------------------DEAAGSSL------EVQWPFEW-----
A0A2K6TRU4_BCL2L11      AM---------------------DEATGSSL--ALRREVQCPLEW-----
A0A0D9RWE0_BCL2L11      AM---------------------ASRRQAE--PADMRPEIRIAQE-----
U6CTE3_BCL2L11-03       AM---------------------ASRRQSQAVPADMRPEMWIAQE-----
A0A2K6E212_BCL2L11      AM---------------------ASRRQAE--PADMRPEIRIAQE-----
H2P5E2_BCL2L11-01       AM---------------------ASMRQAE--PADMRPEIWIAQE-----
A0A250YBV9_BCL2L11      AM---------------------ASMRQSQVEPMDMRPEIWIAQE-----
A0A286XJN2_BCL2L11      AM---------------------ASMRQSQAGPPHLRPEIWIAQE-----
A0A2I2UX96_BCL2L11      AM---------------------ASMRQPQAVPADMRPEIWIAQE-----
A0A1S3FFM9_BCL2L11      AM---------------------ASMRQSQEEPADLRPEIWIAQE-----
A0A452SBG5_BCL2L11      AM---------------------ASMRQSQDVPADMRPEIWIAQE-----
A0A3Q1MV27_BCL2L11      AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
A0A1U8BW10_BCL2L11      AM---------------------ASIRQSQEEPADIRPEIWIAQE-----
A0A287DFJ0_BCL2L11      AM---------------------ASMRESQAEPADMRPEIWIAQE-----
L8IVA4_BCL2L11-01       AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
A0A3Q1MV27_BCL2L11      AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
A0A452FCR6_BCL2L11      AM---------------------ASMRQSQAVPADTRPEIWIAQE-----
A0A2K5CA89_BCL2L11      AM----------------------------GDISLWFRFIFTFFD-----
A0A2K5Z7V3_BCL2L11      AM---------------------VVILEDIGDSSL-FGFIFTGLD-----
A0A2K6KJP8_BCL2L11      AM---------------------VVILEDIGDTSLWFGFIFTGLD-----
                                                                          

Q6JTU4_BCL2L11-01       ---LRRIGDEFNAYYARRLEK-----------------------------
G1MV54_BCL2L11-01       ---LRRIGDEFNASY-CPRRGFLDNH---AG---NPQ-------------
G1PDJ5_BCL2L11-01       ---LRRIGDEFNNSYRNPRRDFLNVYREAEG---HPQ-------------
A0A3P8RLE2_BCL2L11      ---HGELRLTYTREISCTFNLCNSFCTLFSVTVFCHLQS-----------
A0A3B1JXK6_BCL2L11      ---LRRIGDEFNDLYFRGAGR-NGGGAQLP------AQNEPAFI------
A0A3B4BVX1_BCL2L11      ---LRRIGDEFNELYFHGVSQLHGCVAGMQ------ALSNPVAF------
A0A3P8XIA2_BCL2L11      ---LQRIGDEFNNLFIHGRLGARNGQ--VAQANLPQMHQEPAFL------
A0A3Q1ICY2_BCL2L11      ---LRRIGDDFNNHLL--EVAGRHRWVGIQPIRLPHIHQDPTVL------
A0A3Q3K6I5_BCL2L11      ---LRRIGDDYNNHLL--ELADRRRRV------VPRIHQELTIV------
A0A3B4V919_BCL2L11      --------GELKPALLKHTKMTSQCCQTH---------------------
A0A3B4XZH1_BCL2L11      ---LRRIGDDFNRLLLLRVSHHRWCVCVC---------------------
A0A3Q3ESW6_BCL2L11      ---LQRIGDDYNRLLLW-RMAGRHGRPEVHPNPQPHIQPEPTML------
A0A3Q2SZH6_BCL2L11      ---LRAIGDEYNNHLM--RMAGRQQRDMVPLNLMPHIQQEPVAM------
A0A3B3VNE0_BCL2L11      ---LRAIGDDYNNHLMVRRMARRHQRNIVPLNLMPHIQQEPVAM------
A0A3B3YII5_BCL2L11      ---LRAIGDDYNNHLM--RMARRHQRNIVPLNLMPHIQQEPVAM------
A0A3B3YII5_BCL2L11      ---LRAIGDDYNNHLM--RMARRHQRNIVPLNLMPHIQQEPVAM------
A0A3P9N073_BCL2L11      ---------------------------VLPVQLMIQQFSHATSIGIKKRK
A0A3Q3B113_BCL2L11      ---LRTIGDEYNRLLLLRRMAGRPRRNIVPLNLLPHIHQEPVAM------
A0A3B5M375_BCL2L11      ----------------------------IAVNIGPVLFIRPIPM------
A0A3B5QAM1_BCL2L11      ---LRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAM------
A0A3B5QAM1_BCL2L11      ---LRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAM------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      IIMWMN----------------------DLIGRVVQF-------------
A0A3Q1ELG4_BCL2L11      TSLTFS-----AVVFALAIVC---PCLLSFLFTVCFR-------------
A0A3Q1CI15_BCL2L11      ISCTFNLCNSFCTLFSVTVFCHLQSLFASTLQNVLIR-------------
A0A3Q3SYA1_BCL2L11      ---AHRQHGEHKHLRSRLFTAHAEYTQVKQP-------------------
B2KKY9_BCL2L11-01       ---LRRIGDEFNRLYCEAGAGVNQLRAPNEH---AIV-------------
B8JK68_BCL2L11-01       ---LRRIGDEFNRLYCEAGAGVNQLHAPNEH---AIV-------------
R4G9R5_BCL2L11-01       ---LRRIGDEFNASHCPRRGFLDYQAV-------NHQ-------------
A0A3B3QC78_BCL2L11      ---LRRIGDKFNDIYINGVSILLCPHCPLRPTAMGQG-------------
F7CXT2_BCL2L11-01       ---LRRIGDEFNASYYPRRAVWHCFKSFG---------------------
F7FTC8_BCL2L11-01       ---LRRIGDEFNASYCPRRGLLDNNNPAGNN----HQ-------------
C1KGB6_BCL2L11-02       ---LRRIGDEFNAYY-PRRVML-FSLPPFSP---HTL-------------
C1KGB6_BCL2L11-03       ---LRRIGDEFNAYY-PRRLEQ----------------------------
C1KGB6_BCL2L11-01       ---LRRIGDEFNAYY-PRRVFL-NNYQAAEA---HPQ-------------
J9NWV6_BCL2L11-01       ---LRRIGDEFNAYY-PRRVFL-NNYQAAEA---HPQ-------------
A0A3Q2GRS5_BCL2L11      ---LRRIGDEFNASY-PRRVVL-NHHQAAEA---HPQ-------------
A0A3Q2GRS5_BCL2L11      ---LRRIGDEFNASY-PRRVVL-NHHQAAEA---HPQ-------------
A0A2R8M6L7_BCL2L11      ---LRRIGDEFNAYY-PRRVFL-NNYQAAED---HPH-------------
G3SU55_BCL2L11-01       ---LRRIGDEFNAYY-PRRAFL-NNYQAAED---HPQ-------------
G3W979_BCL2L11-01       ---LRRIGDEFNASY-PRRGFLDNNYQAADD---HHQ-------------
U3IW89_BCL2L11-01       ---LRRIGDEFNASYCPRR-------------------------------
A0A3Q2U844_BCL2L11      ---LRRIGDEFNASYCPRRGFL----DNRAG---NPQ-------------
A0A3B4BVX1_BCL2L11      ---LRRIGDEFNELYFHGVSQLHGCVAGMQALSARDL-------------
A0A3P8XIA2_BCL2L11      ---LQRIGDEFNNLFIHGV----------SGCSKMPV-------------
K7GA86_BCL2L11-01       ---LRRIGDEFNASYCPRRGFLDNQA--------INH-------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQAAED---HPH-------------
M3YDI3_BCL2L11-01       ---LRRIGDEFNAYYPRRV--FLNNYPAAEA---HPQ-------------
F7CXT2_BCL2L11-02       ---LRRIGDEFNASYYPRRGFLDNNYQGAGD---HHQ-------------
G1SSY0_BCL2L11-01       LLFLKGRGFPSAGCFPRCPPRPGLDWARPKPGAWNLA-------------
J9NWV6_BCL2L11-06       ---LRRIGDEFNAYYPRRV--MMFYLLLLLTPSPSPQ-------------
C1KGB8_BCL2L11-01       ---LRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI-------------
A0A3Q2GRS5_BCL2L11      ---LRRIGDEFNASYPRRLAQ----CLAFYT-------------------
U6CTE3_BCL2L11-04       ---LRRIGDEFNAYYPRRLARIPASCLC----------------------
A0A1U7T0R1_BCL2L11      ---LRRIGDEFNAYYPRRLAK----NLASSS-------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       ---LRRIGDEFNETYTRRV--FANDYREAED---HPQ-------------
O88498_BCL2L11-01       ---LRRIGDEFNETYTRRA--FANDYREAED---HPQ-------------
A0A2K5Z7V3_BCL2L11      ---LRRIGDEFNAYYARRV--FLNNYQAAED---HPQ-------------
A0A096NYC3_BCL2L11      ---LRRIGDEFNAYYARRV--FLNNYQAAED---HPQ-------------
A0A2K5X1Y3_BCL2L11      ---LRRIGDEFNAYYARRM--SLPPD------------------------
A0A2K6E212_BCL2L11      ---LRRIGDEFNAYYARRM--SLPPD------------------------
A0A2K5NU92_BCL2L11      ---LRRIGDEFNAYYARRL--EK---------------------------
A0A096NYC3_BCL2L11      ---LRRIGDEFNAYYARRL--EK---------------------------
A0A2K6KJP8_BCL2L11      ---LRRIGDEFNAYYARRL--EK---------------------------
A0A2I3SN61_BCL2L11      ---LRRIGDEFNAYYARRL--EK---------------------------
A0A2R8M6L7_BCL2L11      ---LRRIGDEFNAYYPRRL--EK---------------------------
A0A2K5CA89_BCL2L11      ---LRRIGDEFNAYYPRRI--SLPSD------------------------
A0A2K5Q1Y0_BCL2L11      ---LRRIGDEFNAYYPRRI--SLPSD------------------------
A0A1U7T0R1_BCL2L11      ---LRRIGDEFNAYYPRRM--PFPPD------------------------
A0A1U7T0R1_BCL2L11      ---LRRIGDEFNAYYPRRL--EK---------------------------
A0A3Q2GRS5_BCL2L11      ---LRRIGDEFNASYPRRL--EQ---------------------------
J9NWV6_BCL2L11-04       ---LRRIGDEFNAYYPRRL--EQ---------------------------
U6CTE3_BCL2L11-02       ---LRRIGDEFNAYYPRRL--EQ---------------------------
A0A1U8BW10_BCL2L11      ---LRRIGDEFNESYRRRV----NNYQEDEDHPHHPQ-------------
A0A1U7T0R1_BCL2L11      ---LRRIGDEFNAYYPRRA--YLNNNQAAED---HPQ-------------
A0A2K6GE31_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQADED---HPQ-------------
A0A287DFJ0_BCL2L11      ---LRRIGDEFNLYYPRRV--FFNNYQP-ED---RPQ-------------
A0A452FCR6_BCL2L11      ---LRRIGDEFNAYYPRRV--FV-RHQAIEG---HPQ-------------
W5PY58_BCL2L11-01       ---LRRIGDEFNAYYPRRV--FV-RHQAIEG---HPQ-------------
L8IVA4_BCL2L11-02       ---LRRIGDEFNAYYPRRV--FV-RHQAVEG---HPQ-------------
A0A286XJN2_BCL2L11      ---LRRIGDEFNASYPRRV--FLNHYQPAED---QPQ-------------
A0A286XJN2_BCL2L11      ---LRRIGDEFNASYPRRV--FLNHYQPAED---QPQ-------------
G1SSY0_BCL2L11-02       ---LRRIGDEFNAYYPRRV--FLNNYPAAEE---QPQ-------------
A0A250YBV9_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQGVED---HPQ-------------
H0XW23_BCL2L11-01       ---LRRIGDEFNAYYPTRV--FLHNYQAAED---HPQ-------------
A0A1S3FFM9_BCL2L11      ---LRRIGDEFDAYYPRRV--FLNNYQAAED---QPQ-------------
U6CTE3_BCL2L11-01       ---LRRIGDEFNAYYPRRV--FLNNYPAAEA---HPQ-------------
G1LDR8_BCL2L11-01       ---LRRIGDEFNAYYPRRV--FLNNYQAAEA---HPQ-------------
J9NWV6_BCL2L11-03       ---LRRIGDEFNAYYPRRV--FLNNYQAAEA---HPQ-------------
A0A2I2UX96_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQAAEA---QPQ-------------
O54918_BCL2L11-03       ---DAWYN------------------------------------------
A0A1U8BW10_BCL2L11      ---DQSKS------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      ---LAKSS------------------------------------------
A0A2I3GVB2_BCL2L11      ---LAKSS------------------------------------------
A0A2K6TRU4_BCL2L11      ---LAKSS------------------------------------------
A0A0D9RWE0_BCL2L11      ---LRRIGDEFNAYYARRL-------------------------------
U6CTE3_BCL2L11-03       ---LRRIGDEFNAYYPRRL-------------------------------
A0A2K6E212_BCL2L11      ---LRRIGDEFNAYYARRV--FLNNYQAAED---HPQ-------------
H2P5E2_BCL2L11-01       ---LRRIGDEFNAYYARRV--FLNNYQAAED---HPR-------------
A0A250YBV9_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQGVED---HPQ-------------
A0A286XJN2_BCL2L11      ---LRRIGDEFNASYPRRV--FLNHYQPAED---QPQ-------------
A0A2I2UX96_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQAAEA---QPQ-------------
A0A1S3FFM9_BCL2L11      ---LRRIGDEFDAYYPRRV--FLNNYQAAED---QPQ-------------
A0A452SBG5_BCL2L11      ---LRRIGDEFNAYYPRRV--FLNNYQAAEA---HPQ-------------
A0A3Q1MV27_BCL2L11      ---LRRIGDEFNAYYPRRV--FVRH-QAVEG---HPQ-------------
A0A1U8BW10_BCL2L11      ---LRRIGDEFNESYRRRVNNYQED-EDHPH---HPQ-------------
A0A287DFJ0_BCL2L11      ---LRRIGDEFNLYYPRRV--FFNN-YQPED---RPQ-------------
L8IVA4_BCL2L11-01       ---LRRIGDEFNAYYPRRV--FVRH-QAVEG---HPQ-------------
A0A3Q1MV27_BCL2L11      ---LRRIGDEFNAYYPRRV--FVRH-QAVEG---HPQ-------------
A0A452FCR6_BCL2L11      ---LRRIGDEFNAYYPRRV--FVRH-QAIEG---HPQ-------------
A0A2K5CA89_BCL2L11      ---LYG-------------------HHHSQG---TEQ-------------
A0A2K5Z7V3_BCL2L11      ---LYG-------------------HHHSQD---TEQ-------------
A0A2K6KJP8_BCL2L11      ---LYVV--------------WIYIYHHSQD---TEQ-------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       -----------VVILRLLHYIIRLIWRMQ---------------------
G1PDJ5_BCL2L11-01       -----------MVVLRLLRYILRLVWRRM---------------------
A0A3P8RLE2_BCL2L11      -----------LFASTLQNVLIRFINPNYFSTFWKRC-------------
A0A3B1JXK6_BCL2L11      -----------LWMGLLIERLRQFLHRRR---------------------
A0A3B4BVX1_BCL2L11      -----------SILGLF---------RGH---------------------
A0A3P8XIA2_BCL2L11      -----------LWMGLLIGRLLQIIWRRR---------------------
A0A3Q1ICY2_BCL2L11      -----------LCVGLLLFVIGRIIYSQGSTNSEGHSHV-----------
A0A3Q3K6I5_BCL2L11      -----------LCVGILVLVIGQIIL-QGSINSQDNSQV-----------
A0A3B4V919_BCL2L11      -----------FC-------------------------------------
A0A3B4XZH1_BCL2L11      -----------VCVCACGCVCACGCVCGCVRVCGGGGGVE----------
A0A3Q3ESW6_BCL2L11      -----------LCTGLMILLIGWIIYLRGNTNSHDHSQV-----------
A0A3Q2SZH6_BCL2L11      -----------LCVGLLLLLIGRIMYLQGSTNSHDHSQV-----------
A0A3B3VNE0_BCL2L11      -----------LCVCLLLLLVGRIMYMQGNTSSHDHSQV-----------
A0A3B3YII5_BCL2L11      -----------LCVCLLLLLVGRIMYMQGNTSSHDHSQV-----------
A0A3B3YII5_BCL2L11      -----------LCVCLLLLLVGRIMYMQGNTSSHDHSQV-----------
A0A3P9N073_BCL2L11      RVGYDDDYYHYYIDCFFLKSVSKYDVA-----------------------
A0A3Q3B113_BCL2L11      -----------LCVSLLLLLIGRLMYLQGCTNSQNNSQV-----------
A0A3B5M375_BCL2L11      -----------L-VPIYHASTLRISALE----------------------
A0A3B5QAM1_BCL2L11      -----------LCVCLLLLLVGRIMYMQGNTSSHDHSQV-----------
A0A3B5QAM1_BCL2L11      -----------LCVCLLLLLVGRIMYMQGNTSSHDHSQV-----------
M3XHJ5_BCL2L11-01       --------------------------------------------------
A0A3G3M2M0_BCL2L11      -----------FLRRR----------------------------------
A0A3Q1ELG4_BCL2L11      -----------FCNKRVK--------------------------------
A0A3Q1CI15_BCL2L11      -----------FINPNYFSTFWNRC-------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       -----------LWMNVIIGRLVHFFLRRR---------------------
B8JK68_BCL2L11-01       -----------LWMNDIIGRLVHFFLRRR---------------------
R4G9R5_BCL2L11-01       -----------IIILRLLHYIVRFIWRMQ---------------------
A0A3B3QC78_BCL2L11      -----------ATLTPYPGDNKNKESPLRSRSSWLHVRMGEVEQQEIV--
F7CXT2_BCL2L11-01       -----------IGVGSQL--------------------------------
F7FTC8_BCL2L11-01       -----------MGFVHLLRYIIRRVWRLQ---------------------
C1KGB6_BCL2L11-02       -----------PPPYI----------------------------------
C1KGB6_BCL2L11-03       --------------------------------------------------
C1KGB6_BCL2L11-01       -----------MVILRLLRYIARLVWRMQ---------------------
J9NWV6_BCL2L11-01       -----------MIILRLLRYIVRLVWRLQ---------------------
A0A3Q2GRS5_BCL2L11      -----------MIILRLLRYIIRLVRRLQ---------------------
A0A3Q2GRS5_BCL2L11      -----------MIILRLLRYIIRLVRRLQ---------------------
A0A2R8M6L7_BCL2L11      -----------MVILRLLRYIVRLVWRMH---------------------
G3SU55_BCL2L11-01       -----------MVILRLLRYIVRLVWR-----------------------
G3W979_BCL2L11-01       -----------MVILRLLHYIIRLVWRMQ---------------------
U3IW89_BCL2L11-01       -----------VIFLFLLSISLHLVPRLPPPFPRPGSVAGGVCLVGAVQL
A0A3Q2U844_BCL2L11      -----------VVILRLLHYIIRLIWRMQ---------------------
A0A3B4BVX1_BCL2L11      -----------HDQMFALS-------------------------------
A0A3P8XIA2_BCL2L11      -----------LHHLIYKPYQGPHCIKLS---------------------
K7GA86_BCL2L11-01       -----------QIVLRLLHYIIRLIWRMQ---------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2R8M6L7_BCL2L11      -----------MVILRLLRYIVRLVWRMH---------------------
M3YDI3_BCL2L11-01       -----------MIILRLLRYIIRLVWRLQ---------------------
F7CXT2_BCL2L11-02       -----------MVILRLLRYIIRLVWRMQ---------------------
G1SSY0_BCL2L11-01       -----------LSLPPGWQGPS----------------------------
J9NWV6_BCL2L11-06       -----------FFFFKVTSKNSILILEMQGITYM----------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-02       --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2K5HZI5_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       -----------MVILQLLRFIFRLVWRRH---------------------
O88498_BCL2L11-01       -----------MVILQLLRFIFRLVWRRH---------------------
A0A2K5Z7V3_BCL2L11      -----------MVILRLLRYIVRLVWRMH---------------------
A0A096NYC3_BCL2L11      -----------MVILRLLRYIVRLVWRMH---------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I3SN61_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5CA89_BCL2L11      --------------------------------------------------
A0A2K5Q1Y0_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-04       --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A1U8BW10_BCL2L11      -----------MVILQLLRFIVRLVWRRH---------------------
A0A1U7T0R1_BCL2L11      -----------MVLLRLLRYIVRLVWRMY---------------------
A0A2K6GE31_BCL2L11      -----------MLILRLLRYIVRLVWRRH---------------------
A0A287DFJ0_BCL2L11      -----------MVILRLLRCIIRLVWRMH---------------------
A0A452FCR6_BCL2L11      -----------MVLLRVLRYLVRLVWRMQ---------------------
W5PY58_BCL2L11-01       -----------MVLLRVLRYLVRLVWRMQ---------------------
L8IVA4_BCL2L11-02       -----------MVLLRVLRYIVRLVWRMQ---------------------
A0A286XJN2_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
A0A286XJN2_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
G1SSY0_BCL2L11-02       -----------MVILRLLRYIVRLVWRMH---------------------
A0A250YBV9_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
H0XW23_BCL2L11-01       -----------MVILRLLRYIVRLVWRLH---------------------
A0A1S3FFM9_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
U6CTE3_BCL2L11-01       -----------MIILRLLRYIIRLVWRLQ---------------------
G1LDR8_BCL2L11-01       -----------MIILRLLRYIVRLVWRLQ---------------------
J9NWV6_BCL2L11-03       -----------MIILRLLRYIVRLVWRLQ---------------------
A0A2I2UX96_BCL2L11      -----------MIILRLLRYIVRLVWRLQ---------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
J9NWV6_BCL2L11-05       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A2R9C366_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2K6TRU4_BCL2L11      --------------------------------------------------
A0A0D9RWE0_BCL2L11      ---------------------------EK---------------------
U6CTE3_BCL2L11-03       ---------------------------EQ---------------------
A0A2K6E212_BCL2L11      -----------MVILRLLRYIVRLVWRMH---------------------
H2P5E2_BCL2L11-01       -----------MVILRLLRYIVRLVWRMH---------------------
A0A250YBV9_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
A0A286XJN2_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
A0A2I2UX96_BCL2L11      -----------MIILRLLRYIVRLVWRLQ---------------------
A0A1S3FFM9_BCL2L11      -----------MVILRLLRYIIRLVWRMH---------------------
A0A452SBG5_BCL2L11      -----------MIILRLLRYIIRLVWRLQ---------------------
A0A3Q1MV27_BCL2L11      -----------MVLLRVLRYIVRLVWRMQ---------------------
A0A1U8BW10_BCL2L11      -----------MVILQLLRFIVRLVWRRH---------------------
A0A287DFJ0_BCL2L11      -----------MVILRLLRCIIRLVWRMH---------------------
L8IVA4_BCL2L11-01       -----------MVLLRVLRYIVRLVWRMQ---------------------
A0A3Q1MV27_BCL2L11      -----------MVLLRVLRYIVRLVWRMQ---------------------
A0A452FCR6_BCL2L11      -----------MVLLRVLRYLVRLVWRMQ---------------------
A0A2K5CA89_BCL2L11      -----------LHHKYFS--------------------------------
A0A2K5Z7V3_BCL2L11      -----------LNHKDFS--------------------------------
A0A2K6KJP8_BCL2L11      -----------LNHRDFS--------------------------------
                                                                          

Q6JTU4_BCL2L11-01       ------------
G1MV54_BCL2L11-01       ------------
G1PDJ5_BCL2L11-01       ------------
A0A3P8RLE2_BCL2L11      ------------
A0A3B1JXK6_BCL2L11      ------------
A0A3B4BVX1_BCL2L11      ------------
A0A3P8XIA2_BCL2L11      ------------
A0A3Q1ICY2_BCL2L11      ------------
A0A3Q3K6I5_BCL2L11      ------------
A0A3B4V919_BCL2L11      ------------
A0A3B4XZH1_BCL2L11      ------------
A0A3Q3ESW6_BCL2L11      ------------
A0A3Q2SZH6_BCL2L11      ------------
A0A3B3VNE0_BCL2L11      ------------
A0A3B3YII5_BCL2L11      ------------
A0A3B3YII5_BCL2L11      ------------
A0A3P9N073_BCL2L11      ------------
A0A3Q3B113_BCL2L11      ------------
A0A3B5M375_BCL2L11      ------------
A0A3B5QAM1_BCL2L11      ------------
A0A3B5QAM1_BCL2L11      ------------
M3XHJ5_BCL2L11-01       ------------
A0A3G3M2M0_BCL2L11      ------------
A0A3Q1ELG4_BCL2L11      ------------
A0A3Q1CI15_BCL2L11      ------------
A0A3Q3SYA1_BCL2L11      ------------
B2KKY9_BCL2L11-01       ------------
B8JK68_BCL2L11-01       ------------
R4G9R5_BCL2L11-01       ------------
A0A3B3QC78_BCL2L11      ------------
F7CXT2_BCL2L11-01       ------------
F7FTC8_BCL2L11-01       ------------
C1KGB6_BCL2L11-02       ------------
C1KGB6_BCL2L11-03       ------------
C1KGB6_BCL2L11-01       ------------
J9NWV6_BCL2L11-01       ------------
A0A3Q2GRS5_BCL2L11      ------------
A0A3Q2GRS5_BCL2L11      ------------
A0A2R8M6L7_BCL2L11      ------------
G3SU55_BCL2L11-01       ------------
G3W979_BCL2L11-01       ------------
U3IW89_BCL2L11-01       GIKVTFFTLFSF
A0A3Q2U844_BCL2L11      ------------
A0A3B4BVX1_BCL2L11      ------------
A0A3P8XIA2_BCL2L11      ------------
K7GA86_BCL2L11-01       ------------
O43521_BCL2L11-20       ------------
A0A2R8M6L7_BCL2L11      ------------
M3YDI3_BCL2L11-01       ------------
F7CXT2_BCL2L11-02       ------------
G1SSY0_BCL2L11-01       ------------
J9NWV6_BCL2L11-06       ------------
C1KGB8_BCL2L11-01       ------------
A0A3Q2GRS5_BCL2L11      ------------
U6CTE3_BCL2L11-04       ------------
A0A1U7T0R1_BCL2L11      ------------
J9NWV6_BCL2L11-02       ------------
A0A2K6TRU4_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
A0A2I2YQ13_BCL2L11      ------------
A0A2K5X1Y3_BCL2L11      ------------
A0A2K6QIL2_BCL2L11      ------------
A0A2K5HZI5_BCL2L11      ------------
A0A2I3GVB2_BCL2L11      ------------
A0A2R9C366_BCL2L11      ------------
A0A2I3SN61_BCL2L11      ------------
A0A2K5HZI5_BCL2L11      ------------
A0A2I2YQ13_BCL2L11      ------------
A0A2K6QIL2_BCL2L11      ------------
A0A2K5Q1Y0_BCL2L11      ------------
A0A2K6GE31_BCL2L11      ------------
A0A1U7T0R1_BCL2L11      ------------
A0A1U7T0R1_BCL2L11      ------------
O54918_BCL2L11-01       ------------
O88498_BCL2L11-01       ------------
A0A2K5Z7V3_BCL2L11      ------------
A0A096NYC3_BCL2L11      ------------
A0A2K5X1Y3_BCL2L11      ------------
A0A2K6E212_BCL2L11      ------------
A0A2K5NU92_BCL2L11      ------------
A0A096NYC3_BCL2L11      ------------
A0A2K6KJP8_BCL2L11      ------------
A0A2I3SN61_BCL2L11      ------------
A0A2R8M6L7_BCL2L11      ------------
A0A2K5CA89_BCL2L11      ------------
A0A2K5Q1Y0_BCL2L11      ------------
A0A1U7T0R1_BCL2L11      ------------
A0A1U7T0R1_BCL2L11      ------------
A0A3Q2GRS5_BCL2L11      ------------
J9NWV6_BCL2L11-04       ------------
U6CTE3_BCL2L11-02       ------------
A0A1U8BW10_BCL2L11      ------------
A0A1U7T0R1_BCL2L11      ------------
A0A2K6GE31_BCL2L11      ------------
A0A287DFJ0_BCL2L11      ------------
A0A452FCR6_BCL2L11      ------------
W5PY58_BCL2L11-01       ------------
L8IVA4_BCL2L11-02       ------------
A0A286XJN2_BCL2L11      ------------
A0A286XJN2_BCL2L11      ------------
G1SSY0_BCL2L11-02       ------------
A0A250YBV9_BCL2L11      ------------
H0XW23_BCL2L11-01       ------------
A0A1S3FFM9_BCL2L11      ------------
U6CTE3_BCL2L11-01       ------------
G1LDR8_BCL2L11-01       ------------
J9NWV6_BCL2L11-03       ------------
A0A2I2UX96_BCL2L11      ------------
O54918_BCL2L11-03       ------------
A0A1U8BW10_BCL2L11      ------------
J9NWV6_BCL2L11-05       ------------
A0A3Q2GRS5_BCL2L11      ------------
A0A452U4S4_BCL2L11      ------------
A0A2R9C366_BCL2L11      ------------
A0A2I3GVB2_BCL2L11      ------------
A0A2K6TRU4_BCL2L11      ------------
A0A0D9RWE0_BCL2L11      ------------
U6CTE3_BCL2L11-03       ------------
A0A2K6E212_BCL2L11      ------------
H2P5E2_BCL2L11-01       ------------
A0A250YBV9_BCL2L11      ------------
A0A286XJN2_BCL2L11      ------------
A0A2I2UX96_BCL2L11      ------------
A0A1S3FFM9_BCL2L11      ------------
A0A452SBG5_BCL2L11      ------------
A0A3Q1MV27_BCL2L11      ------------
A0A1U8BW10_BCL2L11      ------------
A0A287DFJ0_BCL2L11      ------------
L8IVA4_BCL2L11-01       ------------
A0A3Q1MV27_BCL2L11      ------------
A0A452FCR6_BCL2L11      ------------
A0A2K5CA89_BCL2L11      ------------
A0A2K5Z7V3_BCL2L11      ------------
A0A2K6KJP8_BCL2L11      ------------
                                    

© 1998-2020Legal notice