Dataset for protein Bim of organism all

[Download (right click)] [Sequences] [Repertoires]

583 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      ---------------------------------CS---------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      ---------------------------------MYI-YI-CIC-------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      ---------------------------------MGR-GA-GGR-------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      ------RS------GRSPRRPGPAQTC------CAQHIR-ENN-------
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      ---------------------------------MIP-AA--AG-------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      ---------------------------------MPA-AR-SID-------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      ---------------------------------MFP-AA-ATR-------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      ---------------------------------MFP-AA-AAG-------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      ---------------------------------MFP-AAAAAG-------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      ---------------------------------MIL-KL-----------
A0A8C2P0X3_BCL2L11-02      ---------------------------------MSD-PN-SR--------
A0A8B9QMZ1_BCL2L11-01      ---------------------------------MGP-AR-GRR-------
A0A5F5PK35_BCL2L11-05      ---------------------------------M----------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      ---------------------------------MFP-AP-AAG-------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      ---------------------------------MSS-Y------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      ---------------------------------MIP-AV--AG-------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          ---------------------------------MFP-AA-AAG-------
A0A8I3N1T0_BCL2L11-03      ---------------------------------MFP-AA-AAG-------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      TRSAGAGP------AASAGEPGRATLAFTCWSLKAP-AA-AAA-------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      PATWGGGSRQGSRGVRAGTEAGRAGGAGAARVRETP-AA-VAA-------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      ---------------------------------MGWDGA-AAG-------
A0A8C0S6I7_BCL2L11-03      ---------------------------------MFP-AA-AAG-------
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      TRPAGGRAGG----ARRGTRPGHPRLY------LLEPER-ASR-------
A0A3Q7S5V2_BCL2L11-01      GRKTGARARC----APPPPPPEHVRAA------AC-PRR-TLA-------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      ---------------------------------MKQTRR-DRG-------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          ---------------------------------MGRAGR-GPG-------
A0A8I5ZK47_BCL2L11-01      ---------------------------------LSQPAR-ASG-------
A0A8C2UYE1_BCL2L11-02      TRPGRRRS-------RQGTRRGQPRLY------LSQPAR-AGS-------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      ---------------------------------MGA-SA-GERVAFRVPT
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      ---------------------------------MGA-SA-GERVAFRVPT
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      ---------------------------------MGP-EQ-G---------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      ---------------------------------MFP-AA-AAG-------
A0A8C0NKD6_BCL2L11-02      ---------------------------------MFP-AA-AAG-------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      ---------------------------------MFP-AA-AAG-------
A0A8C0S6I7_BCL2L11-01      ---------------------------------MFP-AA-AAG-------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      ---------------------------------MFP-AA-AVG-------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      ---------------------------------MFP-AA-AAG-------
A0A8C4LFQ1_BCL2L11-05      ---------------------------------MFP-AA-AAG-------
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      ---------------------------------MKQTRR-DRG-------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-06      ---------------------------------MFP-AA-AAG-------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      ---------------------------------MFP-AA-AAG-------
A0A2K5X1Y3_BCL2L11-08      ---------------------------------MFP-AA-AAG-------
F7HHA1_BCL2L11-03          ---------------------------------MFP-AA-AAG-------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      ---------------------------------MIP-AA--AG-------
M3YDI3_BCL2L11-01          ---------------------------------MFP-AA-AAG-------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      ---------------------------------MFP-AA-AAG-------
A0A096NYC3_BCL2L11-02      ---------------------------------MFP-AA-AAG-------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      ---------------------------------MFP-AA-AAG-------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      ---------------------------------MIP-AV--AG-------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      ---------------------------------MFP-AA-AAG-------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          --------------------------------------------------
O43521_BCL2L11-06          ---------------------------------MFP-AA-AAG-------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      ---------------------SNR--------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      ---------------------TYK--------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      ----------GLGRG------RGR-----------------AAPPRRRPL
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      ---------------------AAR--------------------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      ---------------------SER--------------------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      ---------------------AAR--------------------------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      ---------------------AAR--------------------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      ---------------------AAR--------------------------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      --------------------------------------------------
A0A8B9QMZ1_BCL2L11-01      ---------------------PRP--------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      ---------------------AAR--------------------------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      ---------------------AAR--------------------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          ---------------------AAR--------------------------
A0A8I3N1T0_BCL2L11-03      ---------------------AAR--------------------------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      ---------------------AAA--------------------------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      ---------------------GAAFGGEFVNNRLAFGGLTRRRRLRRR-R
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      ---------------------RLL--------------------------
A0A8C0S6I7_BCL2L11-03      ---------------------AAR--------------------------
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      ---------------------CGA--------------------------
A0A3Q7S5V2_BCL2L11-01      ---------AGREAAVRRAGSLPH--------------------------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      ---------------------LAR--------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          ---------------------AAQ--------------------------
A0A8I5ZK47_BCL2L11-01      ---------------------LGA--------------------------
A0A8C2UYE1_BCL2L11-02      ---------------------PRG--------------------------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      PAGLHWGRRPGLESG------AGS--------------------------
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      PAGLHWGRRPGLESG------AGS--------------------------
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      ---------------------AAR--------------------------
A0A8C0NKD6_BCL2L11-02      ---------------------AAR--------------------------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      ---------------------AAR--------------------------
A0A8C0S6I7_BCL2L11-01      ---------------------AAR--------------------------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      ---------------------VAR--------------------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      ---------------------AAR--------------------------
A0A8C4LFQ1_BCL2L11-05      ---------------------AAR--------------------------
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      ---------------------LAR--------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-06      ---------------------AAR--------------------------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      ---------------------AAR--------------------------
A0A2K5X1Y3_BCL2L11-08      ---------------------AAR--------------------------
F7HHA1_BCL2L11-03          ---------------------AAR--------------------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      ---------------------AAR--------------------------
M3YDI3_BCL2L11-01          ---------------------AAR--------------------------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      ---------------------AAR--------------------------
A0A096NYC3_BCL2L11-02      ---------------------AAR--------------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      ---------------------AAR--------------------------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      ---------------------AAR--------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      ---------------------AAR--------------------------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          --------------------------------------------------
O43521_BCL2L11-06          ---------------------AAR--------------------------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      LLAGCGAGT-----------------------------ART-RRS-LALP
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      --------------------------------------ARG-AAR-ETFG
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      --------------------------------------PRA---------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      --------------------------------------ARG-AAR-GAVG
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      --------------------------------------ARG-AAR-GALG
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      --------------------------------------ARG-AAR-GALG
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      --------------------------------------------------
A0A8B9QMZ1_BCL2L11-01      --------------------------------------PRS-P-------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      --------------------------------------ARG-AAR-EVLG
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      --------------------------------------ARG-AAR-ETLG
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          --------------------------------------ARG-AAC-GALG
A0A8I3N1T0_BCL2L11-03      --------------------------------------ARG-AAR-GTLG
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      --------------------------------------RRG-GAG---RA
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      LLAVARSDRARANWERGHPAPAARGGRRCRRRRAQCARRSG-RXA-EALG
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      -LAAAPSCSP----------------------------AAGRAQR-GPAA
A0A8C0S6I7_BCL2L11-03      --------------------------------------ARG-AAR-GALG
A0A7N5JE15_BCL2L11-04      ---------------------------------------MG-PEWGTRPA
A0A8I3N1T0_BCL2L11-01      ---------------------------------------AG-RGGASGPR
A0A3Q7S5V2_BCL2L11-01      ---------------------------------------AG-PGWGGGVR
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      --------------------------------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          --------------------------------------SVQ-APR-RVPA
A0A8I5ZK47_BCL2L11-01      ---------------------------------------VG-GGT-YLPA
A0A8C2UYE1_BCL2L11-02      ---------------------------------------AG-AGL-ALPR
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      ---------------------------------------A------GSVL
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      ---------------------------------------A------GSVL
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      --------------------------------------ARG-AAR-GALG
A0A8C0NKD6_BCL2L11-02      --------------------------------------ARG-AAR-GALG
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      --------------------------------------ARG-AAR-GALG
A0A8C0S6I7_BCL2L11-01      --------------------------------------ARG-AAR-GALG
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      --------------------------------------TGD-AAC-GALS
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      --------------------------------------ARG-AAR-GALG
A0A8C4LFQ1_BCL2L11-05      --------------------------------------ARG-AAR-GALG
A0A8C4LFQ1_BCL2L11-04      ---------------------------------------MG-PERGTRPP
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      ----------------------------------------G-AAC-GALG
A0A0C4DH20_BCL2L11-06      --------------------------------------ARG-AAC-GALG
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      --------------------------------------ARG-AAC-GTLG
A0A2K5X1Y3_BCL2L11-08      --------------------------------------ARG-AAC-GTLG
F7HHA1_BCL2L11-03          --------------------------------------ARG-AAC-GALG
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      --------------------------------------ARG-AAR-ETFG
M3YDI3_BCL2L11-01          --------------------------------------ARG-AAR-GALG
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      --------------------------------------GRG-AAC-GALG
A0A096NYC3_BCL2L11-02      --------------------------------------GRG-AAC-GALG
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      --------------------------------------ARG-AAC-GALG
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      --------------------------------------ARG-AAR-ETLG
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      --------------------------------------ARG-AAR-GALG
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          ----------------------------------------G-AAC-GALG
O43521_BCL2L11-06          --------------------------------------ARG-AAC-GALG
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      ------------------------------------A-------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      -VPTQQVSG------------RAGR----A---RSGAAWLASFT------
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      -SPAERGGG------------RTGR----R---G----------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      ---------------------FSDR----R---G----------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      -CPAERSGG------------LAGR----R---GLCA-------------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      -CPAERGGG-G---------GRAAG----G---GLCA-------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      -CPVERGGG------------RAAS----C---KLCA-------------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      ---------------------------------NLLK-------------
A0A8C2P0X3_BCL2L11-02      ------T-------------------------------------------
A0A8B9QMZ1_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      -CRAQRGGG------------WAGR----R---GLCA-------------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      -SPAERGGG------------RTGR----R---G----------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          -CPAECGG------------GLAGR----R---GLCA-------------
A0A8I3N1T0_BCL2L11-03      -CPAERGGGGG---------GRAAG----G---GLCA-------------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      -CPRA-GA------------GLRGG----GARGDWVR-ALGRQSEL----
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      -CPAERGG------------GRAAS----G---RLCA-------------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      -LSPSQSQHSK---------FRAEP----G---GLGAELLGSQVSLQNVM
A0A8C0S6I7_BCL2L11-03      -CPAERGG--G---------GRAAG----G---GLCA-------------
A0A7N5JE15_BCL2L11-04      -AC----N------------------RCICA--------------R----
A0A8I3N1T0_BCL2L11-01      -GG----A------------GPGGG----GARGDWLR-ARGRQSER----
A0A3Q7S5V2_BCL2L11-01      -AC----G------------APGGGPKCGSGRDCARR-GAGKGSAR----
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      ------------------------G----GSWAW----------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          FCP-----------------------------------------------
A0A8I5ZK47_BCL2L11-01      -CP--------------------------------------GRTER----
A0A8C2UYE1_BCL2L11-02      -AE----A------------GLGGG----GARGDWTR-ARSRQSEL----
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      -SPGDRLSGAAGAAEAGAAPGLTEG----RGRFGWAA-PVPE--------
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      -SPGDRLSGAAGAAEAGAAPGLTEG----RGRFGWAA-PVPE--------
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      -CPAERGGG-G---------GRAAG----G---GLCA-------------
A0A8C0NKD6_BCL2L11-02      -CPAERGGG-G---------GRAAG----G---GLCA-------------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      -CPAERGG--G---------GRAAG----G---GLCA-------------
A0A8C0S6I7_BCL2L11-01      -CPAERGG--G---------GRAAG----G---GLCA-------------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      -CPAERGS------------GRAAS----C---RLSA-------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      -CPAERGG--G---------GRAAS----G---RLCA-------------
A0A8C4LFQ1_BCL2L11-05      -CPAERGG--G---------GRAAS----G---RLCA-------------
A0A8C4LFQ1_BCL2L11-04      -AC----S------------------GCICA--------------R----
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      ------------------------G----GSWAW----------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      -CPAERGG------------GLAGR----R---GLCA-------------
A0A0C4DH20_BCL2L11-06      -CPAERGG------------GLAGR----R---GLCA-------------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      -CPAECGG------------GLAGR----R---GLCA-------------
A0A2K5X1Y3_BCL2L11-08      -CPAECGG------------GLAGR----R---GLCA-------------
F7HHA1_BCL2L11-03          -CPAECGG------------GLAGR----R---GLCA-------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      -SPAERGGG------------RTGR----R---G----------------
M3YDI3_BCL2L11-01          -CRTARG---G---------GRAAS----G---RLCA-------------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      -CPAECGG------------GLAGR----R---GLCA-------------
A0A096NYC3_BCL2L11-02      -CPAECGG------------GLAGR----R---GLCA-------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      -CPAERGG------------GLAGR----R---GLRA-------------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      -SPAERGGG------------RTGR----R---G----------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      -CPAERGGG-G---------GRAAG----G---GLCA-------------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          -CPAERGG------------GLAGR----R---GLCA-------------
O43521_BCL2L11-06          -CPAERGG------------GLAGR----R---GLCA-------------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      ----------YIT------DSLTSCYSR--S------------QR-----
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      -------GPGALG------RSPRSA-PR---------------RQP----
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      ------------S------KCNGFC-----------------RRPADS--
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      ----------ALE------PRTRLCFPC--L------------LGGDV--
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      --------------------------------------------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      -------APGTLN------PSPGLCLLH--C------------LRGDG--
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      -------VPASPS------ASPGLCLPR--C------------LRGDG--
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      -------IIVLLC------PPPT---------------------------
A0A8C2P0X3_BCL2L11-02      --------------------------------------------------
A0A8B9QMZ1_BCL2L11-01      ----------PPA------PPP----------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      -------VLGPLN------PGAGLSPLR--R------------LHGDN--
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      ----------ALE------PRTRLCFPC--L------------LGGYV--
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          -------APGTLN------PSPELCFLR--C------------LRGDG--
A0A8I3N1T0_BCL2L11-03      -------APGALN------ASPGLCLPR--S------------LRADG--
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      -------SCGAVQVSLRSAQPPSLGLVK--ALRPASPLP---PLPPDS--
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      -------APGALN------ASPGYCLLR--S------------LRADG--
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      AFVGGRLTPGALR------SGP----------------------------
A0A8C0S6I7_BCL2L11-03      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A7N5JE15_BCL2L11-04      -------SCAPAQYLIPGSQSP-LGVSD--FCKSA---------------
A0A8I3N1T0_BCL2L11-01      -------SCRAVQVSLRSAQPPGLGLAR--GLRPASPPPPPPPPPPDS--
A0A3Q7S5V2_BCL2L11-01      -------SALSRELRPRCW-ILGCAAGR--QVSPPCPETPPPPPSPGSGR
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      --------------WRWRVGALRSAWINSPAL------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          -------------------VAGGSERAA--ARFPA------PAGADSE--
A0A8I5ZK47_BCL2L11-01      -------GAEPAVIGRRSGGSVRAEWLGQAAFTSL------PAGTGST--
A0A8C2UYE1_BCL2L11-02      -------GCRAAQVSLRSAQPLGAELAG--AQRPA------PSPPPHH--
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      -------------------------------------------APETS--
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      -------------------------------------------APETS--
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A8C0NKD6_BCL2L11-02      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A8C0S6I7_BCL2L11-01      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      -------APGAPT------ASPGLCLPG--R------------LRVDG--
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      -------VLAPLS------ASPGLCLPR--C------------LSGDN--
A0A8C4LFQ1_BCL2L11-05      -------VLAPLS------ASPGLCLPR--C------------LSGDN--
A0A8C4LFQ1_BCL2L11-04      -------SCAPARDLIPGNQSP-LGVSD--LFKLP---------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      --------------WRWRVGALRSAWINSPAL------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      -------APGTLN------PSPGLCLLR--C------------FRGDG--
A0A0C4DH20_BCL2L11-06      -------APGTLN------PSPGLCLLR--C------------FRGDG--
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      -------APGTLN------PSPELCFLR--C------------LRGDG--
A0A2K5X1Y3_BCL2L11-08      -------APGTLN------PSPELCFLR--C------------LRGDG--
F7HHA1_BCL2L11-03          -------APGTLN------PSPELCFLR--C------------LRGDG--
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      ----------ALE------PRTRLCFPC--L------------LGGDV--
M3YDI3_BCL2L11-01          -------APGALK------ASPRLCLPR--F------------FRAEG--
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      -------APGTLN------PSPELCFLR--C------------LRGDG--
A0A096NYC3_BCL2L11-02      -------APGTLN------PSPELCFLR--C------------LRGDG--
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      -------ALGTLS------PSPGLCLLR--C------------FRGDG--
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      ----------ALE------PRTRLCFPC--L------------LGGYV--
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      -------APGALN------ASPGLCLPR--S------------LRADG--
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          -------APGTLN------PSPGLCLLR--C------------FRGDG--
O43521_BCL2L11-06          -------APGTLN------PSPGLCLLR--C------------FRGDG--
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      ---RSAPV-G-----TA--GGFWSVEKGSALLSYFFVCLFVC--------
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      ---QGSFD-R-----R----------------------------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      --------------------------------------------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      ---QGPPG-R-----RK--A------------------------------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      ---QGAPG-R-----RR--T------------------------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      ---RGVPN-R-----RR--A------------------------------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      --------------------------------------------------
A0A8B9QMZ1_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      ---QGAPV-R-----RR--A------------------------------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      ---QGSSD-R-----H----------------------------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          ---QGAPG-R-----RR--A------------------------------
A0A8I3N1T0_BCL2L11-03      ---QGAPG-R-----RR--T------------------------------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      ---HSHPA-R-----AS--P------------------------------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      ---QGAPG-R-----RR--T------------------------------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      ---LGVFG------------------------------------------
A0A8C0S6I7_BCL2L11-03      ---QGAPG-R-----RR--T------------------------------
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-01      AVGAGLAPWLSSGARARCGG---------F---------AELRRFFHWRD
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      ---------------RR--G------------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          ---------------RR--G---------L---------AEE--------
A0A8I5ZK47_BCL2L11-01      ------AC-------WS--S---------AVLAAAAVVVAVT--------
A0A8C2UYE1_BCL2L11-02      ---------------RR--Q---------R--------------------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      ---AAAPA-A-----VR--A------------------------------
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      ---AAAPA-A-----VR--A------------------------------
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      ---QGAPG-R-----RR--T------------------------------
A0A8C0NKD6_BCL2L11-02      ---QGAPG-R-----RR--T------------------------------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      ---QGAPG-R-----RR--T------------------------------
A0A8C0S6I7_BCL2L11-01      ---QGAPG-R-----RR--T------------------------------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      ---QGAPG-R-----RR--A------------------------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      ---QGAPG-R-----RK--A------------------------------
A0A8C4LFQ1_BCL2L11-05      ---QGAPG-R-----RK--A------------------------------
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      ---------------RR--G------------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      ---QGAPG-R-----RR--A------------------------------
A0A0C4DH20_BCL2L11-06      ---QGAPG-R-----RR--A------------------------------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      ---QGAPG-R-----RR--A------------------------------
A0A2K5X1Y3_BCL2L11-08      ---QGAPG-R-----RR--A------------------------------
F7HHA1_BCL2L11-03          ---QGAPG-R-----RR--A------------------------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      ---QGSFD-R-----R----------------------------------
M3YDI3_BCL2L11-01          ---QGAPG-R-----RR--T------------------------------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      ---QGAPG-R-----RR--A------------------------------
A0A096NYC3_BCL2L11-02      ---QGAPG-R-----RR--A------------------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      ---QGVPG-R-----RS--A------------------------------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      ---QGSSD-R-----H----------------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      ---QGAPG-R-----RR--T------------------------------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          ---QGAPG-R-----RR--A------------------------------
O43521_BCL2L11-06          ---QGAPG-R-----RR--A------------------------------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      -----------L-----------------FVRS--S---CG-RCFASSHF
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      --------------------------------------------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      ---------------------------------------------HA--V
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      -----------------------------------R---VG-RRGAPSRA
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      -----------------------------------R---AG-RRGAR--A
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      -----------------------------------R---TA-RRGAR--A
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      ----------------------------------------E--------K
A0A8B9QMZ1_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      -----------------------------------R---VE-RCGARAGA
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      --------------------------------------------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          -----------------------------------R---AR-RPGARARA
A0A8I3N1T0_BCL2L11-03      -----------------------------------R---AG-RRGARA--
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      -----------------------------------T---AA-SIAAGCSL
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      -----------------------------------R---AG-RRGARARA
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-03      -----------------------------------R---AG-RRGARA--
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      ---------------------------------------------HSRP-
A0A3Q7S5V2_BCL2L11-01      SAFSLHRLRPRFQGGCSVR---ALLDVSGGALPCPALPGPRLRCRHQQP-
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      -----------------------------------WL--CP-RWG-----
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          -----------L-----------------LLEPDSL--------------
A0A8I5ZK47_BCL2L11-01      -----------G-----------------FLQPLREL--CS-TWIHTTS-
A0A8C2UYE1_BCL2L11-02      -----------I-----------------LTVPLRALPHCS-QHRLRQL-
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      --------RAAFGGE-FVNNRLAFGGLLAGAAPAAATDWLRLRXXXXXX-
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      --------RAAFGGE-FVNNRLAFGGLLAGAAPAAATDWLRLRXXXXXX-
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      ------------------------------TLPAAACNRCI----CA---
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      -----------------------------------R---AG-RRGARA--
A0A8C0NKD6_BCL2L11-02      -----------------------------------R---AG-RRGARA--
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      -----------------------------------R---AG-RRGARA--
A0A8C0S6I7_BCL2L11-01      -----------------------------------R---AG-RRGARA--
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      -----------------------------------R---AG-RRRAPA--
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      -----------------------------------R---AG-RRGARA--
A0A8C4LFQ1_BCL2L11-05      -----------------------------------R---AG-RRGARA--
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      -----------------------------------WL--CP-RWG-----
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      -----------------------------------R---AG-RRGAWSLA
A0A0C4DH20_BCL2L11-06      -----------------------------------R---AG-RRGAWSLA
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      -----------------------------------R---AR-RPGARARA
A0A2K5X1Y3_BCL2L11-08      -----------------------------------R---AR-RPGARARA
F7HHA1_BCL2L11-03          -----------------------------------R---AR-RPGARARA
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      --------------------------------------------------
M3YDI3_BCL2L11-01          -----------------------------------R---AG-RRGARA--
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      -----------------------------------R---AR-RPGARARA
A0A096NYC3_BCL2L11-02      -----------------------------------R---AR-RPGARARA
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      -----------------------------------R---AG-RRGARSRA
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      --------------------------------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      -----------------------------------R---AG-RRGARA--
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          -----------------------------------R---AG-RRGAWSLA
O43521_BCL2L11-06          -----------------------------------R---AG-RRGAWSLA
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      PD------------------------------------------------
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      -N------------------------------------------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      -E------------------------------------------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      -R------------------------------------------------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      -R------------------------------------------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      -R------------------------------------------------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      -R------------------------------------------------
A0A8B9QMZ1_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      -R------------------------------------------------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      -N------------------------------------------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          -R------------------------------------------------
A0A8I3N1T0_BCL2L11-03      -R------------------------------------------------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      -RPAPAAT------------------------------------------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      -R------------------------------------------------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-03      -R------------------------------------------------
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      --TRPSPLR-----------------------------------------
A0A3Q7S5V2_BCL2L11-01      --HDPDGER-----------------------------------------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      --------------------------------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          --------------------------------------------------
A0A8I5ZK47_BCL2L11-01      --AAPAAT------------------------------------------
A0A8C2UYE1_BCL2L11-02      --QLPRSRR-----------------------------------------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      --XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      --XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      -R------------------------------------------------
A0A8C0NKD6_BCL2L11-02      -R------------------------------------------------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      -R------------------------------------------------
A0A8C0S6I7_BCL2L11-01      -R------------------------------------------------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      -R------------------------------------------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      -R------------------------------------------------
A0A8C4LFQ1_BCL2L11-05      -R------------------------------------------------
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      -R------------------------------------------------
A0A0C4DH20_BCL2L11-06      -R------------------------------------------------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      -R------------------------------------------------
A0A2K5X1Y3_BCL2L11-08      -R------------------------------------------------
F7HHA1_BCL2L11-03          -R------------------------------------------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      -N------------------------------------------------
M3YDI3_BCL2L11-01          -R------------------------------------------------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      -Q------------------------------------------------
A0A096NYC3_BCL2L11-02      -Q------------------------------------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      -R------------------------------------------------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      -N------------------------------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      -R------------------------------------------------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          -R------------------------------------------------
O43521_BCL2L11-06          -R------------------------------------------------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      ----LILS----------------------DGACFSELGDGAVWLQSPDV
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      --------------------------------------------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      --------------------------------------------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      --------------------------------------------------
A0A8B9QMZ1_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      --------------------------------------------------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      --------------------------------------------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          --------------------------------------------------
A0A8I3N1T0_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      ---------------------------------PSAPFP-----------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      --------------------------------------------------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-03      --------------------------------------------------
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      --------------------------PASPRAARFAPLPPPPLWRP---F
A0A3Q7S5V2_BCL2L11-01      -----------------------------PRAA----GPAPPVGHP---H
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      --------------------------------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          --------------------------------------------------
A0A8I5ZK47_BCL2L11-01      ---------------------------------ASAPFP-----------
A0A8C2UYE1_BCL2L11-02      -----------------------------H---RLGALP-----------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      XXXXXXXXXXXXXXXXXXXXXXXXXXGSSERE-SRALFP-----------
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      XXXXXXXXXXXXXXXXXXXXXXXXXXGSSERE-SRALFP-----------
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      --------------------------------------------------
A0A8C0NKD6_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-05      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-06      --------------------------------------------------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-08      --------------------------------------------------
F7HHA1_BCL2L11-03          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      --------------------------------------------------
M3YDI3_BCL2L11-01          --------------------------------------------------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-02      --------------------------------------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      --------------------------------------------------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      --------------------------------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      --------------------------------------------------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          --------------------------------------------------
O43521_BCL2L11-06          --------------------------------------------------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------------------------
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------------------------
A0A3B4V919_BCL2L11-01      --------------------------------------------------
A0A3B4XZH1_BCL2L11-01      --------------------------------------------------
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      --------------------------------------------------
A0A3Q1CI15_BCL2L11-01      --------------------------------------------------
A0A3Q1ELG4_BCL2L11-01      --------------------------------------------------
A0A669C520_BCL2L11-01      --------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      --------------------------------------------------
A0A4W5NF23_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-01      --------------------------------------------------
A0A4W5R3N6_BCL2L11-02      --------------------------------------------------
B2KKY9_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-03      --------------------------------------------------
A0A8C1CBG6_BCL2L11-01      --------------------------------------------------
W5UEE7_BCL2L11-01          --------------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      --------------------------------------------------
A0A3B1JXK6_BCL2L11-01      --------------------------------------------------
A0A3B4BSH7_BCL2L11-02      --------------------------------------------------
A0A8L0DSD4_BCL2L11-01      --------------------------------------------------
A0A3P8XIA2_BCL2L11-01      --------------------------------------------------
A0A673IWZ7_BCL2L11-01      --------------------------------------------------
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      --------------------------------------------------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      --------------------------------------------------
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      --------------------------------------------------
A0A8C9EIW6_BCL2L11-01      --------------------------------------------------
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      --------------------------------------------------
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      --------------------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      --------------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      --------------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      --------------------------------------------------
A0A672TST9_BCL2L11-01      --------------------------------------------------
A0A674H354_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-02      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      VSLWSRESL-------L---------------------------------
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A8C4REW7_BCL2L11-02      --------------------------------------------------
A0A8D0C9E7_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------------------------
A0A4X1VRX9_BCL2L11-05      --------------------------------------------------
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-03      --------------------------------------------------
A0A0P6J9X4_BCL2L11-04      --------------------------------------------------
A0A5F5PK35_BCL2L11-02      --------------------------------------------------
A0A8C3RZA1_BCL2L11-01      --------------------------------------------------
A0A803KLJ9_BCL2L11-01      --------------------------------------------------
A0A8D2Q5M7_BCL2L11-01      --------------------------------------------------
A0A8C4REW7_BCL2L11-01      --------------------------------------------------
A0A0P6J9X4_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-01      --------------------------------------------------
A0A6I9LW27_BCL2L11-01      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-02      ----------------T---------------------------------
A0A8C2QK28_BCL2L11-02      --------------------------------------------------
G3SU55_BCL2L11-01          --------------------------------------------------
A0A8C4LFQ1_BCL2L11-07      ----------------E---------------------------------
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-08      ----------------T---------------------------------
A0A2K5NTQ5_BCL2L11-05      --------------------------------------------------
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      ----------------T---------------------------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-01      ----------------T---------------------------------
A0A8C9PPC0_BCL2L11-01      --------------------------------------------------
A0A2R8M6L7_BCL2L11-02      --------------------------------------------------
A0A8C6HGQ3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-02      ----------------K---------------------------------
A0A8B9QMZ1_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-05      --------------------------------------------------
A0A8B7EUP7_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-03      ----------------T---------------------------------
A0A7N4NUH6_BCL2L11-03      --------------------------------------------------
A0A8C3FX85_BCL2L11-02      --------------------------------------------------
A0A0P6J9X4_BCL2L11-05      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-03      --------------------------------------------------
A0A8I5ZK47_BCL2L11-03      ----------------T---------------------------------
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          ----------------T---------------------------------
A0A8I3N1T0_BCL2L11-03      ----------------T---------------------------------
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      -WPSSPQCL-------T---------------------------------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      ----------------T---------------------------------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-03      ----------------T---------------------------------
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      LGPRPPQCL-------T---------------------------------
A0A3Q7S5V2_BCL2L11-01      SLAVPPGGAVPSGACSSVSELVAEDPPAAGARGVDVFAVCRAHGCARTRV
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      ---GFHR-------------------------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          ---LFRQSL-------S---------------------------------
A0A8I5ZK47_BCL2L11-01      -WPSSTQCL-------T---------------------------------
A0A8C2UYE1_BCL2L11-02      -WPWYPQCL-------T---------------------------------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      ---APPSC------------------------------------------
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      ---APPSC------------------------------------------
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-05      --------------------------------------------------
A0A2K5CA52_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      --------------------------------------------------
A0A2K5CA52_BCL2L11-07      --------------------------------------------------
A0A2K5CA52_BCL2L11-06      --------------------------------------------------
A0A2K5CA52_BCL2L11-04      --------------------------------------------------
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      --------------------------------------------------
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------------------------
A0A2R8M6L7_BCL2L11-04      --------------------------------------------------
A0A2R8M6L7_BCL2L11-05      --------------------------------------------------
A0A2R8M6L7_BCL2L11-06      --------------------------------------------------
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      --------------------------------------------------
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      ----------------T---------------------------------
A0A8C0NKD6_BCL2L11-02      ----------------T---------------------------------
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      ----------------T---------------------------------
A0A8C0S6I7_BCL2L11-01      ----------------T---------------------------------
A0A452FCR6_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------------------------
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-06      --------------------------------------------------
A0A1U7SU38_BCL2L11-05      --------------------------------------------------
A0A1U7SU38_BCL2L11-01      --------------------------------------------------
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      --------------------------------------------------
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-08      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-05      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-06      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-01      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-03      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-06      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-08      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------------------------
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      --------------------------------------------------
A0A8C1CBG6_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-02      --------------------------------------------------
A0A8C2L5J3_BCL2L11-01      --------------------------------------------------
B8JK68_BCL2L11-01          --------------------------------------------------
A0A2Y9Q753_BCL2L11-01      --------------------------------------------------
A0A2Y9Q753_BCL2L11-02      ----------------T---------------------------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-08      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-06      ----------------T---------------------------------
A0A8C4LFQ1_BCL2L11-05      ----------------T---------------------------------
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-04      --------------------------------------------------
A0A8C4TR55_BCL2L11-03      --------------------------------------------------
A0A8C4TR55_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      --------------------------------------------------
A0A2I2UX96_BCL2L11-01      --------------------------------------------------
A0A8C4VJX6_BCL2L11-02      ---GFHR-------------------------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      --------------------------------------------------
A0A0P6J9X4_BCL2L11-06      --------------------------------------------------
A0A0P6J9X4_BCL2L11-07      --------------------------------------------------
A0A0P6J9X4_BCL2L11-08      --------------------------------------------------
A0A0C4DH20_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      ----------------T---------------------------------
A0A0C4DH20_BCL2L11-06      ----------------T---------------------------------
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-01      --------------------------------------------------
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      --------------------------------------------------
A0A667H9R7_BCL2L11-04      --------------------------------------------------
A0A667H9R7_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      ----------------T---------------------------------
A0A2K5X1Y3_BCL2L11-08      ----------------T---------------------------------
F7HHA1_BCL2L11-03          ----------------T---------------------------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-04      --------------------------------------------------
A0A8B7EUP7_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      --------------------------------------------------
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------------------------
A0A8C6HGQ3_BCL2L11-03      ----------------T---------------------------------
M3YDI3_BCL2L11-01          ----------------T---------------------------------
A0A8C6VGF4_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-01      --------------------------------------------------
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      --------------------------------------------------
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      --------------------------------------------------
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-01      --------------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      --------------------------------------------------
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      --------------------------------------------------
H0XW23_BCL2L11-01          --------------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      --------------------------------------------------
A0A096NYC3_BCL2L11-01      ----------------T---------------------------------
A0A096NYC3_BCL2L11-02      ----------------T---------------------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-01      ----------------T---------------------------------
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      --------------------------------------------------
A0A2K6GE22_BCL2L11-04      --------------------------------------------------
A0A2K6GE22_BCL2L11-05      --------------------------------------------------
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      --------------------------------------------------
A0A2K6GE22_BCL2L11-03      --------------------------------------------------
A0A670Y3D3_BCL2L11-01      --------------------------------------------------
A0A8I5ZK47_BCL2L11-04      ----------------T---------------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-04      --------------------------------------------------
A0A2K6KJM8_BCL2L11-09      --------------------------------------------------
A0A2K6KJM8_BCL2L11-07      --------------------------------------------------
A0A2K6KJM8_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-03      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-09      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-10      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-05      --------------------------------------------------
A0A673WET2_BCL2L11-01      --------------------------------------------------
A0A7N4NUH6_BCL2L11-02      --------------------------------------------------
A0A7N4NUH6_BCL2L11-04      --------------------------------------------------
A0A8D2B0V4_BCL2L11-02      --------------------------------------------------
A0A8D2B0V4_BCL2L11-01      --------------------------------------------------
A0A8D2D0L1_BCL2L11-01      --------------------------------------------------
A0A671M057_BCL2L11-01      --------------------------------------------------
A0A671SJ75_BCL2L11-01      --------------------------------------------------
A0A672L1R2_BCL2L11-01      --------------------------------------------------
A0A672PQD1_BCL2L11-01      --------------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      --------------------------------------------------
A0A8D0H1T5_BCL2L11-01      --------------------------------------------------
A0A673SRF7_BCL2L11-03      --------------------------------------------------
A0A673SRF7_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-02      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-01      --------------------------------------------------
C1KGB8_BCL2L11-01          --------------------------------------------------
A0A674IAI8_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-05      --------------------------------------------------
A0A452SBG5_BCL2L11-01      --------------------------------------------------
Q3KPZ6_BCL2L11-01          --------------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      --------------------------------------------------
A0A8C0RM03_BCL2L11-03      --------------------------------------------------
A0A8C0S6I7_BCL2L11-05      --------------------------------------------------
A0A8I3N1T0_BCL2L11-02      --------------------------------------------------
A0A2K5CA52_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-04      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-01      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-08      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-06      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-07      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-02      --------------------------------------------------
A0A2K6TRJ7_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-01      --------------------------------------------------
A0A8C6C635_BCL2L11-03      --------------------------------------------------
A0A8C9CBP3_BCL2L11-04      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-07      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-02      --------------------------------------------------
A0A8C0RM03_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-06      --------------------------------------------------
A0A8I3N1T0_BCL2L11-04      --------------------------------------------------
A0A8C0RM03_BCL2L11-01      ----------------T---------------------------------
A0A6P3TPJ5_BCL2L11-01      --------------------------------------------------
A0A286XJN2_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-01      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-01      --------------------------------------------------
F7HHA1_BCL2L11-01          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-01      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-01      --------------------------------------------------
A0A8D2E0B6_BCL2L11-01      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-05      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-03      --------------------------------------------------
A0A2I3GAA1_BCL2L11-03      --------------------------------------------------
A0A2R9BZX9_BCL2L11-02      --------------------------------------------------
A0A2I3S5F6_BCL2L11-01      --------------------------------------------------
A0A2K5HZ87_BCL2L11-05      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-10          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-07      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-05      --------------------------------------------------
A0A2I3GAA1_BCL2L11-04      --------------------------------------------------
A0A2R9BZX9_BCL2L11-07      --------------------------------------------------
A0A2I3S5F6_BCL2L11-06      --------------------------------------------------
A0A2K5HZ87_BCL2L11-06      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-06      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-08      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-06      --------------------------------------------------
A0A096NYC3_BCL2L11-04      --------------------------------------------------
A0A8C9I5G9_BCL2L11-04      --------------------------------------------------
A0A8D2E0B6_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-03      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-08      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-10      --------------------------------------------------
A0A0C4DH20_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-13          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-07      --------------------------------------------------
A0A2R9BZX9_BCL2L11-10      --------------------------------------------------
A0A2I3S5F6_BCL2L11-09      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-05      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-10      --------------------------------------------------
A0A096NYC3_BCL2L11-06      --------------------------------------------------
A0A8D2E0B6_BCL2L11-07      --------------------------------------------------
A0A2K5HZ87_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-06      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-04      --------------------------------------------------
A0A096NYC3_BCL2L11-03      --------------------------------------------------
A0A8C9I5G9_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-03      --------------------------------------------------
A0A2K5HZ87_BCL2L11-02      --------------------------------------------------
A0A2K6E1Z6_BCL2L11-02      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-02      --------------------------------------------------
A0A2K6KJM8_BCL2L11-03      --------------------------------------------------
A0A8D2E0B6_BCL2L11-02      --------------------------------------------------
A0A8C9I5G9_BCL2L11-05      --------------------------------------------------
A0A2K6KJM8_BCL2L11-08      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-08      --------------------------------------------------
A0A8C6C635_BCL2L11-02      --------------------------------------------------
A0A5F5PK35_BCL2L11-01      --------------------------------------------------
A0A5F5PK35_BCL2L11-03      --------------------------------------------------
A0A667H9R7_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-04      --------------------------------------------------
A0A8C9JC73_BCL2L11-06      --------------------------------------------------
A0A667H9R7_BCL2L11-02      --------------------------------------------------
A0A0C4DH20_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-11          --------------------------------------------------
A0A2R9BZX9_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-05      --------------------------------------------------
A0A0C4DH20_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-05          --------------------------------------------------
A0A2I3GAA1_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-01      --------------------------------------------------
A0A2I3S5F6_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-04          --------------------------------------------------
A0A2R9BZX9_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-04      --------------------------------------------------
A0A2J8SGU7_BCL2L11-04      --------------------------------------------------
A0A0C4DH20_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-14          --------------------------------------------------
A0A2I3GAA1_BCL2L11-06      --------------------------------------------------
A0A2I3S5F6_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-05      --------------------------------------------------
A0A2R9BZX9_BCL2L11-08      --------------------------------------------------
A0A2I3S5F6_BCL2L11-07      --------------------------------------------------
A0A2J8SGU7_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-01          --------------------------------------------------
O43521_BCL2L11-12          --------------------------------------------------
O43521_BCL2L11-09          --------------------------------------------------
O43521_BCL2L11-07          ----------------T---------------------------------
O43521_BCL2L11-06          ----------------T---------------------------------
O43521_BCL2L11-03          --------------------------------------------------
A0A2R9BZX9_BCL2L11-04      --------------------------------------------------
A0A2I3S5F6_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-08          --------------------------------------------------
O43521_BCL2L11-02          --------------------------------------------------
A0A8D2KQ57_BCL2L11-02      --------------------------------------------------
A0A8D2KQ57_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-05      --------------------------------------------------
A0A8C9JC73_BCL2L11-03      --------------------------------------------------
A0A096NYC3_BCL2L11-05      --------------------------------------------------
A0A8D2E0B6_BCL2L11-06      --------------------------------------------------
A0A8B7EUP7_BCL2L11-03      --------------------------------------------------
A0A2I3S5F6_BCL2L11-02      --------------------------------------------------
A0A8C9JC73_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-02      --------------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-05      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-04      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-10      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-09      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-07      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-06      --------------------------------------------------
A0A2K6QIJ1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-03      --------------------------------------------------
A0A8D0C9E7_BCL2L11-04      --------------------------------------------------
A0A4X1VRX9_BCL2L11-02      --------------------------------------------------
A0A8D0JJW3_BCL2L11-04      --------------------------------------------------
A0A8D0JTL2_BCL2L11-05      --------------------------------------------------
A0A8D1A276_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-06      --------------------------------------------------
A0A8D0JJW3_BCL2L11-02      --------------------------------------------------
A0A8D0JTL2_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-02      --------------------------------------------------
A0A4X1VRX9_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-01      --------------------------------------------------
A0A8D0JTL2_BCL2L11-04      --------------------------------------------------
A0A8D1A276_BCL2L11-05      --------------------------------------------------
A0A4X1VRX9_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-03      --------------------------------------------------
A0A8D0JTL2_BCL2L11-03      --------------------------------------------------
A0A8D1A276_BCL2L11-04      --------------------------------------------------
A0A8D0JJW3_BCL2L11-06      --------------------------------------------------
A0A8D1A276_BCL2L11-03      --------------------------------------------------
A0A8D0JJW3_BCL2L11-05      --------------------------------------------------
A0A803KLJ9_BCL2L11-03      --------------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      -----------------------------------MQ-------------
A0A4W3IWD3_BCL2L11-02      -----------------------------------MCS------------
A0A4W3IWD3_BCL2L11-03      -----------------------------------RCS------------
M3XHJ5_BCL2L11-01          -----------------------------------MPT------------
A0A3B5M375_BCL2L11-01      -----------------------------------MLT------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      -----------------------------------MGQ------------
A0A803WCD8_BCL2L11-01      -----------------------------------RSR------------
A0A4W6ETK4_BCL2L11-03      -----------------------------------MKA------------
A0A8D3BD31_BCL2L11-01      -----------------------------------PPN------------
A0A8D0D024_BCL2L11-01      -----------------------------------MKA------------
A0A3B4V919_BCL2L11-01      -----------------------------------MKA------------
A0A3B4XZH1_BCL2L11-01      -----------------------------------MKA------------
A0A8C3MHM7_BCL2L11-01      ------------------------------------AQ------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      -----------------------------------MSV------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      -----------------------------------ANR------------
A0A3Q1CI15_BCL2L11-01      -----------------------------------PTK------------
A0A3Q1ELG4_BCL2L11-01      -----------------------------------SSS------------
A0A669C520_BCL2L11-01      -----------------------------------YLFENADMQADCGLR
A0A3Q3K6I5_BCL2L11-01      -----------------------------------MH-------------
A0A3Q2SZH6_BCL2L11-01      -----------------------------------MV-------------
A0A3B3VNE0_BCL2L11-01      -----------------------------------M--------------
A0A671W556_BCL2L11-01      -----------------------------------MQ-------------
A0A673CKA1_BCL2L11-01      -----------------------------------VA-------------
A0A667ZMY7_BCL2L11-01      -----------------------------------L--------------
A0A3Q3B113_BCL2L11-01      -----------------------------------MR-------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      -----------------------------------MLT------------
A0A4W6ETK4_BCL2L11-02      ---------------------------LCRATD--MQ-------------
A0A3Q3ESW6_BCL2L11-01      -----------------------------------MH-------------
A0A8P4G4W6_BCL2L11-01      -----------------------------------MRK------------
A0A3Q1ICY2_BCL2L11-01      -----------------------------------M--------------
A0A673XGV4_BCL2L11-01      -----------------------------------QN-------------
A0A4W4H3Y1_BCL2L11-01      --------------------------------------------------
A0A4W4H3Y1_BCL2L11-02      --------------------------------------------------
A0A8C8F2F2_BCL2L11-01      -----------------------------------MHG------------
A0A4W5NF23_BCL2L11-01      -----------------------------------MN-------------
A0A3B4BSH7_BCL2L11-01      -----------------------------------M--------------
A0A4W5R3N6_BCL2L11-02      -----------------------------------MTL------------
B2KKY9_BCL2L11-01          -----------------------------------MS-------------
A0A4W5R3N6_BCL2L11-03      -----------------------------------MTL------------
A0A8C1CBG6_BCL2L11-01      -----------------------------------DS-------------
W5UEE7_BCL2L11-01          -----------------------------------MLF------------
A0A3B4BSH7_BCL2L11-03      -----------------------------------M--------------
A0A8C9VIN6_BCL2L11-01      -----------------------------------PLF------------
A0A3B1JXK6_BCL2L11-01      -----------------------------------M--------------
A0A3B4BSH7_BCL2L11-02      -----------------------------------LLS------------
A0A8L0DSD4_BCL2L11-01      -----------------------------------MTL------------
A0A3P8XIA2_BCL2L11-01      -----------------------------------MF-------------
A0A673IWZ7_BCL2L11-01      -----------------------------------MA-------------
A0A8C0B3C7_BCL2L11-01      -----------------------------------MLL------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      -----------------------------------MGP------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          -----------------------------------GMK------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      -----------------------------------DGQ------------
A0A8C0FLD7_BCL2L11-01      -----------------------------------MHI------------
A0A8C3JX57_BCL2L11-01      -----------------------------------CKE------------
A0A8C3DG03_BCL2L11-01      -----------------------------------MLE------------
A0A8C5TVU9_BCL2L11-01      -----------------------------------TYK------------
A0A669QMB4_BCL2L11-01      -----------------------------------MAK------------
A0A8C5IZK3_BCL2L11-01      -----------------------------------MAK------------
A0A8C3TPU0_BCL2L11-01      -----------------------------------MAK------------
A0A8B9MPS6_BCL2L11-01      -----------------------------------MAK------------
A0A8C9EIW6_BCL2L11-01      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-10      -----------------------------------MAK------------
A0A8V0Z3E3_BCL2L11-01      -----------------------------------GMK------------
A0A8B9T738_BCL2L11-02      -----------------------------------GGA------------
A0A8C3BDR3_BCL2L11-01      -----------------------------------MAK------------
A0A8B9VXZ3_BCL2L11-01      -----------------------------------SSS------------
A0A8C2TW35_BCL2L11-01      -----------------------------------MAK------------
U3IW89_BCL2L11-01          -----------------------------------GGA------------
A0A663E970_BCL2L11-01      -----------------------------------MAK------------
A0A8V0Z3R2_BCL2L11-01      -----------------------------------MAK------------
A0A8B9VVW8_BCL2L11-01      -----------------------------------L--------------
A0A8C3BDR3_BCL2L11-02      -----------------------------------MAK------------
A0A663MLZ1_BCL2L11-01      -----------------------------------GSQ------------
A0A8B9EP68_BCL2L11-01      -----------------------------------MKP--------C---
A0A5F8H037_BCL2L11-02      -----------------------------------MAK------------
A0A672TST9_BCL2L11-01      -----------------------------------MAK------------
A0A674H354_BCL2L11-01      -----------------------------------MAK------------
A0A8C5STS5_BCL2L11-02      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-07      -----------------------------------MAK------------
A0A7M4F197_BCL2L11-01      ------------------A-ML-SL--SLQGKKDQMAK------------
A0A8C0UNY9_BCL2L11-01      -----------------------------------XXX------------
A0A671FCV3_BCL2L11-02      -----------------------------------MAK------------
A0A8C4REW7_BCL2L11-02      -----------------------------------MAR------------
A0A8D0C9E7_BCL2L11-02      -----------------------------------MAE------------
A0A5F9C9V3_BCL2L11-01      -----------------------------------MAK------------
A0A8C5QSK2_BCL2L11-01      -----------------------------------MAK------------
A0A4X1VRX9_BCL2L11-05      -----------------------------------MAK------------
A0A8C8SQS1_BCL2L11-01      -----------------------------------MAK------------
A0A8D0C9E7_BCL2L11-01      -----------------------------------MAE------------
A0A671FCV3_BCL2L11-03      -----------------------------------MAK------------
A0A803KLJ9_BCL2L11-02      -----------------------------------MAK------------
A0A6I8NCK5_BCL2L11-04      -----------------------------------MAK------------
A0A8C3X5Q0_BCL2L11-03      -----------------------------------MAK------------
A0A0P6J9X4_BCL2L11-04      -----------------------------------MAK------------
A0A5F5PK35_BCL2L11-02      -----------------------------------MAK------------
A0A8C3RZA1_BCL2L11-01      -----------------------------------MAK------------
A0A803KLJ9_BCL2L11-01      -----------------------------------MAK------------
A0A8D2Q5M7_BCL2L11-01      -----------------------------------MAK------------
A0A8C4REW7_BCL2L11-01      -----------------------------------MAR------------
A0A0P6J9X4_BCL2L11-01      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-01      -----------------------------------MAK------------
A0A6I9LW27_BCL2L11-01      -----------------------------------MAK------------
A0A8C6HGQ3_BCL2L11-02      ------------------P-RS-EG--KGRTKKDQMAK------------
A0A8C2QK28_BCL2L11-02      -----------------------------------MAK------------
G3SU55_BCL2L11-01          -----------------------------------MAK------------
A0A8C4LFQ1_BCL2L11-07      ------------------PRAAEPA--PSLRKKDQMAK------------
A0A8D2MQT6_BCL2L11-01      -----------------------------------MAK------------
A0A8C9JC73_BCL2L11-04      -----------------------------------MAK------------
A0A8C8ZU60_BCL2L11-01      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-08      ------------------L-RS-EG--KARTKKDQMAK------------
A0A2K5NTQ5_BCL2L11-05      -----------------------------------MAK------------
A0A8C3TPU0_BCL2L11-03      -----------------------------------MAK------------
A0A8C0RM03_BCL2L11-02      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C5L6N3_BCL2L11-03      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-05      -----------------------------------MAK------------
A0A8B7EUP7_BCL2L11-06      -----------------------------------MAK------------
A0A1U7SU38_BCL2L11-04      -----------------------------------MAK------------
A0A8D1A276_BCL2L11-01      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C9PPC0_BCL2L11-01      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-02      -----------------------------------MAK------------
A0A8C6HGQ3_BCL2L11-01      ------------------------L--FPCRKKDQMAK------------
A0A8C2P0X3_BCL2L11-02      ------------------A-RC-EGFMEQRRKKDQMAK------------
A0A8B9QMZ1_BCL2L11-01      ------------------P-LS-LS--PRRRPGAPMAK------------
A0A5F5PK35_BCL2L11-05      --------------------RS-NQ--LVLKKKDQMAK------------
A0A8B7EUP7_BCL2L11-05      -----------------------------------MAK------------
A0A0P6J9X4_BCL2L11-03      ------------------L-RS-EG--KGRTKKDQMAK------------
A0A7N4NUH6_BCL2L11-03      -----------------------------------MAK------------
A0A8C3FX85_BCL2L11-02      ---------------------------FFAGKKDQMAK------------
A0A0P6J9X4_BCL2L11-05      -----------------------------------MAK------------
A0A4X1VMQ3_BCL2L11-03      -----------------------------------MAK------------
A0A8I5ZK47_BCL2L11-03      ------------------L-RS-EG--KGRTKKDQMAK------------
A0A8C3TPU0_BCL2L11-02      -----------------------------------MAK------------
F7HHA1_BCL2L11-02          ------------------L-RS-EG--KARTKKDQMAK------------
A0A8I3N1T0_BCL2L11-03      ------------------R-RS-EG--KGRTKKDQMAK------------
O54918_BCL2L11-03          -----------------------------------MAK------------
A0A7N5JE15_BCL2L11-02      ------------------L-TL-GL--RNARKKDQMAK------------
A0A4X2L9J9_BCL2L11-01      -----------------------------------MAK------------
A0A7N5JE15_BCL2L11-03      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C3TPU0_BCL2L11-04      -----------------------------------MAK------------
A0A8C9NMA1_BCL2L11-01      -----------------------------------VEG------------
A0A7M4F197_BCL2L11-02      -----------------------LW--KKAGKKDQMAK------------
A0A8C0S6I7_BCL2L11-03      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A7N5JE15_BCL2L11-04      ---------------L--------S--KEHIKKDQMAK------------
A0A8I3N1T0_BCL2L11-01      ------------------L-TL-GL--RNARKKDQMAK------------
A0A3Q7S5V2_BCL2L11-01      PVASGCGWDLDVRAALGEE-KG-GI--CGGRKKDQMAK------------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      --------------------HV-AL--GRRQEKDQMAK------------
A0A8C3DC27_BCL2L11-01      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-10      -----------------------------------MAK------------
A0A8C4TR55_BCL2L11-01      -----------------------------------RRR------------
A0A0C4DH20_BCL2L11-12      -----------------------------------MAK------------
K7GA86_BCL2L11-01          ------------------A-SY-SL---DAGKGDQMAK------------
A0A8I5ZK47_BCL2L11-01      ------------------L-IL-GL--RNARKKDQMAK------------
A0A8C2UYE1_BCL2L11-02      ------------------L-IL-EL--RSARKKDQMAK------------
A0A8C5L6N3_BCL2L11-01      -----------------------------------MAK------------
A0A8C8Y6N0_BCL2L11-03      -----------------------------------MAK------------
A0A8B9T738_BCL2L11-01      -----------------------------------GGA------------
A0A7N5JE15_BCL2L11-07      -----------------------------------MAK------------
A0A673SRF7_BCL2L11-04      -----------------------------------MAK------------
A0A6I9LW27_BCL2L11-03      -----------------------------------MAK------------
A0A8C2P0X3_BCL2L11-04      --------------------G--LS--GGSRKKDQMAK------------
A0A452U4S4_BCL2L11-01      -----------------------------------MAK------------
A0A0D9RWE0_BCL2L11-01      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-09      -----------------------------------MAK------------
A0A5F8H037_BCL2L11-01      -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-09      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-08      -----------------------------------MAK------------
A0A7N4NUH6_BCL2L11-01      -----------------------------------MAK------------
A0A8B7EUP7_BCL2L11-07      -----------------------------------MAK------------
A0A8C2P0X3_BCL2L11-05      --------------------G--LS--GGSRKKDQMAK------------
A0A8C6QXX9_BCL2L11-03      -----------------------------------MAK------------
A0A1U7SU38_BCL2L11-07      -----------------------------------MAK------------
A0A6I8NCK5_BCL2L11-01      -----------------------------------MAK------------
A0A8B9YZT6_BCL2L11-01      -----------------------------------MAK------------
A0A4X1VMQ3_BCL2L11-05      -----------------------------------MAK------------
A0A0P6J9X4_BCL2L11-02      --------------------R--CC--APARKKDQMAK------------
A0A6I8NCK5_BCL2L11-03      -----------------------------------MAK------------
A0A6I8NCK5_BCL2L11-05      -----------------------------------MAK------------
A0A673SRF7_BCL2L11-02      -----------------------------------MAK------------
A0A7N5JE15_BCL2L11-01      -----------------------------------MAK------------
A0A8C4LFQ1_BCL2L11-01      -----------------------------------MAK------------
A0A2J8SGU7_BCL2L11-06      -----------------------------------MAK------------
A0A7N5JE15_BCL2L11-06      -----------------------------------MAK------------
A0A7N5JE15_BCL2L11-05      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-03      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-09      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-08      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-07      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-06      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-04      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-02      -----------------------------------MAK------------
A0A663E983_BCL2L11-01      -----------------------------------ITQ------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      -----------------------------------MAK------------
A0A8B8Z6B1_BCL2L11-01      -----------------------------------MAK------------
A0A8B8Z6B1_BCL2L11-02      -----------------------------------MAK------------
A0A8B8Z6B1_BCL2L11-03      -----------------------------------MAK------------
L8IVA4_BCL2L11-01          -----------------------------------MAK------------
L8IVA4_BCL2L11-02          -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-04      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-05      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-06      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-07      -----------------------------------MAK------------
A0A2R8M6L7_BCL2L11-03      -----------------------------------MAK------------
A0A8C0L5G0_BCL2L11-02      -----------------------------------MAK------------
A0A8C0L5G0_BCL2L11-01      -----------------------------------MAK------------
A0A8C0NKD6_BCL2L11-04      -----------------------------------MAK------------
A0A8C0NKD6_BCL2L11-03      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C0NKD6_BCL2L11-02      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C0S6I7_BCL2L11-02      -----------------------------------MAK------------
A0A8C0S6I7_BCL2L11-04      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C0S6I7_BCL2L11-01      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A452FCR6_BCL2L11-01      -----------------------------------MAK------------
A0A452FCR6_BCL2L11-02      -----------------------------------MAK------------
A0A8C2P0X3_BCL2L11-01      -----------------------------------MAK------------
A0A8C2P0X3_BCL2L11-03      -----------------------------------MAK------------
A0A3G3M2M0_BCL2L11-01      -----------------------------------MS-------------
A0A1U7SU38_BCL2L11-03      -----------------------------------MAK------------
A0A1U7SU38_BCL2L11-06      -----------------------------------MAK------------
A0A1U7SU38_BCL2L11-05      -----------------------------------MAK------------
A0A1U7SU38_BCL2L11-01      -----------------------------------MAK------------
A0A1U7SU38_BCL2L11-02      -----------------------------------MAK------------
A0A250YBV9_BCL2L11-01      -----------------------------------MAK------------
A0A250YBV9_BCL2L11-02      -----------------------------------MAK------------
A0A8C3X5Q0_BCL2L11-04      -----------------------------------MAK------------
A0A8C3X5Q0_BCL2L11-01      -----------------------------------MAK------------
A0A8C3X5Q0_BCL2L11-02      -----------------------------------MAK------------
A0A8C3X5Q0_BCL2L11-05      -----------------------------------MAK------------
A0A286XJN2_BCL2L11-02      -----------------------------------MAK------------
A0A286XJN2_BCL2L11-01      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-08      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-10      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-02      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-04      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-05      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-06      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-01      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-03      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-01      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-03      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-06      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-08      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-09      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-10      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-04      -----------------------------------MAK------------
A0A2K5NTQ5_BCL2L11-02      -----------------------------------MAK------------
A0A8C0QRC8_BCL2L11-01      -----------------------------------MAK------------
A0A8C3RZA1_BCL2L11-02      -----------------------------------MAK------------
A0A8C2UYE1_BCL2L11-03      -----------------------------------MAK------------
A0A8C2UYE1_BCL2L11-01      -----------------------------------MAK------------
A0A8C3FX85_BCL2L11-01      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-03      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-10      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-09      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-07      -----------------------------------MAK------------
A0A8C2QK28_BCL2L11-01      -----------------------------------MAK------------
A0A8C3NS85_BCL2L11-01      -----------------------------------MAK------------
A0A8C1CBG6_BCL2L11-02      -----------------------------------MS-------------
A0A8C2L5J3_BCL2L11-02      -----------------------------------LA-------------
A0A8C2L5J3_BCL2L11-01      -----------------------------------MS-------------
B8JK68_BCL2L11-01          -----------------------------------MS-------------
A0A2Y9Q753_BCL2L11-01      -----------------------------------MAK------------
A0A2Y9Q753_BCL2L11-02      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C4LFQ1_BCL2L11-03      -----------------------------------MAK------------
A0A8C4LFQ1_BCL2L11-08      -----------------------------------MAK------------
A0A8C4LFQ1_BCL2L11-06      ------------------R-RS-EG--KGRIKKDQMAK------------
A0A8C4LFQ1_BCL2L11-05      ------------------R-RS-EG--KGRIKKDQMAK------------
A0A8C4LFQ1_BCL2L11-04      ------------------------G--ADHIKKDQMAK------------
A0A8C4LFQ1_BCL2L11-02      -----------------------------------MAK------------
A0A5F5PK35_BCL2L11-04      -----------------------------------MAK------------
A0A8C4TR55_BCL2L11-03      -----------------------------------MAK------------
A0A8C4TR55_BCL2L11-02      -----------------------------------MAK------------
A0A2I2UX96_BCL2L11-04      -----------------------------------MAK------------
A0A2I2UX96_BCL2L11-02      -----------------------------------MAK------------
A0A2I2UX96_BCL2L11-03      -----------------------------------MAK------------
A0A2I2UX96_BCL2L11-01      -----------------------------------MAK------------
A0A8C4VJX6_BCL2L11-02      --------------------HV-AL--GRRQEKDQMAK------------
A0A2I2Y4B3_BCL2L11-03      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-06      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-01      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-02      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-04      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-09      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-08      -----------------------------------MAK------------
A0A0P6J9X4_BCL2L11-06      -----------------------------------MAK------------
A0A0P6J9X4_BCL2L11-07      -----------------------------------MAK------------
A0A0P6J9X4_BCL2L11-08      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-01      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-09      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-07      ------------------L-RS-EG--KARTKKDQMAK------------
A0A0C4DH20_BCL2L11-06      ------------------L-RS-EG--KARTKKDQMAK------------
A0A0C4DH20_BCL2L11-03      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-02      -----------------------------------MAK------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      -----------------------------------MT-------------
A0A287DFJ0_BCL2L11-01      -----------------------------------MAK------------
A0A287DFJ0_BCL2L11-02      -----------------------------------MAK------------
A0A8C5L6N3_BCL2L11-02      -----------------------------------MAK------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      -----------------------------------MAK------------
A0A667H9R7_BCL2L11-04      -----------------------------------MAK------------
A0A667H9R7_BCL2L11-03      -----------------------------------MAK------------
A0A667H9R7_BCL2L11-01      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-04      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-07      ------------------L-RS-EG--KARTKKDQMAK------------
A0A2K5X1Y3_BCL2L11-08      ------------------L-RS-EG--KARTKKDQMAK------------
F7HHA1_BCL2L11-03          ------------------L-RS-EG--KARTKKDQMAK------------
A0A2K6E1Z6_BCL2L11-04      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-09      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-10      -----------------------------------MAK------------
A0A8C5YNZ8_BCL2L11-02      -----------------------------------MAK------------
A0A8C5YNZ8_BCL2L11-01      -----------------------------------MAK------------
A0A8B7EUP7_BCL2L11-04      -----------------------------------MAK------------
A0A8B7EUP7_BCL2L11-01      -----------------------------------MAK------------
A0A8B7EUP7_BCL2L11-02      -----------------------------------MAK------------
A0A8C6C635_BCL2L11-01      -----------------------------------MAK------------
A0A8C6DRY6_BCL2L11-02      -----------------------------------MAK------------
A0A8C6DRY6_BCL2L11-03      -----------------------------------MAK------------
A0A8C6DRY6_BCL2L11-01      -----------------------------------MAK------------
O54918_BCL2L11-06          -----------------------------------MAK------------
O54918_BCL2L11-05          -----------------------------------MAK------------
O54918_BCL2L11-04          -----------------------------------MAK------------
A0A8C6HGQ3_BCL2L11-03      ------------------P-RS-EG--KGRTKKDQMAK------------
M3YDI3_BCL2L11-01          ------------------R-RS-EG--KGRTKKDQMAK------------
A0A8C6VGF4_BCL2L11-01      -----------------------------------MAK------------
A0A8C6QXX9_BCL2L11-01      -----------------------------------MAK------------
A0A8C6QXX9_BCL2L11-02      -----------------------------------MAK------------
A0A8C7BAK5_BCL2L11-01      -----------------------------------MAK------------
A0A8C7BAK5_BCL2L11-04      -----------------------------------MAK------------
A0A8C7BAK5_BCL2L11-03      -----------------------------------MAK------------
A0A8C7BAK5_BCL2L11-02      -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-08      -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-02      -----------------------------------MAK------------
A0A8C7HIL6_BCL2L11-02      -----------------------------------MTL------------
A0A8C7HIL6_BCL2L11-01      -----------------------------------MS-------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      -----------------------------------MS-------------
A0A6I8NCK5_BCL2L11-02      -----------------------------------MAK------------
A0A5F9C9V3_BCL2L11-02      -----------------------------------MAK------------
H0XW23_BCL2L11-01          -----------------------------------MAK------------
A0A8C8AGU8_BCL2L11-01      -----------------------------------FSS------------
A0A2R9BZX9_BCL2L11-05      -----------------------------------MAK------------
A0A8C8Y6N0_BCL2L11-01      -----------------------------------MAK------------
A0A096NYC3_BCL2L11-01      ------------------L-RS-EG--KARTKKDQMAK------------
A0A096NYC3_BCL2L11-02      ------------------L-RS-EG--KARTKKDQMAK------------
A0A6I9LW27_BCL2L11-02      -----------------------------------MAK------------
A0A8C9CBP3_BCL2L11-03      -----------------------------------MAK------------
A0A2Y9T3Y6_BCL2L11-03      -----------------------------------MAK------------
A0A2Y9T3Y6_BCL2L11-02      -----------------------------------MAK------------
A0A2Y9T3Y6_BCL2L11-01      -----------------------------------MAK------------
A0A8C9I5G9_BCL2L11-06      -----------------------------------MAK------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      -----------------------------------MAK------------
A0A3B3YII5_BCL2L11-02      -----------------------------------M--------------
A0A2J8SGU7_BCL2L11-05      -----------------------------------MAK------------
A0A2J8SGU7_BCL2L11-02      -----------------------------------MAK------------
A0A2J8SGU7_BCL2L11-01      ------------------L-RS-EG--KAQTKKDQMAK------------
A0A8C8ZU60_BCL2L11-02      -----------------------------------MAK------------
A0A8C8ZU60_BCL2L11-04      -----------------------------------MAK------------
A0A8C8ZU60_BCL2L11-03      -----------------------------------MAK------------
A0A2K6GE22_BCL2L11-04      -----------------------------------MAK------------
A0A2K6GE22_BCL2L11-05      -----------------------------------MAK------------
A0A2K6GE22_BCL2L11-02      -----------------------------------MAK------------
A0A2K6GE22_BCL2L11-06      -----------------------------------MAK------------
A0A2K6GE22_BCL2L11-01      -----------------------------------MAK------------
A0A2K6GE22_BCL2L11-03      -----------------------------------MAK------------
A0A670Y3D3_BCL2L11-01      -----------------------------------MAK------------
A0A8I5ZK47_BCL2L11-04      ------------------L-RS-EG--KGRTKKDQMAK------------
A0A8I5ZK47_BCL2L11-02      -----------------------------------MAK------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      -----------------------------------MAK------------
A0A671FCV3_BCL2L11-04      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-01      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-05      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-04      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-09      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-07      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-06      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-03      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-02      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-09      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-10      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-05      -----------------------------------MAK------------
A0A673WET2_BCL2L11-01      -----------------------------------MS-------------
A0A7N4NUH6_BCL2L11-02      -----------------------------------MAK------------
A0A7N4NUH6_BCL2L11-04      -----------------------------------MAK------------
A0A8D2B0V4_BCL2L11-02      -----------------------------------MAK------------
A0A8D2B0V4_BCL2L11-01      -----------------------------------MAK------------
A0A8D2D0L1_BCL2L11-01      -----------------------------------MAK------------
A0A671M057_BCL2L11-01      -----------------------------------MS-------------
A0A671SJ75_BCL2L11-01      -----------------------------------VS-------------
A0A672L1R2_BCL2L11-01      -----------------------------------MS-------------
A0A672PQD1_BCL2L11-01      -----------------------------------MS-------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      -----------------------------------MAK------------
A0A8D0H1T5_BCL2L11-01      -----------------------------------MAK------------
A0A673SRF7_BCL2L11-03      -----------------------------------MAK------------
A0A673SRF7_BCL2L11-01      -----------------------------------MAK------------
A0A4X1VMQ3_BCL2L11-01      -----------------------------------MAK------------
A0A4X1VMQ3_BCL2L11-02      -----------------------------------MAK------------
A0A4X1VMQ3_BCL2L11-04      -----------------------------------MAK------------
A0A4X1VRX9_BCL2L11-01      -----------------------------------MAK------------
C1KGB8_BCL2L11-01          -----------------------------------MAK------------
A0A674IAI8_BCL2L11-01      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-05      -----------------------------------MAK------------
A0A452SBG5_BCL2L11-01      -----------------------------------MAK------------
Q3KPZ6_BCL2L11-01          -----------------------------------MAK------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      -----------------------------------MAK------------
A0A8C0RM03_BCL2L11-03      -----------------------------------MAK------------
A0A8C0S6I7_BCL2L11-05      -----------------------------------MAK------------
A0A8I3N1T0_BCL2L11-02      -----------------------------------MAK------------
A0A2K5CA52_BCL2L11-01      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-04      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-01      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-08      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-06      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-07      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-02      -----------------------------------MAK------------
A0A2K6TRJ7_BCL2L11-03      -----------------------------------MAK------------
A0A8C9CBP3_BCL2L11-02      -----------------------------------MAK------------
A0A8C9CBP3_BCL2L11-01      -----------------------------------MAK------------
A0A8C6C635_BCL2L11-03      -----------------------------------MAK------------
A0A8C9CBP3_BCL2L11-04      -----------------------------------MAK------------
A0A2K5Q1U2_BCL2L11-07      -----------------------------------MAK------------
A0A3Q7S5V2_BCL2L11-02      -----------------------------------MAK------------
A0A8C0RM03_BCL2L11-04      -----------------------------------MAK------------
A0A8C0S6I7_BCL2L11-06      -----------------------------------MAK------------
A0A8I3N1T0_BCL2L11-04      -----------------------------------MAK------------
A0A8C0RM03_BCL2L11-01      ------------------R-RS-EG--KGRTKKDQMAK------------
A0A6P3TPJ5_BCL2L11-01      -----------------------------------MAK------------
A0A286XJN2_BCL2L11-03      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-01      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-01      -----------------------------------MAK------------
F7HHA1_BCL2L11-01          -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-01      -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-03      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-01      -----------------------------------MAK------------
A0A8C9I5G9_BCL2L11-01      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-01      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-05      -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-05      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-03      -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-03      -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-02      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-01      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-05      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-07      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-10      -----------------------------------MAK------------
O43521_BCL2L11-10          -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-07      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-05      -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-04      -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-07      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-06      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-06      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-06      -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-08      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-06      -----------------------------------MAK------------
A0A096NYC3_BCL2L11-04      -----------------------------------MAK------------
A0A8C9I5G9_BCL2L11-04      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-04      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-03      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-07      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-08      -----------------------------------MAK------------
A0A2I2Y4B3_BCL2L11-10      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-13      -----------------------------------MAK------------
O43521_BCL2L11-13          -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-09      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-08      -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-07      -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-10      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-09      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-05      -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-10      -----------------------------------MAK------------
A0A096NYC3_BCL2L11-06      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-07      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-04      -----------------------------------MAK------------
A0A2K5X1Y3_BCL2L11-02      -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-06      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-04      -----------------------------------MAK------------
A0A096NYC3_BCL2L11-03      -----------------------------------MAK------------
A0A8C9I5G9_BCL2L11-03      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-03      -----------------------------------MAK------------
A0A2K5HZ87_BCL2L11-02      -----------------------------------MAK------------
A0A2K6E1Z6_BCL2L11-02      -----------------------------------MAK------------
A0A2K5Z7V3_BCL2L11-02      -----------------------------------MAK------------
A0A8C9I5G9_BCL2L11-02      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-03      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-02      -----------------------------------MAK------------
A0A8C9I5G9_BCL2L11-05      -----------------------------------MAK------------
A0A2K6KJM8_BCL2L11-08      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-08      -----------------------------------MAK------------
A0A8C6C635_BCL2L11-02      -----------------------------------MAK------------
A0A5F5PK35_BCL2L11-01      -----------------------------------MAK------------
A0A5F5PK35_BCL2L11-03      -----------------------------------MAK------------
A0A667H9R7_BCL2L11-05      -----------------------------------MAK------------
A0A8C8Y6N0_BCL2L11-04      -----------------------------------MAK------------
A0A8C9JC73_BCL2L11-06      -----------------------------------MAK------------
A0A667H9R7_BCL2L11-02      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-11      -----------------------------------MAK------------
O43521_BCL2L11-11          -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-06      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-05      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-05      -----------------------------------MAK------------
O43521_BCL2L11-05          -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-01      -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-01      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-03      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-04      -----------------------------------MAK------------
O43521_BCL2L11-04          -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-03      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-04      -----------------------------------MAK------------
A0A2J8SGU7_BCL2L11-04      -----------------------------------MAK------------
A0A0C4DH20_BCL2L11-14      -----------------------------------MAK------------
O43521_BCL2L11-14          -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-06      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-08      -----------------------------------MAK------------
A0A2I3GAA1_BCL2L11-05      -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-08      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-07      -----------------------------------MAK------------
A0A2J8SGU7_BCL2L11-03      -----------------------------------MAK------------
O43521_BCL2L11-01          -----------------------------------MAK------------
O43521_BCL2L11-12          -----------------------------------MAK------------
O43521_BCL2L11-09          -----------------------------------MAK------------
O43521_BCL2L11-07          ------------------L-RS-EG--KARTKKDQMAK------------
O43521_BCL2L11-06          ------------------L-RS-EG--KARTKKDQMAK------------
O43521_BCL2L11-03          -----------------------------------MAK------------
A0A2R9BZX9_BCL2L11-04      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-10      -----------------------------------MAK------------
O43521_BCL2L11-08          -----------------------------------MAK------------
O43521_BCL2L11-02          -----------------------------------MAK------------
A0A8D2KQ57_BCL2L11-02      -----------------------------------MAK------------
A0A8D2KQ57_BCL2L11-01      -----------------------------------MAK------------
A0A8C8Y6N0_BCL2L11-02      -----------------------------------MAK------------
A0A8C9JC73_BCL2L11-05      -----------------------------------MAK------------
A0A8C9JC73_BCL2L11-03      -----------------------------------MAK------------
A0A096NYC3_BCL2L11-05      -----------------------------------MAK------------
A0A8D2E0B6_BCL2L11-06      -----------------------------------MAK------------
A0A8B7EUP7_BCL2L11-03      -----------------------------------MAK------------
A0A2I3S5F6_BCL2L11-02      -----------------------------------MAK------------
A0A8C9JC73_BCL2L11-01      -----------------------------------MAK------------
A0A8C9JC73_BCL2L11-02      -----------------------------------MAK------------
A0A3B3YII5_BCL2L11-01      -----------------------------------M--------------
A0A2K6KJM8_BCL2L11-02      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-05      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-04      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-10      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-09      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-07      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-06      -----------------------------------MAK------------
A0A2K6QIJ1_BCL2L11-01      -----------------------------------MAK------------
A0A8D0C9E7_BCL2L11-03      -----------------------------------MAE------------
A0A8D0C9E7_BCL2L11-04      -----------------------------------MAE------------
A0A4X1VRX9_BCL2L11-02      -----------------------------------MAK------------
A0A8D0JJW3_BCL2L11-04      -----------------------------------MAK------------
A0A8D0JTL2_BCL2L11-05      -----------------------------------MAK------------
A0A8D1A276_BCL2L11-02      -----------------------------------MAK------------
A0A4X1VRX9_BCL2L11-06      -----------------------------------MAK------------
A0A8D0JJW3_BCL2L11-02      -----------------------------------MAK------------
A0A8D0JTL2_BCL2L11-01      -----------------------------------MAK------------
A0A8D0JTL2_BCL2L11-02      -----------------------------------MAK------------
A0A4X1VRX9_BCL2L11-03      -----------------------------------MAK------------
A0A8D0JJW3_BCL2L11-01      -----------------------------------MAK------------
A0A8D0JTL2_BCL2L11-04      -----------------------------------MAK------------
A0A8D1A276_BCL2L11-05      -----------------------------------MAK------------
A0A4X1VRX9_BCL2L11-04      -----------------------------------MAK------------
A0A8D0JJW3_BCL2L11-03      -----------------------------------MAK------------
A0A8D0JTL2_BCL2L11-03      -----------------------------------MAK------------
A0A8D1A276_BCL2L11-04      -----------------------------------MAK------------
A0A8D0JJW3_BCL2L11-06      -----------------------------------MAK------------
A0A8D1A276_BCL2L11-03      -----------------------------------MAK------------
A0A8D0JJW3_BCL2L11-05      -----------------------------------MAK------------
A0A803KLJ9_BCL2L11-03      -----------------------------------MAK------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      -----------G-----------VV-K-E--------------------Y
A0A4W3IWD3_BCL2L11-03      -----------Q-----------FQ-FHT--------------------L
M3XHJ5_BCL2L11-01          -----------E-ESLQFDKDQGTS-DVI--------------------S
A0A3B5M375_BCL2L11-01      -----------V-----------T--------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      -----------I-----------LL-TIP-C------------------S
A0A803WCD8_BCL2L11-01      -----------G-----------PG-RVG--------------------S
A0A4W6ETK4_BCL2L11-03      -----------Q-----------AD-GAALF------IQQTT-K--PV-R
A0A8D3BD31_BCL2L11-01      -----------R-----------SD-GALTA------REESG--------
A0A8D0D024_BCL2L11-01      -----------Q-----------TD-GAALV------IQQTT-K--PV-R
A0A3B4V919_BCL2L11-01      -----------Q-----------AD-GAALF------IQQTT-K--PV-R
A0A3B4XZH1_BCL2L11-01      -----------Q-----------AD-GAALF------IQQTT-K--PV-R
A0A8C3MHM7_BCL2L11-01      -----------V-----------PP-VSP--------------------S
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      -----------W--------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      -----------T-----------PS-LVG--------------------P
A0A3Q1CI15_BCL2L11-01      -----------S-----------G-------------------------P
A0A3Q1ELG4_BCL2L11-01      -----------A-----------AS-PAA--------------------P
A0A669C520_BCL2L11-01      IYFWLFLCDAAE-----------VT-LGL--------------------P
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------T-----------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      -----------V--------------T-----------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      -----------K-----------QK-D-----------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      -------------------------------------------K--IYKK
A0A4W4H3Y1_BCL2L11-01      -----------------------------------------------R-I
A0A4W4H3Y1_BCL2L11-02      -------------------------------------------------I
A0A8C8F2F2_BCL2L11-01      -----------Q-----------IYIYFL-N------SLTLILD-LSY-R
A0A4W5NF23_BCL2L11-01      -------------------------------------------H------
A0A3B4BSH7_BCL2L11-01      -----------------------------------------------S-R
A0A4W5R3N6_BCL2L11-02      -----------H-----------RQ-NNK-N------SLTLILD-LSY-R
B2KKY9_BCL2L11-01          -------------------------------------------D--TS-R
A0A4W5R3N6_BCL2L11-03      -----------H-----------RQ-NNK-N------SLTLILD-LSY-R
A0A8C1CBG6_BCL2L11-01      -------------------------------------------D--TA-R
W5UEE7_BCL2L11-01          -----------A-----------RR-RRF-FFCPWSPEAVCPRN--MS-K
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      -----------A-----------RR-KC--C------SQQFAAD---N-G
A0A3B1JXK6_BCL2L11-01      -----------------------------------------------S-R
A0A3B4BSH7_BCL2L11-02      -----------A-----------RK-ARF-SVCPCSSPEDRIHHLPHY-L
A0A8L0DSD4_BCL2L11-01      -----------H-----------RQ-NNK-N------SLTLILD-LSY-R
A0A3P8XIA2_BCL2L11-01      -------------------------------------------D--SS-R
A0A673IWZ7_BCL2L11-01      -------------------------------------------D-STI-L
A0A8C0B3C7_BCL2L11-01      -----------RGELSRFP----PT-DGK--------------------S
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      -----------G-----------GE-RRR--------------------E
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          -----------S-----------P--EVC--------------------S
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      -----------A-----------AP-EVK--------------------A
A0A8C0FLD7_BCL2L11-01      -----------L-----------R--DKS--------------------H
A0A8C3JX57_BCL2L11-01      -----------V-----------Q--------------------------
A0A8C3DG03_BCL2L11-01      -----------L-----------D--------------------------
A0A8C5TVU9_BCL2L11-01      -----------S-----------N--------------------------
A0A669QMB4_BCL2L11-01      -----------Q-----------PP-EAK--------------------A
A0A8C5IZK3_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8C3TPU0_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8B9MPS6_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8C9EIW6_BCL2L11-01      -----------Q-----------PP-EAK--------------------A
A0A2K5CA52_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A8V0Z3E3_BCL2L11-01      -----------S-----------PQ-VCS--------------------E
A0A8B9T738_BCL2L11-02      -----------G-----------KH-GAG--------------------T
A0A8C3BDR3_BCL2L11-01      -----------Q-----------PP-EAK--------------------A
A0A8B9VXZ3_BCL2L11-01      -----------S-----------PS-SSS--------------------A
A0A8C2TW35_BCL2L11-01      -----------Q-----------PP-EAK--------------------A
U3IW89_BCL2L11-01          -----------G-----------KH-GAG--------------------T
A0A663E970_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8V0Z3R2_BCL2L11-01      -----------Q-----------PP-EAK--------------------A
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      -----------Q-----------PP-EAK--------------------A
A0A663MLZ1_BCL2L11-01      -----------A--------------------------------------
A0A8B9EP68_BCL2L11-01      -----------Q-----------PP-PGP--------------------S
A0A5F8H037_BCL2L11-02      -----------Q-----------PS-DLN--------------------S
A0A672TST9_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A674H354_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8C5STS5_BCL2L11-02      -----------Q-----------SP-DLN--------------------S
A0A2K5NTQ5_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A7M4F197_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A8C0UNY9_BCL2L11-01      -----------X-----------XX-XGG--------------------R
A0A671FCV3_BCL2L11-02      -----------Q-----------PS-DAS--------------------S
A0A8C4REW7_BCL2L11-02      -----------P-----------PS-DLN--------------------S
A0A8D0C9E7_BCL2L11-02      -----------Q-----------PP-SLS--------------------S
A0A5F9C9V3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C5QSK2_BCL2L11-01      -----------Q-----------PS-VLS--------------------P
A0A4X1VRX9_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C8SQS1_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A8D0C9E7_BCL2L11-01      -----------Q-----------PP-SLS--------------------S
A0A671FCV3_BCL2L11-03      -----------Q-----------PS-DAS--------------------S
A0A803KLJ9_BCL2L11-02      -----------Q-----------PS-VLS--------------------P
A0A6I8NCK5_BCL2L11-04      -----------Q-----------PS-DLN--------------------S
A0A8C3X5Q0_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A0P6J9X4_BCL2L11-04      -----------Q-----------PS-DVS--------------------C
A0A5F5PK35_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C3RZA1_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A803KLJ9_BCL2L11-01      -----------Q-----------PS-VLS--------------------P
A0A8D2Q5M7_BCL2L11-01      -----------Q-----------SS-DLT--------------------S
A0A8C4REW7_BCL2L11-01      -----------P-----------PS-DLN--------------------S
A0A0P6J9X4_BCL2L11-01      -----------Q-----------PS-DVS--------------------C
A0A2R8M6L7_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A6I9LW27_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C6HGQ3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C2QK28_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
G3SU55_BCL2L11-01          -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A8D2MQT6_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8C9JC73_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C8ZU60_BCL2L11-01      -----------Q-----------PS-DVG--------------------S
A0A2R8M6L7_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C3TPU0_BCL2L11-03      -----------Q-----------PP-EVK--------------------A
A0A8C0RM03_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C5L6N3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8B7EUP7_BCL2L11-06      -----------Q-----------PS-DVG--------------------S
A0A1U7SU38_BCL2L11-04      -----------Q-----------PS-VVS--------------------S
A0A8D1A276_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C9PPC0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2R8M6L7_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C6HGQ3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C2P0X3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8B9QMZ1_BCL2L11-01      -----------Q-----------AA-DVN--------------------S
A0A5F5PK35_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8B7EUP7_BCL2L11-05      -----------Q-----------PS-DVG--------------------S
A0A0P6J9X4_BCL2L11-03      -----------Q-----------PS-DVS--------------------C
A0A7N4NUH6_BCL2L11-03      -----------Q-----------PS-DLN--------------------S
A0A8C3FX85_BCL2L11-02      -----------Q-----------SS-DLN--------------------S
A0A0P6J9X4_BCL2L11-05      -----------Q-----------PS-DVS--------------------C
A0A4X1VMQ3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8I5ZK47_BCL2L11-03      -----------Q-----------PS-DVN--------------------S
A0A8C3TPU0_BCL2L11-02      -----------Q-----------PP-EVK--------------------A
F7HHA1_BCL2L11-02          -----------Q-----------PS-DVS--------------------S
A0A8I3N1T0_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
O54918_BCL2L11-03          -----------Q-----------PS-DVS--------------------S
A0A7N5JE15_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A4X2L9J9_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A7N5JE15_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C3TPU0_BCL2L11-04      -----------Q-----------PP-EVK--------------------A
A0A8C9NMA1_BCL2L11-01      -----------W-----------IP-NPG--------------------A
A0A7M4F197_BCL2L11-02      -----------Q-----------PS-DLN--------------------S
A0A8C0S6I7_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A7N5JE15_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8I3N1T0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A3Q7S5V2_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A8C3DC27_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A2K6KJM8_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A8C4TR55_BCL2L11-01      -----------R-----------RR-ARG--------------------R
A0A0C4DH20_BCL2L11-12      -----------Q-----------PS-DVS--------------------S
K7GA86_BCL2L11-01          -----------Q-----------PS-DLN--------------------S
A0A8I5ZK47_BCL2L11-01      -----------Q-----------PS-DVN--------------------S
A0A8C2UYE1_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C5L6N3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C8Y6N0_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8B9T738_BCL2L11-01      -----------G-----------KH-GAG--------------------T
A0A7N5JE15_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A673SRF7_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A6I9LW27_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C2P0X3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A452U4S4_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A0D9RWE0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A5F8H037_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A2R9BZX9_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A7N4NUH6_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A8B7EUP7_BCL2L11-07      -----------Q-----------PS-DVG--------------------S
A0A8C2P0X3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C6QXX9_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A1U7SU38_BCL2L11-07      -----------Q-----------PS-VVS--------------------S
A0A6I8NCK5_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A8B9YZT6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A4X1VMQ3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A0P6J9X4_BCL2L11-02      -----------Q-----------PS-DVS--------------------C
A0A6I8NCK5_BCL2L11-03      -----------Q-----------PS-DLN--------------------S
A0A6I8NCK5_BCL2L11-05      -----------Q-----------PS-DLN--------------------S
A0A673SRF7_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A7N5JE15_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2J8SGU7_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A7N5JE15_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A7N5JE15_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A663E983_BCL2L11-01      -----------A--------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8B8Z6B1_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8B8Z6B1_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8B8Z6B1_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
L8IVA4_BCL2L11-01          -----------Q-----------PS-DVS--------------------S
L8IVA4_BCL2L11-02          -----------Q-----------PS-DVS--------------------S
A0A2R8M6L7_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2R8M6L7_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2R8M6L7_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2R8M6L7_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2R8M6L7_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C0L5G0_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C0L5G0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C0NKD6_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C0NKD6_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C0NKD6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C0S6I7_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C0S6I7_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C0S6I7_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A452FCR6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A452FCR6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C2P0X3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C2P0X3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A3G3M2M0_BCL2L11-01      -------------------------------------------D-TS--R
A0A1U7SU38_BCL2L11-03      -----------Q-----------PS-VVS--------------------S
A0A1U7SU38_BCL2L11-06      -----------Q-----------PS-VVS--------------------S
A0A1U7SU38_BCL2L11-05      -----------Q-----------PS-VVS--------------------S
A0A1U7SU38_BCL2L11-01      -----------Q-----------PS-VVS--------------------S
A0A1U7SU38_BCL2L11-02      -----------Q-----------PS-VVS--------------------S
A0A250YBV9_BCL2L11-01      -----------Q-----------PS-DAS--------------------S
A0A250YBV9_BCL2L11-02      -----------Q-----------PS-DAS--------------------S
A0A8C3X5Q0_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C3X5Q0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C3X5Q0_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C3X5Q0_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A286XJN2_BCL2L11-02      -----------Q-----------PS-DVS--------------------C
A0A286XJN2_BCL2L11-01      -----------Q-----------PS-DVS--------------------C
A0A2K5Q1U2_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5NTQ5_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C0QRC8_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A8C3RZA1_BCL2L11-02      -----------Q-----------PS-DLN--------------------S
A0A8C2UYE1_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C2UYE1_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C3FX85_BCL2L11-01      -----------Q-----------SS-DLN--------------------S
A0A2K5HZ87_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A8C2QK28_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C3NS85_BCL2L11-01      -----------Q-----------PP-EVK--------------------A
A0A8C1CBG6_BCL2L11-02      -------------------------------------------D--TS-R
A0A8C2L5J3_BCL2L11-02      -------------------------------------------D--VS-F
A0A8C2L5J3_BCL2L11-01      -------------------------------------------D--TS-R
B8JK68_BCL2L11-01          -------------------------------------------D--TS-R
A0A2Y9Q753_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2Y9Q753_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C4LFQ1_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A5F5PK35_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C4TR55_BCL2L11-03      -----------Q-----------PP-EVK--------------------A
A0A8C4TR55_BCL2L11-02      -----------Q-----------PP-EVK--------------------A
A0A2I2UX96_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2I2UX96_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2I2UX96_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2I2UX96_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C4VJX6_BCL2L11-02      -----------Q-----------PS-DLN--------------------S
A0A2I2Y4B3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A0P6J9X4_BCL2L11-06      -----------Q-----------PS-DVS--------------------C
A0A0P6J9X4_BCL2L11-07      -----------Q-----------PS-DVS--------------------C
A0A0P6J9X4_BCL2L11-08      -----------Q-----------PS-DVS--------------------C
A0A0C4DH20_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      ---------------------------------------------DSS-R
A0A287DFJ0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A287DFJ0_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C5L6N3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      -----------Q-----------SP-DLN--------------------S
A0A667H9R7_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A667H9R7_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A667H9R7_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
F7HHA1_BCL2L11-03          -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A8C5YNZ8_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C5YNZ8_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8B7EUP7_BCL2L11-04      -----------Q-----------PS-DVG--------------------S
A0A8B7EUP7_BCL2L11-01      -----------Q-----------PS-DVG--------------------S
A0A8B7EUP7_BCL2L11-02      -----------Q-----------PS-DVG--------------------S
A0A8C6C635_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C6DRY6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C6DRY6_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C6DRY6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
O54918_BCL2L11-06          -----------Q-----------PS-DVS--------------------S
O54918_BCL2L11-05          -----------Q-----------PS-DVS--------------------S
O54918_BCL2L11-04          -----------Q-----------PS-DVS--------------------S
A0A8C6HGQ3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
M3YDI3_BCL2L11-01          -----------Q-----------PS-DVS--------------------S
A0A8C6VGF4_BCL2L11-01      -----------Q-----------SS-DLN--------------------S
A0A8C6QXX9_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C6QXX9_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C7BAK5_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C7BAK5_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C7BAK5_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C7BAK5_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C7HIL6_BCL2L11-02      -----------H-----------RQ-NNK-N------SLTLILD-LSY-R
A0A8C7HIL6_BCL2L11-01      -------------------------------------------D--SS-R
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      -------------------------------------------D--SS-R
A0A6I8NCK5_BCL2L11-02      -----------Q-----------PS-DLN--------------------S
A0A5F9C9V3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
H0XW23_BCL2L11-01          -----------Q-----------PS-DVG--------------------S
A0A8C8AGU8_BCL2L11-01      -----------Y-----------E--------------------------
A0A2R9BZX9_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C8Y6N0_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A096NYC3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A096NYC3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A6I9LW27_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C9CBP3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2Y9T3Y6_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2Y9T3Y6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2Y9T3Y6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C9I5G9_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      -----------Q-----------SS-DLT--------------------S
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2J8SGU7_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2J8SGU7_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C8ZU60_BCL2L11-02      -----------Q-----------PS-DVG--------------------S
A0A8C8ZU60_BCL2L11-04      -----------Q-----------PS-DVG--------------------S
A0A8C8ZU60_BCL2L11-03      -----------Q-----------PS-DVG--------------------S
A0A2K6GE22_BCL2L11-04      -----------Q-----------PS-DVG--------------------S
A0A2K6GE22_BCL2L11-05      -----------Q-----------PS-DVG--------------------S
A0A2K6GE22_BCL2L11-02      -----------Q-----------PS-DVG--------------------S
A0A2K6GE22_BCL2L11-06      -----------Q-----------PS-DVG--------------------S
A0A2K6GE22_BCL2L11-01      -----------Q-----------PS-DVG--------------------S
A0A2K6GE22_BCL2L11-03      -----------Q-----------PS-DVG--------------------S
A0A670Y3D3_BCL2L11-01      -----------Q-----------SS-DLN--------------------S
A0A8I5ZK47_BCL2L11-04      -----------Q-----------PS-DVN--------------------S
A0A8I5ZK47_BCL2L11-02      -----------Q-----------PS-DVN--------------------S
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      -----------Q-----------PS-DAS--------------------S
A0A671FCV3_BCL2L11-04      -----------Q-----------PS-DAS--------------------S
A0A2K6KJM8_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A673WET2_BCL2L11-01      -------------------------------------------D--SS-R
A0A7N4NUH6_BCL2L11-02      -----------Q-----------PS-DLN--------------------S
A0A7N4NUH6_BCL2L11-04      -----------Q-----------PS-DLN--------------------S
A0A8D2B0V4_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8D2B0V4_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8D2D0L1_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A671M057_BCL2L11-01      -------------------------------------------D--TS-R
A0A671SJ75_BCL2L11-01      -------------------------------------------D-TT---
A0A672L1R2_BCL2L11-01      -------------------------------------------D--TS-R
A0A672PQD1_BCL2L11-01      -------------------------------------------D-TSS-R
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8D0H1T5_BCL2L11-01      -----------Q-----------PS-DLN--------------------S
A0A673SRF7_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A673SRF7_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A4X1VMQ3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A4X1VMQ3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A4X1VMQ3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A4X1VRX9_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
C1KGB8_BCL2L11-01          -----------Q-----------PS-DVS--------------------S
A0A674IAI8_BCL2L11-01      -----------Q-----------SS-DLN--------------------S
A0A8D2E0B6_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A452SBG5_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
Q3KPZ6_BCL2L11-01          -----------Q-----------PS-VLS--------------------P
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C0RM03_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C0S6I7_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8I3N1T0_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K5CA52_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K6TRJ7_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C9CBP3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C9CBP3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C6C635_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C9CBP3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5Q1U2_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A3Q7S5V2_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C0RM03_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C0S6I7_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A8I3N1T0_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C0RM03_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A6P3TPJ5_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A286XJN2_BCL2L11-03      -----------Q-----------PS-DVS--------------------C
A0A2K5HZ87_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
F7HHA1_BCL2L11-01          -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C9I5G9_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8D2E0B6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-10          -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A096NYC3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C9I5G9_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8D2E0B6_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2I2Y4B3_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-13      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-13          -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A096NYC3_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A8D2E0B6_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K5X1Y3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A096NYC3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8C9I5G9_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8D2E0B6_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2K5HZ87_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K6E1Z6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K5Z7V3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C9I5G9_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8D2E0B6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C9I5G9_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K6KJM8_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A8C6C635_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A5F5PK35_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A5F5PK35_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A667H9R7_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C8Y6N0_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8C9JC73_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A667H9R7_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-11      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-11          -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-05          -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-04          -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2J8SGU7_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A0C4DH20_BCL2L11-14      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-14          -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2I3GAA1_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-08      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2J8SGU7_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-01          -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-12          -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-09          -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-07          -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-06          -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-03          -----------Q-----------PS-DVS--------------------S
A0A2R9BZX9_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2I3S5F6_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-08          -----------Q-----------PS-DVS--------------------S
O43521_BCL2L11-02          -----------Q-----------PS-DVS--------------------S
A0A8D2KQ57_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8D2KQ57_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C8Y6N0_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C9JC73_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8C9JC73_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A096NYC3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8D2E0B6_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A8B7EUP7_BCL2L11-03      -----------Q-----------PS-DVG--------------------S
A0A2I3S5F6_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8C9JC73_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8C9JC73_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-10      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-09      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-07      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A2K6QIJ1_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8D0C9E7_BCL2L11-03      -----------Q-----------PP-SLS--------------------S
A0A8D0C9E7_BCL2L11-04      -----------Q-----------PP-SLS--------------------S
A0A4X1VRX9_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8D0JJW3_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8D0JTL2_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A8D1A276_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A4X1VRX9_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A8D0JJW3_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A8D0JTL2_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8D0JTL2_BCL2L11-02      -----------Q-----------PS-DVS--------------------S
A0A4X1VRX9_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8D0JJW3_BCL2L11-01      -----------Q-----------PS-DVS--------------------S
A0A8D0JTL2_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8D1A276_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A4X1VRX9_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8D0JJW3_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8D0JTL2_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8D1A276_BCL2L11-04      -----------Q-----------PS-DVS--------------------S
A0A8D0JJW3_BCL2L11-06      -----------Q-----------PS-DVS--------------------S
A0A8D1A276_BCL2L11-03      -----------Q-----------PS-DVS--------------------S
A0A8D0JJW3_BCL2L11-05      -----------Q-----------PS-DVS--------------------S
A0A803KLJ9_BCL2L11-03      -----------Q-----------PS-VLS--------------------P
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      P--G----------------------------------------------
A0A4W3IWD3_BCL2L11-03      T--D----------------------------------------------
M3XHJ5_BCL2L11-01          E--C----------------------------------------------
A0A3B5M375_BCL2L11-01      --------------------------------------------------
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      V--C----------------------------------------------
A0A803WCD8_BCL2L11-01      G--R----------------------------------------------
A0A4W6ETK4_BCL2L11-03      W--L----------------------------------------------
A0A8D3BD31_BCL2L11-01      G--G----------------------------------------------
A0A8D0D024_BCL2L11-01      W--L----------------------------------------------
A0A3B4V919_BCL2L11-01      W--L----------------------------------------------
A0A3B4XZH1_BCL2L11-01      W--L----------------------------------------------
A0A8C3MHM7_BCL2L11-01      L--C----------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      E--Q----------------------------------------------
A0A3Q1CI15_BCL2L11-01      D--A----------------------------------------------
A0A3Q1ELG4_BCL2L11-01      H-------------------------------------------------
A0A669C520_BCL2L11-01      H-------------------------------------------------
A0A3Q3K6I5_BCL2L11-01      --------------------------------------------------
A0A3Q2SZH6_BCL2L11-01      --------------------------------------------------
A0A3B3VNE0_BCL2L11-01      --------------------------------------------------
A0A671W556_BCL2L11-01      --------------------------------------------------
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      --------------------------------------------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      --------------------------------------------------
A0A4W6ETK4_BCL2L11-02      --------------------------------------------------
A0A3Q3ESW6_BCL2L11-01      --------------------------------------------------
A0A8P4G4W6_BCL2L11-01      --------------------------------------------------
A0A3Q1ICY2_BCL2L11-01      --------------------------------------------------
A0A673XGV4_BCL2L11-01      R--G----------------------------------------------
A0A4W4H3Y1_BCL2L11-01      R--Q----------------------------------------------
A0A4W4H3Y1_BCL2L11-02      R--Q----------------------------------------------
A0A8C8F2F2_BCL2L11-01      P--Q----------------------------------------------
A0A4W5NF23_BCL2L11-01      ---N----------------------------------------------
A0A3B4BSH7_BCL2L11-01      R--S----------------------------------------------
A0A4W5R3N6_BCL2L11-02      Q--Q----------------------------------------------
B2KKY9_BCL2L11-01          E--Q----------------------------------------------
A0A4W5R3N6_BCL2L11-03      Q--Q----------------------------------------------
A0A8C1CBG6_BCL2L11-01      E--Q----------------------------------------------
W5UEE7_BCL2L11-01          R--Q----------------------------------------------
A0A3B4BSH7_BCL2L11-03      --------------------------------------------------
A0A8C9VIN6_BCL2L11-01      R--Q----------------------------------------------
A0A3B1JXK6_BCL2L11-01      P--S----------------------------------------------
A0A3B4BSH7_BCL2L11-02      R--S----------------------------------------------
A0A8L0DSD4_BCL2L11-01      R--Q----------------------------------------------
A0A3P8XIA2_BCL2L11-01      P--Q----------------------------------------------
A0A673IWZ7_BCL2L11-01      K--Q----------------------------------------------
A0A8C0B3C7_BCL2L11-01      F--SLLEAGFLGVQIQLWLSSQYDKTDRFPFSCCALQNGLGRKCENVIKL
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      E--E----------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          E--C----------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      R--R----------------------------------------------
A0A8C0FLD7_BCL2L11-01      LCCI----------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      ---C----------------------------------------------
A0A669QMB4_BCL2L11-01      P--R----------------------------------------------
A0A8C5IZK3_BCL2L11-01      R--R----------------------------------------------
A0A8C3TPU0_BCL2L11-01      R--R----------------------------------------------
A0A8B9MPS6_BCL2L11-01      Q--R----------------------------------------------
A0A8C9EIW6_BCL2L11-01      P--R----------------------------------------------
A0A2K5CA52_BCL2L11-10      E--C----------------------------------------------
A0A8V0Z3E3_BCL2L11-01      C--T----------------------------------------------
A0A8B9T738_BCL2L11-02      G--R----------------------------------------------
A0A8C3BDR3_BCL2L11-01      Q--R----------------------------------------------
A0A8B9VXZ3_BCL2L11-01      A-------------------------------------------------
A0A8C2TW35_BCL2L11-01      P--R----------------------------------------------
U3IW89_BCL2L11-01          G--R----------------------------------------------
A0A663E970_BCL2L11-01      Q--R----------------------------------------------
A0A8V0Z3R2_BCL2L11-01      P--R----------------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      Q--R----------------------------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      R--P----------------------------------------------
A0A5F8H037_BCL2L11-02      E--C----------------------------------------------
A0A672TST9_BCL2L11-01      Q--R----------------------------------------------
A0A674H354_BCL2L11-01      R--R----------------------------------------------
A0A8C5STS5_BCL2L11-02      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-07      E--C----------------------------------------------
A0A7M4F197_BCL2L11-01      K--C----------------------------------------------
A0A8C0UNY9_BCL2L11-01      E--G----------------------------------------------
A0A671FCV3_BCL2L11-02      E--C----------------------------------------------
A0A8C4REW7_BCL2L11-02      E--S----------------------------------------------
A0A8D0C9E7_BCL2L11-02      E--Y----------------------------------------------
A0A5F9C9V3_BCL2L11-01      E--C----------------------------------------------
A0A8C5QSK2_BCL2L11-01      D--S----------------------------------------------
A0A4X1VRX9_BCL2L11-05      E--C----------------------------------------------
A0A8C8SQS1_BCL2L11-01      E--C----------------------------------------------
A0A8D0C9E7_BCL2L11-01      E--Y----------------------------------------------
A0A671FCV3_BCL2L11-03      E--C----------------------------------------------
A0A803KLJ9_BCL2L11-02      D--C----------------------------------------------
A0A6I8NCK5_BCL2L11-04      E--C----------------------------------------------
A0A8C3X5Q0_BCL2L11-03      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-04      E--C----------------------------------------------
A0A5F5PK35_BCL2L11-02      E--C----------------------------------------------
A0A8C3RZA1_BCL2L11-01      E--C----------------------------------------------
A0A803KLJ9_BCL2L11-01      D--C----------------------------------------------
A0A8D2Q5M7_BCL2L11-01      E--C----------------------------------------------
A0A8C4REW7_BCL2L11-01      E--S----------------------------------------------
A0A0P6J9X4_BCL2L11-01      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-01      E--C----------------------------------------------
A0A6I9LW27_BCL2L11-01      E--C----------------------------------------------
A0A8C6HGQ3_BCL2L11-02      E--C----------------------------------------------
A0A8C2QK28_BCL2L11-02      E--C----------------------------------------------
G3SU55_BCL2L11-01          E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-07      E--C----------------------------------------------
A0A8D2MQT6_BCL2L11-01      R--R----------------------------------------------
A0A8C9JC73_BCL2L11-04      E--C----------------------------------------------
A0A8C8ZU60_BCL2L11-01      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-08      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-05      E--C----------------------------------------------
A0A8C3TPU0_BCL2L11-03      R--R----------------------------------------------
A0A8C0RM03_BCL2L11-02      E--C----------------------------------------------
A0A8C5L6N3_BCL2L11-03      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-05      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-06      E--C----------------------------------------------
A0A1U7SU38_BCL2L11-04      E--C----------------------------------------------
A0A8D1A276_BCL2L11-01      E--C----------------------------------------------
A0A8C9PPC0_BCL2L11-01      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-02      E--C----------------------------------------------
A0A8C6HGQ3_BCL2L11-01      E--C----------------------------------------------
A0A8C2P0X3_BCL2L11-02      E--C----------------------------------------------
A0A8B9QMZ1_BCL2L11-01      P--C----------------------------------------------
A0A5F5PK35_BCL2L11-05      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-05      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-03      E--C----------------------------------------------
A0A7N4NUH6_BCL2L11-03      E--C----------------------------------------------
A0A8C3FX85_BCL2L11-02      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-05      E--C----------------------------------------------
A0A4X1VMQ3_BCL2L11-03      E--C----------------------------------------------
A0A8I5ZK47_BCL2L11-03      E--C----------------------------------------------
A0A8C3TPU0_BCL2L11-02      R--R----------------------------------------------
F7HHA1_BCL2L11-02          E--C----------------------------------------------
A0A8I3N1T0_BCL2L11-03      E--C----------------------------------------------
O54918_BCL2L11-03          E--C----------------------------------------------
A0A7N5JE15_BCL2L11-02      E--C----------------------------------------------
A0A4X2L9J9_BCL2L11-01      E--C----------------------------------------------
A0A7N5JE15_BCL2L11-03      E--C----------------------------------------------
A0A8C3TPU0_BCL2L11-04      R--R----------------------------------------------
A0A8C9NMA1_BCL2L11-01      D--V----------------------------------------------
A0A7M4F197_BCL2L11-02      K--C----------------------------------------------
A0A8C0S6I7_BCL2L11-03      E--C----------------------------------------------
A0A7N5JE15_BCL2L11-04      E--C----------------------------------------------
A0A8I3N1T0_BCL2L11-01      E--C----------------------------------------------
A0A3Q7S5V2_BCL2L11-01      E--C----------------------------------------------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      E--C----------------------------------------------
A0A8C3DC27_BCL2L11-01      R--R----------------------------------------------
A0A2K6KJM8_BCL2L11-10      E--C----------------------------------------------
A0A8C4TR55_BCL2L11-01      R--R----------------------------------------------
A0A0C4DH20_BCL2L11-12      E--C----------------------------------------------
K7GA86_BCL2L11-01          E--C----------------------------------------------
A0A8I5ZK47_BCL2L11-01      E--C----------------------------------------------
A0A8C2UYE1_BCL2L11-02      E--C----------------------------------------------
A0A8C5L6N3_BCL2L11-01      E--C----------------------------------------------
A0A8C8Y6N0_BCL2L11-03      E--C----------------------------------------------
A0A8B9T738_BCL2L11-01      G--R----------------------------------------------
A0A7N5JE15_BCL2L11-07      E--C----------------------------------------------
A0A673SRF7_BCL2L11-04      E--C----------------------------------------------
A0A6I9LW27_BCL2L11-03      E--C----------------------------------------------
A0A8C2P0X3_BCL2L11-04      E--C----------------------------------------------
A0A452U4S4_BCL2L11-01      E--C----------------------------------------------
A0A0D9RWE0_BCL2L11-01      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-09      E--C----------------------------------------------
A0A5F8H037_BCL2L11-01      E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-09      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-08      E--C----------------------------------------------
A0A7N4NUH6_BCL2L11-01      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-07      E--C----------------------------------------------
A0A8C2P0X3_BCL2L11-05      E--C----------------------------------------------
A0A8C6QXX9_BCL2L11-03      E--C----------------------------------------------
A0A1U7SU38_BCL2L11-07      E--C----------------------------------------------
A0A6I8NCK5_BCL2L11-01      E--C----------------------------------------------
A0A8B9YZT6_BCL2L11-01      E--C----------------------------------------------
A0A4X1VMQ3_BCL2L11-05      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-02      E--C----------------------------------------------
A0A6I8NCK5_BCL2L11-03      E--C----------------------------------------------
A0A6I8NCK5_BCL2L11-05      E--C----------------------------------------------
A0A673SRF7_BCL2L11-02      E--C----------------------------------------------
A0A7N5JE15_BCL2L11-01      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-01      E--C----------------------------------------------
A0A2J8SGU7_BCL2L11-06      E--C----------------------------------------------
A0A7N5JE15_BCL2L11-06      E--C----------------------------------------------
A0A7N5JE15_BCL2L11-05      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-03      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-09      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-08      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-07      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-06      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-04      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-02      E--C----------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-04      E--C----------------------------------------------
A0A8B8Z6B1_BCL2L11-01      E--C----------------------------------------------
A0A8B8Z6B1_BCL2L11-02      E--C----------------------------------------------
A0A8B8Z6B1_BCL2L11-03      E--C----------------------------------------------
L8IVA4_BCL2L11-01          E--C----------------------------------------------
L8IVA4_BCL2L11-02          E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-04      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-05      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-06      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-07      E--C----------------------------------------------
A0A2R8M6L7_BCL2L11-03      E--C----------------------------------------------
A0A8C0L5G0_BCL2L11-02      E--C----------------------------------------------
A0A8C0L5G0_BCL2L11-01      E--C----------------------------------------------
A0A8C0NKD6_BCL2L11-04      E--C----------------------------------------------
A0A8C0NKD6_BCL2L11-03      E--C----------------------------------------------
A0A8C0NKD6_BCL2L11-02      E--C----------------------------------------------
A0A8C0S6I7_BCL2L11-02      E--C----------------------------------------------
A0A8C0S6I7_BCL2L11-04      E--C----------------------------------------------
A0A8C0S6I7_BCL2L11-01      E--C----------------------------------------------
A0A452FCR6_BCL2L11-01      E--C----------------------------------------------
A0A452FCR6_BCL2L11-02      E--C----------------------------------------------
A0A8C2P0X3_BCL2L11-01      E--C----------------------------------------------
A0A8C2P0X3_BCL2L11-03      E--C----------------------------------------------
A0A3G3M2M0_BCL2L11-01      E--Q----------------------------------------------
A0A1U7SU38_BCL2L11-03      E--C----------------------------------------------
A0A1U7SU38_BCL2L11-06      E--C----------------------------------------------
A0A1U7SU38_BCL2L11-05      E--C----------------------------------------------
A0A1U7SU38_BCL2L11-01      E--C----------------------------------------------
A0A1U7SU38_BCL2L11-02      E--C----------------------------------------------
A0A250YBV9_BCL2L11-01      E--C----------------------------------------------
A0A250YBV9_BCL2L11-02      E--C----------------------------------------------
A0A8C3X5Q0_BCL2L11-04      E--C----------------------------------------------
A0A8C3X5Q0_BCL2L11-01      E--C----------------------------------------------
A0A8C3X5Q0_BCL2L11-02      E--C----------------------------------------------
A0A8C3X5Q0_BCL2L11-05      E--C----------------------------------------------
A0A286XJN2_BCL2L11-02      E--C----------------------------------------------
A0A286XJN2_BCL2L11-01      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-08      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-10      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-02      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-04      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-05      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-06      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-01      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-03      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-01      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-03      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-06      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-08      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-09      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-10      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-04      E--C----------------------------------------------
A0A2K5NTQ5_BCL2L11-02      E--C----------------------------------------------
A0A8C0QRC8_BCL2L11-01      E--C----------------------------------------------
A0A8C3RZA1_BCL2L11-02      E--C----------------------------------------------
A0A8C2UYE1_BCL2L11-03      E--C----------------------------------------------
A0A8C2UYE1_BCL2L11-01      E--C----------------------------------------------
A0A8C3FX85_BCL2L11-01      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-03      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-10      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-09      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-07      E--C----------------------------------------------
A0A8C2QK28_BCL2L11-01      E--C----------------------------------------------
A0A8C3NS85_BCL2L11-01      R--R----------------------------------------------
A0A8C1CBG6_BCL2L11-02      E--Q----------------------------------------------
A0A8C2L5J3_BCL2L11-02      C--Q----------------------------------------------
A0A8C2L5J3_BCL2L11-01      E--Q----------------------------------------------
B8JK68_BCL2L11-01          E--Q----------------------------------------------
A0A2Y9Q753_BCL2L11-01      E--C----------------------------------------------
A0A2Y9Q753_BCL2L11-02      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-03      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-08      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-06      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-05      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-04      E--C----------------------------------------------
A0A8C4LFQ1_BCL2L11-02      E--C----------------------------------------------
A0A5F5PK35_BCL2L11-04      E--C----------------------------------------------
A0A8C4TR55_BCL2L11-03      Q--R----------------------------------------------
A0A8C4TR55_BCL2L11-02      Q--R----------------------------------------------
A0A2I2UX96_BCL2L11-04      E--C----------------------------------------------
A0A2I2UX96_BCL2L11-02      E--C----------------------------------------------
A0A2I2UX96_BCL2L11-03      E--C----------------------------------------------
A0A2I2UX96_BCL2L11-01      E--C----------------------------------------------
A0A8C4VJX6_BCL2L11-02      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-03      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-06      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-01      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-02      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-04      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-09      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-08      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-06      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-07      E--C----------------------------------------------
A0A0P6J9X4_BCL2L11-08      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-01      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-09      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-07      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-06      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-03      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-02      E--C----------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      Q--Q----------------------------------------------
A0A287DFJ0_BCL2L11-01      E--C----------------------------------------------
A0A287DFJ0_BCL2L11-02      E--C----------------------------------------------
A0A8C5L6N3_BCL2L11-02      E--C----------------------------------------------
A0A4W6ETK4_BCL2L11-01      --------------------------------------------------
A0A8C5STS5_BCL2L11-01      E--C----------------------------------------------
A0A667H9R7_BCL2L11-04      E--C----------------------------------------------
A0A667H9R7_BCL2L11-03      E--C----------------------------------------------
A0A667H9R7_BCL2L11-01      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-04      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-07      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-08      E--C----------------------------------------------
F7HHA1_BCL2L11-03          E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-04      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-09      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-10      E--C----------------------------------------------
A0A8C5YNZ8_BCL2L11-02      E--C----------------------------------------------
A0A8C5YNZ8_BCL2L11-01      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-04      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-01      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-02      E--C----------------------------------------------
A0A8C6C635_BCL2L11-01      E--C----------------------------------------------
A0A8C6DRY6_BCL2L11-02      E--C----------------------------------------------
A0A8C6DRY6_BCL2L11-03      E--C----------------------------------------------
A0A8C6DRY6_BCL2L11-01      E--C----------------------------------------------
O54918_BCL2L11-06          E--C----------------------------------------------
O54918_BCL2L11-05          E--C----------------------------------------------
O54918_BCL2L11-04          E--C----------------------------------------------
A0A8C6HGQ3_BCL2L11-03      E--C----------------------------------------------
M3YDI3_BCL2L11-01          E--C----------------------------------------------
A0A8C6VGF4_BCL2L11-01      E--C----------------------------------------------
A0A8C6QXX9_BCL2L11-01      E--C----------------------------------------------
A0A8C6QXX9_BCL2L11-02      E--C----------------------------------------------
A0A8C7BAK5_BCL2L11-01      E--C----------------------------------------------
A0A8C7BAK5_BCL2L11-04      E--C----------------------------------------------
A0A8C7BAK5_BCL2L11-03      E--C----------------------------------------------
A0A8C7BAK5_BCL2L11-02      E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-08      E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-02      E--C----------------------------------------------
A0A8C7HIL6_BCL2L11-02      R--Q----------------------------------------------
A0A8C7HIL6_BCL2L11-01      R--Q----------------------------------------------
A0A8C7L4D1_BCL2L11-01      --------------------------------------------------
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      R--Q----------------------------------------------
A0A6I8NCK5_BCL2L11-02      E--C----------------------------------------------
A0A5F9C9V3_BCL2L11-02      E--C----------------------------------------------
H0XW23_BCL2L11-01          E--C----------------------------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      E--C----------------------------------------------
A0A8C8Y6N0_BCL2L11-01      E--C----------------------------------------------
A0A096NYC3_BCL2L11-01      E--C----------------------------------------------
A0A096NYC3_BCL2L11-02      E--C----------------------------------------------
A0A6I9LW27_BCL2L11-02      E--C----------------------------------------------
A0A8C9CBP3_BCL2L11-03      E--C----------------------------------------------
A0A2Y9T3Y6_BCL2L11-03      E--C----------------------------------------------
A0A2Y9T3Y6_BCL2L11-02      E--C----------------------------------------------
A0A2Y9T3Y6_BCL2L11-01      E--C----------------------------------------------
A0A8C9I5G9_BCL2L11-06      E--C----------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      E--C----------------------------------------------
A0A3B3YII5_BCL2L11-02      --------------------------------------------------
A0A2J8SGU7_BCL2L11-05      E--C----------------------------------------------
A0A2J8SGU7_BCL2L11-02      E--C----------------------------------------------
A0A2J8SGU7_BCL2L11-01      E--C----------------------------------------------
A0A8C8ZU60_BCL2L11-02      E--C----------------------------------------------
A0A8C8ZU60_BCL2L11-04      E--C----------------------------------------------
A0A8C8ZU60_BCL2L11-03      E--C----------------------------------------------
A0A2K6GE22_BCL2L11-04      E--C----------------------------------------------
A0A2K6GE22_BCL2L11-05      E--C----------------------------------------------
A0A2K6GE22_BCL2L11-02      E--C----------------------------------------------
A0A2K6GE22_BCL2L11-06      E--C----------------------------------------------
A0A2K6GE22_BCL2L11-01      E--C----------------------------------------------
A0A2K6GE22_BCL2L11-03      E--C----------------------------------------------
A0A670Y3D3_BCL2L11-01      E--C----------------------------------------------
A0A8I5ZK47_BCL2L11-04      E--C----------------------------------------------
A0A8I5ZK47_BCL2L11-02      E--C----------------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      E--C----------------------------------------------
A0A671FCV3_BCL2L11-04      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-01      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-05      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-04      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-09      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-07      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-06      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-03      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-02      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-09      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-10      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-05      E--C----------------------------------------------
A0A673WET2_BCL2L11-01      Q--Q----------------------------------------------
A0A7N4NUH6_BCL2L11-02      E--C----------------------------------------------
A0A7N4NUH6_BCL2L11-04      E--C----------------------------------------------
A0A8D2B0V4_BCL2L11-02      E--C----------------------------------------------
A0A8D2B0V4_BCL2L11-01      E--C----------------------------------------------
A0A8D2D0L1_BCL2L11-01      E--C----------------------------------------------
A0A671M057_BCL2L11-01      E--Q----------------------------------------------
A0A671SJ75_BCL2L11-01      T--Q----------------------------------------------
A0A672L1R2_BCL2L11-01      E--Q----------------------------------------------
A0A672PQD1_BCL2L11-01      E--Q----------------------------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      E--C----------------------------------------------
A0A8D0H1T5_BCL2L11-01      E--C----------------------------------------------
A0A673SRF7_BCL2L11-03      E--C----------------------------------------------
A0A673SRF7_BCL2L11-01      E--C----------------------------------------------
A0A4X1VMQ3_BCL2L11-01      E--C----------------------------------------------
A0A4X1VMQ3_BCL2L11-02      E--C----------------------------------------------
A0A4X1VMQ3_BCL2L11-04      E--C----------------------------------------------
A0A4X1VRX9_BCL2L11-01      E--C----------------------------------------------
C1KGB8_BCL2L11-01          E--C----------------------------------------------
A0A674IAI8_BCL2L11-01      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-05      E--C----------------------------------------------
A0A452SBG5_BCL2L11-01      E--C----------------------------------------------
Q3KPZ6_BCL2L11-01          E--C----------------------------------------------
A0A3B5QAM1_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-01      E--C----------------------------------------------
A0A8C0RM03_BCL2L11-03      E--C----------------------------------------------
A0A8C0S6I7_BCL2L11-05      E--C----------------------------------------------
A0A8I3N1T0_BCL2L11-02      E--C----------------------------------------------
A0A2K5CA52_BCL2L11-01      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-04      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-01      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-08      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-06      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-07      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-02      E--C----------------------------------------------
A0A2K6TRJ7_BCL2L11-03      E--C----------------------------------------------
A0A8C9CBP3_BCL2L11-02      E--C----------------------------------------------
A0A8C9CBP3_BCL2L11-01      E--C----------------------------------------------
A0A8C6C635_BCL2L11-03      E--C----------------------------------------------
A0A8C9CBP3_BCL2L11-04      E--C----------------------------------------------
A0A2K5Q1U2_BCL2L11-07      E--C----------------------------------------------
A0A3Q7S5V2_BCL2L11-02      E--C----------------------------------------------
A0A8C0RM03_BCL2L11-04      E--C----------------------------------------------
A0A8C0S6I7_BCL2L11-06      E--C----------------------------------------------
A0A8I3N1T0_BCL2L11-04      E--C----------------------------------------------
A0A8C0RM03_BCL2L11-01      E--C----------------------------------------------
A0A6P3TPJ5_BCL2L11-01      E--C----------------------------------------------
A0A286XJN2_BCL2L11-03      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-01      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-01      E--C----------------------------------------------
F7HHA1_BCL2L11-01          E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-01      E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-03      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-01      E--C----------------------------------------------
A0A8C9I5G9_BCL2L11-01      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-01      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-05      E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-05      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-03      E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-03      E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-02      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-01      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-05      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-07      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-10      E--C----------------------------------------------
O43521_BCL2L11-10          E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-07      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-05      E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-04      E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-07      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-06      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-06      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-06      E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-08      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-06      E--C----------------------------------------------
A0A096NYC3_BCL2L11-04      E--C----------------------------------------------
A0A8C9I5G9_BCL2L11-04      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-04      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-03      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-07      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-08      E--C----------------------------------------------
A0A2I2Y4B3_BCL2L11-10      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-13      E--C----------------------------------------------
O43521_BCL2L11-13          E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-09      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-08      E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-07      E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-10      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-09      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-05      E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-10      E--C----------------------------------------------
A0A096NYC3_BCL2L11-06      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-07      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-04      E--C----------------------------------------------
A0A2K5X1Y3_BCL2L11-02      E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-06      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-04      E--C----------------------------------------------
A0A096NYC3_BCL2L11-03      E--C----------------------------------------------
A0A8C9I5G9_BCL2L11-03      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-03      E--C----------------------------------------------
A0A2K5HZ87_BCL2L11-02      E--C----------------------------------------------
A0A2K6E1Z6_BCL2L11-02      E--C----------------------------------------------
A0A2K5Z7V3_BCL2L11-02      E--C----------------------------------------------
A0A8C9I5G9_BCL2L11-02      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-03      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-02      E--C----------------------------------------------
A0A8C9I5G9_BCL2L11-05      E--C----------------------------------------------
A0A2K6KJM8_BCL2L11-08      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-08      E--C----------------------------------------------
A0A8C6C635_BCL2L11-02      E--C----------------------------------------------
A0A5F5PK35_BCL2L11-01      E--C----------------------------------------------
A0A5F5PK35_BCL2L11-03      E--C----------------------------------------------
A0A667H9R7_BCL2L11-05      E--C----------------------------------------------
A0A8C8Y6N0_BCL2L11-04      E--C----------------------------------------------
A0A8C9JC73_BCL2L11-06      E--C----------------------------------------------
A0A667H9R7_BCL2L11-02      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-11      E--C----------------------------------------------
O43521_BCL2L11-11          E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-06      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-05      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-05      E--C----------------------------------------------
O43521_BCL2L11-05          E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-01      E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-01      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-03      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-04      E--C----------------------------------------------
O43521_BCL2L11-04          E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-03      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-04      E--C----------------------------------------------
A0A2J8SGU7_BCL2L11-04      E--C----------------------------------------------
A0A0C4DH20_BCL2L11-14      E--C----------------------------------------------
O43521_BCL2L11-14          E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-06      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-08      E--C----------------------------------------------
A0A2I3GAA1_BCL2L11-05      E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-08      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-07      E--C----------------------------------------------
A0A2J8SGU7_BCL2L11-03      E--C----------------------------------------------
O43521_BCL2L11-01          E--C----------------------------------------------
O43521_BCL2L11-12          E--C----------------------------------------------
O43521_BCL2L11-09          E--C----------------------------------------------
O43521_BCL2L11-07          E--C----------------------------------------------
O43521_BCL2L11-06          E--C----------------------------------------------
O43521_BCL2L11-03          E--C----------------------------------------------
A0A2R9BZX9_BCL2L11-04      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-10      E--C----------------------------------------------
O43521_BCL2L11-08          E--C----------------------------------------------
O43521_BCL2L11-02          E--C----------------------------------------------
A0A8D2KQ57_BCL2L11-02      E--C----------------------------------------------
A0A8D2KQ57_BCL2L11-01      E--C----------------------------------------------
A0A8C8Y6N0_BCL2L11-02      E--C----------------------------------------------
A0A8C9JC73_BCL2L11-05      E--C----------------------------------------------
A0A8C9JC73_BCL2L11-03      E--C----------------------------------------------
A0A096NYC3_BCL2L11-05      E--C----------------------------------------------
A0A8D2E0B6_BCL2L11-06      E--C----------------------------------------------
A0A8B7EUP7_BCL2L11-03      E--C----------------------------------------------
A0A2I3S5F6_BCL2L11-02      E--C----------------------------------------------
A0A8C9JC73_BCL2L11-01      E--C----------------------------------------------
A0A8C9JC73_BCL2L11-02      E--C----------------------------------------------
A0A3B3YII5_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-02      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-05      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-04      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-10      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-09      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-07      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-06      E--C----------------------------------------------
A0A2K6QIJ1_BCL2L11-01      E--C----------------------------------------------
A0A8D0C9E7_BCL2L11-03      E--Y----------------------------------------------
A0A8D0C9E7_BCL2L11-04      E--Y----------------------------------------------
A0A4X1VRX9_BCL2L11-02      E--C----------------------------------------------
A0A8D0JJW3_BCL2L11-04      E--C----------------------------------------------
A0A8D0JTL2_BCL2L11-05      E--C----------------------------------------------
A0A8D1A276_BCL2L11-02      E--C----------------------------------------------
A0A4X1VRX9_BCL2L11-06      E--C----------------------------------------------
A0A8D0JJW3_BCL2L11-02      E--C----------------------------------------------
A0A8D0JTL2_BCL2L11-01      E--C----------------------------------------------
A0A8D0JTL2_BCL2L11-02      E--C----------------------------------------------
A0A4X1VRX9_BCL2L11-03      E--C----------------------------------------------
A0A8D0JJW3_BCL2L11-01      E--C----------------------------------------------
A0A8D0JTL2_BCL2L11-04      E--C----------------------------------------------
A0A8D1A276_BCL2L11-05      E--C----------------------------------------------
A0A4X1VRX9_BCL2L11-04      E--C----------------------------------------------
A0A8D0JJW3_BCL2L11-03      E--C----------------------------------------------
A0A8D0JTL2_BCL2L11-03      E--C----------------------------------------------
A0A8D1A276_BCL2L11-04      E--C----------------------------------------------
A0A8D0JJW3_BCL2L11-06      E--C----------------------------------------------
A0A8D1A276_BCL2L11-03      E--C----------------------------------------------
A0A8D0JJW3_BCL2L11-05      E--C----------------------------------------------
A0A803KLJ9_BCL2L11-03      D--C----------------------------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      ------------------------------------SSRSTQNIQ----L
A0A4W3IWD3_BCL2L11-02      -------M--SRG-E-LS----GQS-D---F-P---INTTCENIQ----L
A0A4W3IWD3_BCL2L11-03      -------K--REG-R-QG----VPS-D---F-P---INTTCENIQ----L
M3XHJ5_BCL2L11-01          --------------G-HL----HPT-Q---R-P---D-------Q-PPFV
A0A3B5M375_BCL2L11-01      -----------------L----CSS-N---R-P---P-------N----L
A0A3P9N073_BCL2L11-01      --------------------------------------------------
A0A3B3QC78_BCL2L11-01      -------S--AED-K-IT----RMA-E---S-R---N-------------
A0A803WCD8_BCL2L11-01      -------V--RHG-R-RA----LPA-E-----------------------
A0A4W6ETK4_BCL2L11-03      -------D--RSN-G-KRGERRRST-R---R-R---C-------R----W
A0A8D3BD31_BCL2L11-01      -------D--SAS-A-QRGEPES---P---A-R---C-------R----T
A0A8D0D024_BCL2L11-01      -------G--RSN-G-NTGERRRST-T---R-R---C-------R----W
A0A3B4V919_BCL2L11-01      -------D--RSN-G-KRGERRGST-T---R-R---C-------R----W
A0A3B4XZH1_BCL2L11-01      -------D--RSN-G-KRGERRGST-T---R-R---C-------R----W
A0A8C3MHM7_BCL2L11-01      -------P--TTT-GRSA----RPS-QG--E-K---P-------R----V
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      K------K--RNG-G-NL----RGG-G---A-D---P-------E----P
A0A3Q1CI15_BCL2L11-01      A------A--R-C-F-T---------------------------------
A0A3Q1ELG4_BCL2L11-01      ------------A-D-TT----EGG-G---A-D---P-------E----P
A0A669C520_BCL2L11-01      ------------A-F-PI----RQT-E---M-Y---L-------P----P
A0A3Q3K6I5_BCL2L11-01      ------------------------L-S---R-P---P-------N----R
A0A3Q2SZH6_BCL2L11-01      -----------------L----CSS-N---R-P---P-------N----L
A0A3B3VNE0_BCL2L11-01      -----------------------HS-S---R-P---P-------N----L
A0A671W556_BCL2L11-01      -----------------------HP-S---R-P---P-------N----S
A0A673CKA1_BCL2L11-01      --------------------------------------------------
A0A667ZMY7_BCL2L11-01      --------------------------------------------------
A0A3Q3B113_BCL2L11-01      -----------------------SP-S---R-P---P-------N----L
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      --------------------------------------------------
A0A3B5QAM1_BCL2L11-02      -----------------L----CSS-N---R-P---P-------N----L
A0A4W6ETK4_BCL2L11-02      -----------------------PP-S---R-P---P-------N----Q
A0A3Q3ESW6_BCL2L11-01      -----------------------RP-S---R-P---P-------N----R
A0A8P4G4W6_BCL2L11-01      -----------------G----CLH-P---R-P---P-------N----P
A0A3Q1ICY2_BCL2L11-01      ------------------------D-P---R-Q---P-------N----R
A0A673XGV4_BCL2L11-01      -------Y--YCN-L-WV----AIM-D---Q-GES-G-------E----S
A0A4W4H3Y1_BCL2L11-01      -------N--RAN-G-PA----FLK-E---Q-GES-G-------E----N
A0A4W4H3Y1_BCL2L11-02      -------N--RAN-G-PA----FLK-E---Q-GES-G-------E----N
A0A8C8F2F2_BCL2L11-01      --------------------------N---R-GKS-G-------E----S
A0A4W5NF23_BCL2L11-01      -------I--GPN-V-ST----TLI-E---R-RKS-G-------E----S
A0A3B4BSH7_BCL2L11-01      -------N--RAG-R-PA----FLK-E---Q-GES-G-------Q----S
A0A4W5R3N6_BCL2L11-02      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
B2KKY9_BCL2L11-01          -------T--LAN-G-PA--------S---Q-G-S-G-------E----S
A0A4W5R3N6_BCL2L11-03      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A8C1CBG6_BCL2L11-01      -------T--LAN-G-PA--------S---R-G-G-G-------E----S
W5UEE7_BCL2L11-01          -------Y--RAD-G-PA----FLK-E---H-GGR-G-------E-----
A0A3B4BSH7_BCL2L11-03      -----------QN-S-NY----CCF-E---Q-GES-G-------Q----S
A0A8C9VIN6_BCL2L11-01      -------T--RAN-G-PT----TLS-E---S-GEG-R-------E-----
A0A3B1JXK6_BCL2L11-01      -------N--RAT-R-PP----FLK-E---Q-GER-G-------Q----S
A0A3B4BSH7_BCL2L11-02      -------N--RAG-R-PA----FLK-E---Q-GES-G-------Q----S
A0A8L0DSD4_BCL2L11-01      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A3P8XIA2_BCL2L11-01      -------N--RSN-G-TT----TLI-G---R-GKI-G-------E----S
A0A673IWZ7_BCL2L11-01      -------T--LAN-G-PA--------S---R-G-S-G-------E----S
A0A8C0B3C7_BCL2L11-01      SRQRFFKV--REG-A-AA----VPA-R---K-E---G-------Y----L
A0A8D0FSN5_BCL2L11-01      -------G--REG-K-P---------------------------------
A0A8C2TYI5_BCL2L11-01      EKRRRRKG--RAGPA-P---------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          -------TLANTG-T-RL----QHA-H---R-T---A-------S----L
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-R---A-------R----A
A0A8C0FLD7_BCL2L11-01      -------P--CAG-P-------EYL-F---F-C---C------CS----S
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      -------E--FYG-V-------QSV-Q---F-V---L-------A----L
A0A669QMB4_BCL2L11-01      -------D--RRA-G-RL----PPG-E---G-P---G----PAVP----L
A0A8C5IZK3_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-P---G----PGAQ----L
A0A8C3TPU0_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-P---G----PGAQ----L
A0A8B9MPS6_BCL2L11-01      -------D--GEG-G-RL----PPA-E---G-P---G----PAAQ----L
A0A8C9EIW6_BCL2L11-01      -------D--RRA-G-RL----PPG-E---G-P---G----PAVP----L
A0A2K5CA52_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P----------PQ----L
A0A8V0Z3E3_BCL2L11-01      -------V--SNC-G-----------------------------------
A0A8B9T738_BCL2L11-02      -------D--GRG-G-QR----QPR-------------------------
A0A8C3BDR3_BCL2L11-01      -------G--RQA-G-RL----PPA-E---G-P---G----PAAQ----L
A0A8B9VXZ3_BCL2L11-01      -------------------------------------------------A
A0A8C2TW35_BCL2L11-01      -------D--RRA-G-RL----PPG-E---G-P---G----PAVP----L
U3IW89_BCL2L11-01          -------D--GRG-G-QR----QPR-------------------------
A0A663E970_BCL2L11-01      -------D--GEG-G-RL----PPA-E---G-P---G----PAAQ----L
A0A8V0Z3R2_BCL2L11-01      -------D--RRA-G-RL----PPG-E---G-P---G----PAVP----L
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      -------G--RQA-G-RL----PPA-E---G-P---G----PAAQ----L
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      -------A--ARR-G-R---------------------------S----R
A0A5F8H037_BCL2L11-02      -------D--REG-G-QL----QPT-E---R-P---T----QPQQ----L
A0A672TST9_BCL2L11-01      -------D--GDG-G-----------E---G-P---G----PAAQ----L
A0A674H354_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-P---G----PGAQ----L
A0A8C5STS5_BCL2L11-02      -------E--REG-G-QL----QPA-E---R-P---A----QPHH----L
A0A2K5NTQ5_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A7M4F197_BCL2L11-01      -------G--SED-R-QL----QPR-E---R-P---S-------Q-PQPV
A0A8C0UNY9_BCL2L11-01      -------G--REG-G-RM----EPA-S---F-T-----------------
A0A671FCV3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4REW7_BCL2L11-02      -------G-AGDG-G-PL----QPT-Q---E-A---G-------R-P-LS
A0A8D0C9E7_BCL2L11-02      -------T--GEN-S-QL----QPT-E---R-L---V-------Q---HL
A0A5F9C9V3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C5QSK2_BCL2L11-01      -------E-SGDT-D-NL----QSTSS---R-P---T-------P-HCPL
A0A4X1VRX9_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C8SQS1_BCL2L11-01      -------D--REG-G-QF----QSV-E---R-P---S-------Q-PQHL
A0A8D0C9E7_BCL2L11-01      -------T--GEN-S-QL----QPT-E---R-L---V-------Q---HL
A0A671FCV3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A803KLJ9_BCL2L11-02      -------N-SGEG-G-QL----QST-S---R-Q---H-------S-HRPL
A0A6I8NCK5_BCL2L11-04      -------D--SEG-G-RL----EPA-E---G-P---A-------Q-PPQL
A0A8C3X5Q0_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0P6J9X4_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A5F5PK35_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3RZA1_BCL2L11-01      -------N--REG-G-QF----QSI-E---R-P---S-------Q-PQHL
A0A803KLJ9_BCL2L11-01      -------N-SGEG-G-QL----QST-S---R-Q---H-------S-HRPL
A0A8D2Q5M7_BCL2L11-01      -------N--REG-G-QL----EPA-E---R-P---A-------Q-PQHL
A0A8C4REW7_BCL2L11-01      -------G-AGDG-G-PL----QPT-Q---E-A---G-------R-P-LS
A0A0P6J9X4_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A6I9LW27_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6HGQ3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2QK28_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
G3SU55_BCL2L11-01          -------D--REG-G-QL----QPA-E---R-P---P----QPPQ----L
A0A8C4LFQ1_BCL2L11-07      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D2MQT6_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-PGPGA-------Q----L
A0A8C9JC73_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C8ZU60_BCL2L11-01      -------D--REG-G-RL----QPV-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C3TPU0_BCL2L11-03      -------D--GEG-G-RL----PAA-E---G-PGPGA-------Q----L
A0A8C0RM03_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C5L6N3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P----Q--Q----L
A0A2K5CA52_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8B7EUP7_BCL2L11-06      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A1U7SU38_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D1A276_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9PPC0_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C6HGQ3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2P0X3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B9QMZ1_BCL2L11-01      -------E--REG-G-RL----QAP-R---R-P---G-------H----P
A0A5F5PK35_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B7EUP7_BCL2L11-05      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A0P6J9X4_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A7N4NUH6_BCL2L11-03      -------D--REG-G-QL----QPT-E---R-PTQ-P-------Q----L
A0A8C3FX85_BCL2L11-02      -------N--REG-G-QF----QSI-E---R-P---S----QPQH----L
A0A0P6J9X4_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VMQ3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8I5ZK47_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3TPU0_BCL2L11-02      -------D--GEG-G-RL----PAA-E---G-P---G-------------
F7HHA1_BCL2L11-02          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8I3N1T0_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
O54918_BCL2L11-03          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A7N5JE15_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X2L9J9_BCL2L11-01      -------H--REG-G-QL----HPT-E---R-P---T----QPQQ----L
A0A7N5JE15_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3TPU0_BCL2L11-04      -------D--GEG-G-RL----PAA-E---G-P---G-------------
A0A8C9NMA1_BCL2L11-01      -------A--IWG-W-FL----CPS-E---PEP---Q-------Q----F
A0A7M4F197_BCL2L11-02      -------G--SED-R-QL----QPR-E---R-P---S-------Q-PQPV
A0A8C0S6I7_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A7N5JE15_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8I3N1T0_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A3Q7S5V2_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      -------D--REG-G-QF----QST-E---R-P---S----QPQH----L
A0A8C3DC27_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-P---G----PGAQ----L
A0A2K6KJM8_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C4TR55_BCL2L11-01      -------G--RAA-A-HT----AAA-P---R-P---P-------R----S
A0A0C4DH20_BCL2L11-12      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
K7GA86_BCL2L11-01          -------D--GEG-G-QF----QSI-E---R-P---S----QPQH----L
A0A8I5ZK47_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2UYE1_BCL2L11-02      -------D--TEG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C5L6N3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P------QQ----L
A0A8C8Y6N0_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B9T738_BCL2L11-01      -------D--GRG-G-QR----QPR-A---R-S---P-------L----L
A0A7N5JE15_BCL2L11-07      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A673SRF7_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A6I9LW27_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2P0X3_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A452U4S4_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0D9RWE0_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A5F8H037_BCL2L11-01      -------D--REG-G-QL----QPT-E---R-P---T----QPQQ----L
A0A2R9BZX9_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A7N4NUH6_BCL2L11-01      -------D--REG-G-QL----QPT-E---R-PTQ-P-------Q----L
A0A8B7EUP7_BCL2L11-07      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A8C2P0X3_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6QXX9_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---A-------Q----L
A0A1U7SU38_BCL2L11-07      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A6I8NCK5_BCL2L11-01      -------D--SEG-G-RL----EPA-EGPAQ-P---P-------Q----L
A0A8B9YZT6_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VMQ3_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0P6J9X4_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A6I8NCK5_BCL2L11-03      -------D--SEG-G-RL----EPA-EGPAQ-P---P-------Q----L
A0A6I8NCK5_BCL2L11-05      -------D--SEG-G-RL----EPA-EGPAQ-P---P-------Q----L
A0A673SRF7_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A7N5JE15_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2J8SGU7_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A7N5JE15_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A7N5JE15_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      --------------------------A---L-GLR-G-------C----D
A0A8B8Z6B1_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B8Z6B1_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B8Z6B1_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B8Z6B1_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
L8IVA4_BCL2L11-01          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
L8IVA4_BCL2L11-02          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R8M6L7_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C0L5G0_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0L5G0_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0NKD6_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0NKD6_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0NKD6_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0S6I7_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0S6I7_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0S6I7_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A452FCR6_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A452FCR6_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2P0X3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2P0X3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A3G3M2M0_BCL2L11-01      -------T--PGN-V-PA--------S---R-G-S-G-------E----S
A0A1U7SU38_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A1U7SU38_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A1U7SU38_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A1U7SU38_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A1U7SU38_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A250YBV9_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A250YBV9_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3X5Q0_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3X5Q0_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3X5Q0_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3X5Q0_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A286XJN2_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---S-------Q----L
A0A286XJN2_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---S-------Q----L
A0A2K5Q1U2_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P----------PQ----L
A0A2K5Q1U2_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5NTQ5_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C0QRC8_BCL2L11-01      -------N--REG-G-QF----QST-E---R-P---S-------QP-QHL
A0A8C3RZA1_BCL2L11-02      -------N--REG-G-QF----QSI-E---R-P---S-------QP-QHL
A0A8C2UYE1_BCL2L11-03      -------D--TEG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C2UYE1_BCL2L11-01      -------D--TEG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3FX85_BCL2L11-01      -------N--REG-G-QF----QSI-E---R-P---S----QPQH----L
A0A2K5HZ87_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C2QK28_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C3NS85_BCL2L11-01      -------D--GEG-G-RL----PAA-E---G-P---G----PGAQ----L
A0A8C1CBG6_BCL2L11-02      -------T--LAN-G-PA--------S---R-G-G-G-------E----S
A0A8C2L5J3_BCL2L11-02      -------T--PGN-G-PA--------S---R-G-S-G-------E----S
A0A8C2L5J3_BCL2L11-01      -------T--PGN-G-PA--------S---R-G-S-G-------E----S
B8JK68_BCL2L11-01          -------T--LAN-G-PA--------S---Q-G-S-G-------E----S
A0A2Y9Q753_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2Y9Q753_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-08      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4LFQ1_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A5F5PK35_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4TR55_BCL2L11-03      -------D--GEG-G-RL----PAA-E---G-P---G----PAAQ----L
A0A8C4TR55_BCL2L11-02      -------D--GEG-G-RL----PAA-E---G-P---G----PAAQ----L
A0A2I2UX96_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2I2UX96_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2I2UX96_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2I2UX96_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C4VJX6_BCL2L11-02      -------D--REG-G-QF----QST-E---R-P---S----QPQH----L
A0A2I2Y4B3_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0P6J9X4_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0P6J9X4_BCL2L11-07      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0P6J9X4_BCL2L11-08      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A287DFJ0_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A287DFJ0_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C5L6N3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------QQ---L
A0A4W6ETK4_BCL2L11-01      --------------------------Q---R-P---P-------N----Q
A0A8C5STS5_BCL2L11-01      -------E--REG-G-QL----QPA-E---R-P---A-------QP-HHL
A0A667H9R7_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A667H9R7_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A667H9R7_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
F7HHA1_BCL2L11-03          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C5YNZ8_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C5YNZ8_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8B7EUP7_BCL2L11-04      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A8B7EUP7_BCL2L11-01      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A8B7EUP7_BCL2L11-02      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A8C6C635_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6DRY6_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6DRY6_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6DRY6_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
O54918_BCL2L11-06          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
O54918_BCL2L11-05          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
O54918_BCL2L11-04          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6HGQ3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
M3YDI3_BCL2L11-01          -------D--REG-G-QL----QPV-E---R-P---P-------Q----L
A0A8C6VGF4_BCL2L11-01      -------E--REG-G-QL----QPA-E---R-P---A-------QP-HHL
A0A8C6QXX9_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---A-------Q----L
A0A8C6QXX9_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---A-------Q----L
A0A8C7BAK5_BCL2L11-01      -------D--REG-G-QL----QPV-E---R-P---P-------Q----L
A0A8C7BAK5_BCL2L11-04      -------D--REG-G-QL----QPV-E---R-P---P-------Q----L
A0A8C7BAK5_BCL2L11-03      -------D--REG-G-QL----QPV-E---R-P---P-------Q----L
A0A8C7BAK5_BCL2L11-02      -------D--REG-G-QL----QPV-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C7HIL6_BCL2L11-02      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A8C7HIL6_BCL2L11-01      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A8C7L4D1_BCL2L11-01      --------------------------------FYY-G-------E----S
A0A8C7V9R7_BCL2L11-01      --------------------------------------------------
A0A8C8FY48_BCL2L11-01      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A6I8NCK5_BCL2L11-02      -------D--SEG-G-RL----EPA-EGPAQ-P---P-------Q----L
A0A5F9C9V3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
H0XW23_BCL2L11-01          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C8Y6N0_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A096NYC3_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A096NYC3_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A6I9LW27_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9CBP3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2Y9T3Y6_BCL2L11-03      -------D--REG-G-QL----QTA-E---R-P---P-------Q----L
A0A2Y9T3Y6_BCL2L11-02      -------D--REG-G-QL----QTA-E---R-P---P-------Q----L
A0A2Y9T3Y6_BCL2L11-01      -------D--REG-G-QL----QTA-E---R-P---P-------Q----L
A0A8C9I5G9_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      -------G--REG-G-QL----QPA-E---R-P---A----------QHL
A0A3B3YII5_BCL2L11-02      -----------------------HS-L---R-P---P-------N----L
A0A2J8SGU7_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2J8SGU7_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2J8SGU7_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C8ZU60_BCL2L11-02      -------D--REG-G-RL----QPV-E---R-P---P-------Q----L
A0A8C8ZU60_BCL2L11-04      -------D--REG-G-RL----QPV-E---R-P---P-------Q----L
A0A8C8ZU60_BCL2L11-03      -------D--REG-G-RL----QPV-E---R-P---P-------Q----L
A0A2K6GE22_BCL2L11-04      -------D--REG-G-QL----QSV-E---R-P---P-------Q----L
A0A2K6GE22_BCL2L11-05      -------D--REG-G-QL----QSV-E---R-P---P-------Q----L
A0A2K6GE22_BCL2L11-02      -------D--REG-G-QL----QSV-E---R-P---P-------Q----L
A0A2K6GE22_BCL2L11-06      -------D--REG-G-QL----QSV-E---R-P---P-------Q----L
A0A2K6GE22_BCL2L11-01      -------D--REG-G-QL----QSV-E---R-P---P-------Q----L
A0A2K6GE22_BCL2L11-03      -------D--REG-G-QL----QSV-E---R-P---P-------Q----L
A0A670Y3D3_BCL2L11-01      -------E--REG-G-QL----QPA-E---R-P---A-------QP-HHL
A0A8I5ZK47_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8I5ZK47_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A671FCV3_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A673WET2_BCL2L11-01      -------N--QSN-G-ST----ILI-E---R-GKY-G-------E----L
A0A7N4NUH6_BCL2L11-02      -------D--REG-G-QL----QPT-E---R-P---T----QPQ-----L
A0A7N4NUH6_BCL2L11-04      -------D--REG-G-QL----QPT-E---R-PTQ-P-------Q----L
A0A8D2B0V4_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D2B0V4_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D2D0L1_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A671M057_BCL2L11-01      -------T--P---------------G---R-G-S-G-------E----S
A0A671SJ75_BCL2L11-01      -------T--LAN-G-PA--------S---R-G-S-G-------E----S
A0A672L1R2_BCL2L11-01      -------T--P---------------G---R-G-S-G-------E----S
A0A672PQD1_BCL2L11-01      -------T--P---------------G---R-G-S-G-------E----S
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0H1T5_BCL2L11-01      -------N--SEG-G-QL----QPV-E---R-P---S-------QP-QHL
A0A673SRF7_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A673SRF7_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VMQ3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VMQ3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VMQ3_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VRX9_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
C1KGB8_BCL2L11-01          -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A674IAI8_BCL2L11-01      -------N--REG-G-QF----QSI-E---R-P---S----QPQH----L
A0A8D2E0B6_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A452SBG5_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
Q3KPZ6_BCL2L11-01          -------N-SGEG-G-QL----QST-S---R-R---H-------SH-RPR
A0A3B5QAM1_BCL2L11-01      ----------------------MHS-L---R-P---P-------N----L
A0A8C0NKD6_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0RM03_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0S6I7_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8I3N1T0_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2K5CA52_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6TRJ7_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9CBP3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9CBP3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C6C635_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9CBP3_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A2K5Q1U2_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A3Q7S5V2_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0RM03_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0S6I7_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8I3N1T0_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C0RM03_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A6P3TPJ5_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A286XJN2_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---S-------Q----L
A0A2K5HZ87_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
F7HHA1_BCL2L11-01          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9I5G9_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2E0B6_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-10          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A096NYC3_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9I5G9_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2E0B6_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I2Y4B3_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-13      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-13          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A096NYC3_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2E0B6_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5X1Y3_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A096NYC3_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9I5G9_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2E0B6_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5HZ87_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6E1Z6_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K5Z7V3_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9I5G9_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2E0B6_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9I5G9_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6KJM8_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C6C635_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A5F5PK35_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A5F5PK35_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A667H9R7_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C8Y6N0_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9JC73_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A667H9R7_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-11      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-11          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-05          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-04          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2J8SGU7_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A0C4DH20_BCL2L11-14      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-14          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3GAA1_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-08      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2J8SGU7_BCL2L11-03      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-01          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-12          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-09          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-07          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-06          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-03          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2R9BZX9_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-08          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
O43521_BCL2L11-02          -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2KQ57_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D2KQ57_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C8Y6N0_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9JC73_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9JC73_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A096NYC3_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D2E0B6_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8B7EUP7_BCL2L11-03      -------D--QEG-G-QL----QPV-E---R-P---P-------Q----L
A0A2I3S5F6_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8C9JC73_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8C9JC73_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A3B3YII5_BCL2L11-01      -----------------------HS-L---R-P---P-------N----L
A0A2K6KJM8_BCL2L11-02      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-05      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-04      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-10      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-09      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-07      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-06      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A2K6QIJ1_BCL2L11-01      -------D--REG-R-QL----QPA-E---R-P---P-------Q----L
A0A8D0C9E7_BCL2L11-03      -------T--GEN-S-QL----QPT-E---R-L---V-------Q---HL
A0A8D0C9E7_BCL2L11-04      -------T--GEN-S-QL----QPT-E---R-L---V-------Q---HL
A0A4X1VRX9_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JJW3_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JTL2_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D1A276_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VRX9_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JJW3_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JTL2_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JTL2_BCL2L11-02      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VRX9_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JJW3_BCL2L11-01      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JTL2_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D1A276_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A4X1VRX9_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JJW3_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JTL2_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D1A276_BCL2L11-04      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JJW3_BCL2L11-06      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D1A276_BCL2L11-03      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A8D0JJW3_BCL2L11-05      -------D--REG-G-QL----QPA-E---R-P---P-------Q----L
A0A803KLJ9_BCL2L11-03      -------N-SGEG-G-QL----QST-S---R-Q---H-------S-HRPL
                                                                             

A0A4W3IWD3_BCL2L11-01      SPA-----------------------------------------------
A0A4W3IWD3_BCL2L11-02      SPA-----------------------------------------------
A0A4W3IWD3_BCL2L11-03      SPA-----------------------------------------------
M3XHJ5_BCL2L11-01          KQEGCYCI-ISPLS--KVIALV----------------------------
A0A3B5M375_BCL2L11-01      LDGSTEVT-PAEGT-GG--DPAS------SARTPRSS---KH---TERSR
A0A3P9N073_BCL2L11-01      -------------------DPAS------SARTPRSS---KH---TERSC
A0A3B3QC78_BCL2L11-01      ----PVAE-Q----------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      SLGANVPF-ERRRR--R--RR-----------------------------
A0A8D3BD31_BCL2L11-01      KST-----------------------------------------------
A0A8D0D024_BCL2L11-01      SLSANLPF-ERLRR------------------------------------
A0A3B4V919_BCL2L11-01      SPSAKPQF-ERQRR------------------------------------
A0A3B4XZH1_BCL2L11-01      SPGAKPQF-ERQRR------------------------------------
A0A8C3MHM7_BCL2L11-01      APGSK---------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      VGAAGVSA-KTSRL--N--ST-----------------------------
A0A3Q1CI15_BCL2L11-01      SGSRCRDS-ERLPP--N--PS-----------------------------
A0A3Q1ELG4_BCL2L11-01      VGAAGVSA-KTSRS--N--ST-----------------------------
A0A669C520_BCL2L11-01      VGATGAQTSRLNRG--S--TG-----------------------------
A0A3Q3K6I5_BCL2L11-01      SDGSTAVT-ATEES--G--DPPSVGAAGTSAQSSRSN---GG---SERS-
A0A3Q2SZH6_BCL2L11-01      RDGSTEVT-PPEGT-GG--DPAS------SARTPRLS---KH---REGSC
A0A3B3VNE0_BCL2L11-01      LDGSTEVT-PAEGT-GG--DPAS------SARTPRSS---KH---TERSC
A0A671W556_BCL2L11-01      SDGSTAVT-AGQGS-GG--DPSPAGAAGASAQTSRSD---TG---GVPS-
A0A673CKA1_BCL2L11-01      --------------------P-----CVKSLKRAYCS---AS---GELS-
A0A667ZMY7_BCL2L11-01      ----SDVT-AA--------------------QTPRAAPANES---GGRC-
A0A3Q3B113_BCL2L11-01      RDGSTEVK-ATEGSSGG--APPSAGAARGSAHATRPV-------------
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      -------M-ATEES--G--DPP-AGDPRVSAQTSRSN---GG---TDQS-
A0A3B5QAM1_BCL2L11-02      LDGSTEVT-PAEGT-GG--DPAS------SARTPRSS---KH---TERSR
A0A4W6ETK4_BCL2L11-02      SDGSTEVT-AREES-GG--DPHVDGAAGASAQTSRSN---DGGGGGERS-
A0A3Q3ESW6_BCL2L11-01      LDGSPTVT-ESHGT-RG--DPP---------QTSRSD---NS---GGRN-
A0A8P4G4W6_BCL2L11-01      SDGSTAVT-ATQGS-GG--DPPPAGAAGACAQTNRSD---NA---GERS-
A0A3Q1ICY2_BCL2L11-01      SDGSTAVT-ATGES-GG--DPPPVGAAGVSTPTSRSN---DG---GERR-
A0A673XGV4_BCL2L11-01      HPGGGAAS-RAEPS--D--NPQ----------------------------
A0A4W4H3Y1_BCL2L11-01      T-GVGTAS-RPEQF--D--CSH----------------------------
A0A4W4H3Y1_BCL2L11-02      T-GVGTAS-RPEQF--D--CSH----------------------------
A0A8C8F2F2_BCL2L11-01      HPGGGAAS-RAEPS--D--NPQ----------------------------
A0A4W5NF23_BCL2L11-01      HPGGGAAS-RAEPS--D--NPQ----------------------------
A0A3B4BSH7_BCL2L11-01      S-GAASSR-AAEQC--E--QPE----------------------------
A0A4W5R3N6_BCL2L11-02      NPGGGAAS-GAEPT--D--IPQ----------------------------
B2KKY9_BCL2L11-01          T-GGGVVL-PAGHF--D--FPQ----------------------------
A0A4W5R3N6_BCL2L11-03      NPGGGAAS-GAEPT--D--IPQ----------------------------
A0A8C1CBG6_BCL2L11-01      A-GGGAVL-RTEHF--D--FPQ----------------------------
W5UEE7_BCL2L11-01          -----SAS-RAEPY--E--SPQ----------------------------
A0A3B4BSH7_BCL2L11-03      S-GAASSR-AAEQC--E--QPE----------------------------
A0A8C9VIN6_BCL2L11-01      --------------------AQ----------------------------
A0A3B1JXK6_BCL2L11-01      GGGGGTLS-RAEQC--E--QPE----------------------------
A0A3B4BSH7_BCL2L11-02      S-GAASSR-AAEQC--E--QPE----------------------------
A0A8L0DSD4_BCL2L11-01      NPGGGAAS-GAEPT--D--NPQ----------------------------
A0A3P8XIA2_BCL2L11-01      HPCGGATS-SSKLS--D--YPQ----------------------------
A0A673IWZ7_BCL2L11-01      A-GGGAVL-RSEHF--D--FPQ----------------------------
A0A8C0B3C7_BCL2L11-01      ERGKEKVL-LGKES------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          DF-VPVS-------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      RSCARRPR-RLPGP--G--RPG----------------------------
A0A8C0FLD7_BCL2L11-01      VSTAL---------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      GSNAP---------------------------------------------
A0A669QMB4_BCL2L11-01      RPGAPAAL-PGAA-------------------------------------
A0A8C5IZK3_BCL2L11-01      RPGAPAAL-PGAG-------------------------------------
A0A8C3TPU0_BCL2L11-01      RPGAPAAL-PGAGA--V---------------------------------
A0A8B9MPS6_BCL2L11-01      RPGAPAAL-PGSA-------------------------------------
A0A8C9EIW6_BCL2L11-01      RPGAPAAL-PGAA-------------------------------------
A0A2K5CA52_BCL2L11-10      RPGAPTSL-QT---------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      RPGAPAAL-PGLPA--A--ASF----------------------------
A0A8B9VXZ3_BCL2L11-01      RPVSPCSP-PRA--------------------------------------
A0A8C2TW35_BCL2L11-01      RPGAPAAL-PGAA-------------------------------------
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      RPGAPAAL-P----------------------------------------
A0A8V0Z3R2_BCL2L11-01      RPGAPAAL-PGAA-------------------------------------
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      RPGAPAAL-PGLPA--A--ASF----------------------------
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      RPPAPA--------------------------------------------
A0A5F8H037_BCL2L11-02      RPGAPTSI-QTQYQ--G--N------------------------------
A0A672TST9_BCL2L11-01      RPGAPAAL-PGSA-------------------------------------
A0A674H354_BCL2L11-01      RPGAPAAL-PGAG-------------------------------------
A0A8C5STS5_BCL2L11-02      RPGAPTSL-QTEYQ--G--NHL----------------------------
A0A2K5NTQ5_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A7M4F197_BCL2L11-01      RPGAPTSI-QTQYQ------------------------------------
A0A8C0UNY9_BCL2L11-01      --GGRRSA-RGR--------------------------------------
A0A671FCV3_BCL2L11-02      RPGAPTSV-QIERQ--G--NPE----------------------------
A0A8C4REW7_BCL2L11-02      RPGPRT-----HSE--G--DQS----------------------------
A0A8D0C9E7_BCL2L11-02      RFDAPTSL-QTEYP--G--NLS----------------------------
A0A5F9C9V3_BCL2L11-01      RPGAPTSL-QSEPQ------------------------------------
A0A8C5QSK2_BCL2L11-01      RRGAPTSL-NSPFQ--G--SLS----------------------------
A0A4X1VRX9_BCL2L11-05      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8C8SQS1_BCL2L11-01      RPGAPTSI-QTQYQ--D--SR-----------------------------
A0A8D0C9E7_BCL2L11-01      RFDAPTSL-QTEYP--G--NLS----------------------------
A0A671FCV3_BCL2L11-03      RPGAPTSV-QIERQ------------------------------------
A0A803KLJ9_BCL2L11-02      RRGAPTSL-SSPFQ--G--NQS----------------------------
A0A6I8NCK5_BCL2L11-04      RPGAPTSI-RTQYQ--G--NLS----------------------------
A0A8C3X5Q0_BCL2L11-03      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A0P6J9X4_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A5F5PK35_BCL2L11-02      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8C3RZA1_BCL2L11-01      RPGAPTSI-QTQYQ--G--NHT----------------------------
A0A803KLJ9_BCL2L11-01      RRGAPTSL-SSPFQ--G--NQS----------------------------
A0A8D2Q5M7_BCL2L11-01      RPGAPTSL-QTEHQ--G--NHS----------------------------
A0A8C4REW7_BCL2L11-01      RPGPRT-----HSE--G--DQS----------------------------
A0A0P6J9X4_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A6I9LW27_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPD----------------------------
A0A8C6HGQ3_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPD----------------------------
A0A8C2QK28_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPD----------------------------
G3SU55_BCL2L11-01          RPGAPTSL-LTEPQ--G--NPD----------------------------
A0A8C4LFQ1_BCL2L11-07      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8D2MQT6_BCL2L11-01      RPGAPAAL-PGA--------------------------------------
A0A8C9JC73_BCL2L11-04      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C8ZU60_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8C3TPU0_BCL2L11-03      RPGAPAAL-PGA--------------------------------------
A0A8C0RM03_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A8C5L6N3_BCL2L11-03      RPGAPTSL-QTVPQ------------------------------------
A0A2K5CA52_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8B7EUP7_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A1U7SU38_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8D1A276_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8C9PPC0_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8C6HGQ3_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPD----------------------------
A0A8C2P0X3_BCL2L11-02      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8B9QMZ1_BCL2L11-01      RPGAPTSL-PW---------------------------------------
A0A5F5PK35_BCL2L11-05      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8B7EUP7_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0P6J9X4_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A7N4NUH6_BCL2L11-03      RPGAPTSI-QTQYQ--G--NS-----------------------------
A0A8C3FX85_BCL2L11-02      RPGAPTSI-QTQYQ--G--NHS----------------------------
A0A0P6J9X4_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A4X1VMQ3_BCL2L11-03      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8I5ZK47_BCL2L11-03      RPGAPTSL-QTESQ--G--NPD----------------------------
A0A8C3TPU0_BCL2L11-02      -PGAPGPF-A----------------------------------------
F7HHA1_BCL2L11-02          RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8I3N1T0_BCL2L11-03      RPGAPTSL-QTEQQ--G--NPE----------------------------
O54918_BCL2L11-03          RPGAPTSL-QTEPQ------------------------------------
A0A7N5JE15_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A4X2L9J9_BCL2L11-01      RPGAPTSI-QTQYQ------------------------------------
A0A7N5JE15_BCL2L11-03      RPGAPTSL-QTEQQ------------------------------------
A0A8C3TPU0_BCL2L11-04      -PGAPGPF-A----------------------------------------
A0A8C9NMA1_BCL2L11-01      HPGAS---------------------------------------------
A0A7M4F197_BCL2L11-02      RPGAPTSI-QTQYQ------------------------------------
A0A8C0S6I7_BCL2L11-03      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A7N5JE15_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8I3N1T0_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
A0A3Q7S5V2_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      RPGAPTSI-QTQYQ------------------------------------
A0A8C3DC27_BCL2L11-01      RPGAPAAL-P----------------------------------------
A0A2K6KJM8_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A8C4TR55_BCL2L11-01      APGYFSF-----DA------------------------------------
A0A0C4DH20_BCL2L11-12      RPGAPTSL-QTEPQ------------------------------------
K7GA86_BCL2L11-01          RPGAPTSI-QTQYQ------------------------------------
A0A8I5ZK47_BCL2L11-01      RPGAPTSL-QTESQ------------------------------------
A0A8C2UYE1_BCL2L11-02      RPGALTSL-QTEPQ------------------------------------
A0A8C5L6N3_BCL2L11-01      RPGAPTSL-QTVPQ------------------------------------
A0A8C8Y6N0_BCL2L11-03      RPGAPTSL-QTEQQ------------------------------------
A0A8B9T738_BCL2L11-01      SRSSSGYF-SF-EA------------------------------------
A0A7N5JE15_BCL2L11-07      RPGAPTSL-QTEQQ------------------------------------
A0A673SRF7_BCL2L11-04      RPGAPTSL-QTQRQ------------------------------------
A0A6I9LW27_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A8C2P0X3_BCL2L11-04      RPGAPTSL-QTERQ------------------------------------
A0A452U4S4_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
A0A0D9RWE0_BCL2L11-01      RPGAPTSL-QTEPQ------------------------------------
A0A2K5Q1U2_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A5F8H037_BCL2L11-01      RPGAPTSI-QTQYQ------------------------------------
A0A2R9BZX9_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A0C4DH20_BCL2L11-08      RPGAPTSL-QTEPQ------------------------------------
A0A7N4NUH6_BCL2L11-01      RPGAPTSI-QTQYQ------------------------------------
A0A8B7EUP7_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A8C2P0X3_BCL2L11-05      RPGAPTSL-QTERQ------------------------------------
A0A8C6QXX9_BCL2L11-03      RPGAPTSL-QTEQQ------------------------------------
A0A1U7SU38_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A6I8NCK5_BCL2L11-01      RPGAPTSI-RTQYQ------------------------------------
A0A8B9YZT6_BCL2L11-01      RPGAPTSL-QTERQ------------------------------------
A0A4X1VMQ3_BCL2L11-05      RPGAPTSL-QTERQ------------------------------------
A0A0P6J9X4_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A6I8NCK5_BCL2L11-03      RPGAPTSI-RTQYQ------------------------------------
A0A6I8NCK5_BCL2L11-05      RPGAPTSI-RTQYQ------------------------------------
A0A673SRF7_BCL2L11-02      RPGAPTSL-QTQRQ------------------------------------
A0A7N5JE15_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
A0A8C4LFQ1_BCL2L11-01      RPGAPTSL-QIEQQ------------------------------------
A0A2J8SGU7_BCL2L11-06      RPGAPTSL-QTEPQ------------------------------------
A0A7N5JE15_BCL2L11-06      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A7N5JE15_BCL2L11-05      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A2K5CA52_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      GGGGGTLS-RAEQC--E--QPE----------------------------
A0A8B8Z6B1_BCL2L11-04      RPGAPISL-QTERQ------------------------------------
A0A8B8Z6B1_BCL2L11-01      RPGAPISL-QTERQ--G--NPE----------------------------
A0A8B8Z6B1_BCL2L11-02      RPGAPISL-QTERQ------------------------------------
A0A8B8Z6B1_BCL2L11-03      RPGAPISL-QTERQ--G--NPE----------------------------
L8IVA4_BCL2L11-01          RPGAPTSL-QTERQ------------------------------------
L8IVA4_BCL2L11-02          RPGAPTSL-QTERQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R8M6L7_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A2R8M6L7_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A8C0L5G0_BCL2L11-02      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C0L5G0_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
A0A8C0NKD6_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8C0NKD6_BCL2L11-03      RPGAPTSL-QTEQQ------------------------------------
A0A8C0NKD6_BCL2L11-02      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C0S6I7_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A8C0S6I7_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8C0S6I7_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
A0A452FCR6_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A452FCR6_BCL2L11-02      RPGAPTSL-QTERQ------------------------------------
A0A8C2P0X3_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8C2P0X3_BCL2L11-03      RPGAPTSL-QTERQ------------------------------------
A0A3G3M2M0_BCL2L11-01      A-GVGAAL-RPGHF--D--FPQ----------------------------
A0A1U7SU38_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A1U7SU38_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A1U7SU38_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A1U7SU38_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A1U7SU38_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A250YBV9_BCL2L11-01      RPGAPTSL-QTEPP--G--NPE----------------------------
A0A250YBV9_BCL2L11-02      RPGAPTSL-QTEPP------------------------------------
A0A8C3X5Q0_BCL2L11-04      RPGAPTSL-QTERQ------------------------------------
A0A8C3X5Q0_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8C3X5Q0_BCL2L11-02      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8C3X5Q0_BCL2L11-05      RPGAPTSL-QTERQ------------------------------------
A0A286XJN2_BCL2L11-02      RAGAPTSL-QTEPQ------------------------------------
A0A286XJN2_BCL2L11-01      RAGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-10      RPGAPTSL-QT---------------------------------------
A0A2K5Q1U2_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-01      RPGAPTSL-QTEPQ------------------------------------
A0A2K5Q1U2_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A2K5NTQ5_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A2K5NTQ5_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5NTQ5_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C0QRC8_BCL2L11-01      RPGAPTSI-QTQYQ--G--NHS----------------------------
A0A8C3RZA1_BCL2L11-02      RPGAPTSI-QTQYQ------------------------------------
A0A8C2UYE1_BCL2L11-03      RPGALTSL-QTEPQ------------------------------------
A0A8C2UYE1_BCL2L11-01      RPGALTSL-QTEPQ------------------------------------
A0A8C3FX85_BCL2L11-01      RPGAPTSI-QTQYQ--G--NHS----------------------------
A0A2K5HZ87_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5HZ87_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A2K5HZ87_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A2K5HZ87_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A8C2QK28_BCL2L11-01      RPGAPTSL-QTEPQ------------------------------------
A0A8C3NS85_BCL2L11-01      RPGAPAAL-PGAG-------------------------------------
A0A8C1CBG6_BCL2L11-02      A-GGGAVL-RTEHF--D--FPQ----------------------------
A0A8C2L5J3_BCL2L11-02      A-GGGAAS-RSGHF--D--FPQ----------------------------
A0A8C2L5J3_BCL2L11-01      A-GGGAAS-RSGHF--D--FPQ----------------------------
B8JK68_BCL2L11-01          T-GGGVVL-PAGHF--D--FPQ----------------------------
A0A2Y9Q753_BCL2L11-01      RPGAPISL-QTERQ--G--NPE----------------------------
A0A2Y9Q753_BCL2L11-02      RPGAPISL-QTERQ------------------------------------
A0A8C4LFQ1_BCL2L11-03      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8C4LFQ1_BCL2L11-08      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8C4LFQ1_BCL2L11-06      RPGAPTSL-QIEQQ------------------------------------
A0A8C4LFQ1_BCL2L11-05      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8C4LFQ1_BCL2L11-04      RPGAPTSL-QIEQQ------------------------------------
A0A8C4LFQ1_BCL2L11-02      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A5F5PK35_BCL2L11-04      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A8C4TR55_BCL2L11-03      RPGAPAAL-PGSA-------------------------------------
A0A8C4TR55_BCL2L11-02      RPGAPAAL-PGSA-------------------------------------
A0A2I2UX96_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A2I2UX96_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A2I2UX96_BCL2L11-03      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A2I2UX96_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C4VJX6_BCL2L11-02      RPGAPTSI-QTQYQ------------------------------------
A0A2I2Y4B3_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A2I2Y4B3_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I2Y4B3_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I2Y4B3_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A2I2Y4B3_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
A0A2I2Y4B3_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A2I2Y4B3_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0P6J9X4_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0P6J9X4_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0P6J9X4_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A0C4DH20_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A0C4DH20_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A0C4DH20_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      NPGGGAAS-GAEPT--D--IPQ----------------------------
A0A287DFJ0_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A287DFJ0_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C5L6N3_BCL2L11-02      RPGAPTSL-QTVPQ--G--NPE----------------------------
A0A4W6ETK4_BCL2L11-01      SDGSTEVT-AREES-GG--DPHVDGAAGASAQTSRSN---DGGGGGERS-
A0A8C5STS5_BCL2L11-01      RPGAPTSL-QTEYQ--G--NHL----------------------------
A0A667H9R7_BCL2L11-04      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A667H9R7_BCL2L11-03      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A667H9R7_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
A0A2K5X1Y3_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-08      RPGAPTSL-QTEPQ------------------------------------
F7HHA1_BCL2L11-03          RPGAPTSL-QTEPQ------------------------------------
A0A2K6E1Z6_BCL2L11-04      RPGAPTSL-QTD--------------------------------------
A0A2K5Z7V3_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A2K5Z7V3_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A8C5YNZ8_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C5YNZ8_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8B7EUP7_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8B7EUP7_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8B7EUP7_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C6C635_BCL2L11-01      RPGAPISL-QTERQ------------------------------------
A0A8C6DRY6_BCL2L11-02      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8C6DRY6_BCL2L11-03      RPGAPTSL-QTERQ------------------------------------
A0A8C6DRY6_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
O54918_BCL2L11-06          RPGAPTSL-QTEPQ------------------------------------
O54918_BCL2L11-05          RPGAPTSL-QTEPQ------------------------------------
O54918_BCL2L11-04          RPGAPTSL-QTEPQ--G--NPD----------------------------
A0A8C6HGQ3_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
M3YDI3_BCL2L11-01          RPGAPTSL-QTEQQ------------------------------------
A0A8C6VGF4_BCL2L11-01      RPGAPTSL-QTEYQ--G--NHL----------------------------
A0A8C6QXX9_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C6QXX9_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A8C7BAK5_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C7BAK5_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8C7BAK5_BCL2L11-03      RPGAPTSL-QTEQQ------------------------------------
A0A8C7BAK5_BCL2L11-02      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A2I3GAA1_BCL2L11-08      RPGAPTSL-QTEPQ------------------------------------
A0A2I3GAA1_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C7HIL6_BCL2L11-02      NPGGGAAS-GAEPT--D--NPQ----------------------------
A0A8C7HIL6_BCL2L11-01      NPGGGAAS-GAEPT--D--NPQ----------------------------
A0A8C7L4D1_BCL2L11-01      HPGGGAAS-RAEPS--D--NPQ----------------------------
A0A8C7V9R7_BCL2L11-01      --GGGAAS-RAEPS--D--NPQ----------------------------
A0A8C8FY48_BCL2L11-01      NPGGGAAS-GAEPT--D--NPQ----------------------------
A0A6I8NCK5_BCL2L11-02      RPGAPTSI-RTQYQ------------------------------------
A0A5F9C9V3_BCL2L11-02      RPGAPTSL-QSEPQ--G--NPE----------------------------
H0XW23_BCL2L11-01          RPGAPTSL-HTEPQ--G--NPE----------------------------
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      RPGAPTSL-QTEPQ------------------------------------
A0A8C8Y6N0_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A096NYC3_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A096NYC3_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A6I9LW27_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C9CBP3_BCL2L11-03      RPGAPISL-QTERQ--G--NPE----------------------------
A0A2Y9T3Y6_BCL2L11-03      RPGAPISL-QTERQ--G--NPE----------------------------
A0A2Y9T3Y6_BCL2L11-02      RPGAPISL-QTERQ--G--NPE----------------------------
A0A2Y9T3Y6_BCL2L11-01      RPGAPISL-QTERQ------------------------------------
A0A8C9I5G9_BCL2L11-06      RPGAPTSL-QTEPQ------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      RPGAPTSL-QTVYQ--G--NHS----------------------------
A0A3B3YII5_BCL2L11-02      LDGSTEVT-PAEGT-GG--DPAS------SARTPRSS---KH---TERSC
A0A2J8SGU7_BCL2L11-05      RPGAPTSL-QTEPQ------------------------------------
A0A2J8SGU7_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2J8SGU7_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8C8ZU60_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C8ZU60_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
A0A8C8ZU60_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6GE22_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6GE22_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6GE22_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A2K6GE22_BCL2L11-06      RPGAPTSL-QTEPQ------------------------------------
A0A2K6GE22_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6GE22_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A670Y3D3_BCL2L11-01      RPGAPTSL-QTEYQ--G--NHL----------------------------
A0A8I5ZK47_BCL2L11-04      RPGAPTSL-QTESQ------------------------------------
A0A8I5ZK47_BCL2L11-02      RPGAPTSL-QTESQ------------------------------------
O88498_BCL2L11-01          --------------------------------------------------
A0A671FCV3_BCL2L11-01      RPGAPTSV-QIERQ--G--NPE----------------------------
A0A671FCV3_BCL2L11-04      RPGAPTSV-QIERQ--G--NPE----------------------------
A0A2K6KJM8_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6KJM8_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6KJM8_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6KJM8_BCL2L11-09      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6KJM8_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6KJM8_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A2K6TRJ7_BCL2L11-09      RPGAPTSL-QTEPQ------------------------------------
A0A2K6TRJ7_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A2K6TRJ7_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A673WET2_BCL2L11-01      NPGGGAAS-GAEPT--D--NPQ----------------------------
A0A7N4NUH6_BCL2L11-02      RPGAPTSI-QTQYQ--G--N------------------------------
A0A7N4NUH6_BCL2L11-04      RPGAPTSI-QTQYQ------------------------------------
A0A8D2B0V4_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8D2B0V4_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPQ----------------------------
A0A8D2D0L1_BCL2L11-01      RPGAPTSL-QTD--------------------------------------
A0A671M057_BCL2L11-01      A-GGGAVV-RSGYF--D--FPQ----------------------------
A0A671SJ75_BCL2L11-01      A-GGGAVL-RSGHF--D--FPQ----------------------------
A0A672L1R2_BCL2L11-01      A-GGAAVL-GSGHF--D--FPQ----------------------------
A0A672PQD1_BCL2L11-01      A-GGAAVL-GSGHF--D--FPQ----------------------------
A0A673NIJ7_BCL2L11-01      --------------------------------------------------
A0A8C9PPC0_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8D0H1T5_BCL2L11-01      RPGAPTSI-QTQYQ--G--NHS----------------------------
A0A673SRF7_BCL2L11-03      RPGAPTSL-QTQRQ--G--NPE----------------------------
A0A673SRF7_BCL2L11-01      RPGAPTSL-QTQRQ--G--NPE----------------------------
A0A4X1VMQ3_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A4X1VMQ3_BCL2L11-02      RPGAPTSL-QTERQ------------------------------------
A0A4X1VMQ3_BCL2L11-04      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A4X1VRX9_BCL2L11-01      RPGAPTSL-QTERQ------------------------------------
C1KGB8_BCL2L11-01          RPGAPTSL-QTERQ------------------------------------
A0A674IAI8_BCL2L11-01      RPGAPTSI-QTQYQ--G--NHS----------------------------
A0A8D2E0B6_BCL2L11-05      RPGAPTSL-QTEPQ------------------------------------
A0A452SBG5_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
Q3KPZ6_BCL2L11-01          RRGAPTSL-SSPFQ--G--NQS----------------------------
A0A3B5QAM1_BCL2L11-01      LDGSTEVT-PAEGT-GG--DPAS------SARTPRSS---KH---TERSR
A0A8C0NKD6_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C0RM03_BCL2L11-03      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C0S6I7_BCL2L11-05      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8I3N1T0_BCL2L11-02      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A2K5CA52_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6TRJ7_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A8C9CBP3_BCL2L11-02      RPGAPISL-QTERQ--G--NPE----------------------------
A0A8C9CBP3_BCL2L11-01      RPGAPISL-QTERQ------------------------------------
A0A8C6C635_BCL2L11-03      RPGAPISL-QTERQ--G--NPE----------------------------
A0A8C9CBP3_BCL2L11-04      RPGAPISL-QTERQ--G--NPE----------------------------
A0A2K5Q1U2_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A3Q7S5V2_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A8C0RM03_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8C0S6I7_BCL2L11-06      RPGAPTSL-QTEQQ------------------------------------
A0A8I3N1T0_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8C0RM03_BCL2L11-01      RPGAPTSL-QTEQQ------------------------------------
A0A6P3TPJ5_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A286XJN2_BCL2L11-03      RAGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5HZ87_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
F7HHA1_BCL2L11-01          RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Z7V3_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8C9I5G9_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8D2E0B6_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I2Y4B3_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Z7V3_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3GAA1_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R9BZX9_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5HZ87_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I2Y4B3_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-10      RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-10          RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Z7V3_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3GAA1_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R9BZX9_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5HZ87_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Z7V3_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A096NYC3_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8C9I5G9_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8D2E0B6_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A2K5Z7V3_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A2K5HZ87_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I2Y4B3_BCL2L11-10      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-13      RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-13          RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-09      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Z7V3_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3GAA1_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R9BZX9_BCL2L11-10      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-09      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-05      RPGAPTSL-QTEPQ------------------------------------
A0A2K6E1Z6_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A096NYC3_BCL2L11-06      RPGAPTSL-QTEPQ------------------------------------
A0A8D2E0B6_BCL2L11-07      RPGAPTSL-QTEPQ------------------------------------
A0A2K5HZ87_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5X1Y3_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6E1Z6_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5Z7V3_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A096NYC3_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8C9I5G9_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8D2E0B6_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K5HZ87_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A2K6E1Z6_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A2K5Z7V3_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C9I5G9_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A2K6KJM8_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A8D2E0B6_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C9I5G9_BCL2L11-05      RPGAPTSL-QTEPQ------------------------------------
A0A2K6KJM8_BCL2L11-08      RPGAPTSL-QTEPQ------------------------------------
A0A2K6QIJ1_BCL2L11-08      RPGAPTSL-QTEPQ------------------------------------
A0A8C6C635_BCL2L11-02      RPGAPISL-QTERQ--G--NPE----------------------------
A0A5F5PK35_BCL2L11-01      RPGAPTSL-QIEQQ------------------------------------
A0A5F5PK35_BCL2L11-03      RPGAPTSL-QIEQQ--G--NPG----------------------------
A0A667H9R7_BCL2L11-05      RPGAPTSL-QTEQQ------------------------------------
A0A8C8Y6N0_BCL2L11-04      RPGAPTSL-QTEQQ------------------------------------
A0A8C9JC73_BCL2L11-06      RPGAPTSL-QTEQQ------------------------------------
A0A667H9R7_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A0C4DH20_BCL2L11-11      RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-11          RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R9BZX9_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-05          RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3GAA1_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R9BZX9_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A0C4DH20_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-04          RPGAPTSL-QTEPQ------------------------------------
A0A2R9BZX9_BCL2L11-03      RPGAPTSL-QTEPQ------------------------------------
A0A2I3S5F6_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
A0A2J8SGU7_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
A0A0C4DH20_BCL2L11-14      RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-14          RPGAPTSL-QTEPQ------------------------------------
A0A2I3GAA1_BCL2L11-06      RPGAPTSL-QTEPQ------------------------------------
A0A2I3S5F6_BCL2L11-08      RPGAPTSL-QTEPQ------------------------------------
A0A2I3GAA1_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2R9BZX9_BCL2L11-08      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2J8SGU7_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-01          RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-12          RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-09          RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-07          RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-06          RPGAPTSL-QTEPQ--G--NPE----------------------------
O43521_BCL2L11-03          RPGAPTSL-QTEPQ------------------------------------
A0A2R9BZX9_BCL2L11-04      RPGAPTSL-QTEPQ------------------------------------
A0A2I3S5F6_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-08          RPGAPTSL-QTEPQ------------------------------------
O43521_BCL2L11-02          RPGAPTSL-QTEPQ------------------------------------
A0A8D2KQ57_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8D2KQ57_BCL2L11-01      RPGAPTSL-QTEPQ------------------------------------
A0A8C8Y6N0_BCL2L11-02      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C9JC73_BCL2L11-05      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C9JC73_BCL2L11-03      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A096NYC3_BCL2L11-05      RPGAPTSL-QTEPQ------------------------------------
A0A8D2E0B6_BCL2L11-06      RPGAPTSL-QTEPQ------------------------------------
A0A8B7EUP7_BCL2L11-03      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2I3S5F6_BCL2L11-02      RPGAPTSL-QTEPQ------------------------------------
A0A8C9JC73_BCL2L11-01      RPGAPTSL-QTEQQ--G--NPE----------------------------
A0A8C9JC73_BCL2L11-02      RPGAPTSL-QTEQQ------------------------------------
A0A3B3YII5_BCL2L11-01      LDGSTEVT-PAEGT-GG--DPAS------SARTPRSS---KH---TERSC
A0A2K6KJM8_BCL2L11-02      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-05      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-04      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-10      RPGAPTSL-QTEPQ------------------------------------
A0A2K6QIJ1_BCL2L11-09      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-07      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-06      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A2K6QIJ1_BCL2L11-01      RPGAPTSL-QTEPQ--G--NPE----------------------------
A0A8D0C9E7_BCL2L11-03      RFDAPTSL-QTEYP--G--NLS----------------------------
A0A8D0C9E7_BCL2L11-04      RFDAPTSL-QTEYP--G--NLS----------------------------
A0A4X1VRX9_BCL2L11-02      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JJW3_BCL2L11-04      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JTL2_BCL2L11-05      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D1A276_BCL2L11-02      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A4X1VRX9_BCL2L11-06      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JJW3_BCL2L11-02      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JTL2_BCL2L11-01      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JTL2_BCL2L11-02      RPGAPTSL-QTERQ------------------------------------
A0A4X1VRX9_BCL2L11-03      RPGAPTSL-QTERQ------------------------------------
A0A8D0JJW3_BCL2L11-01      RPGAPTSL-QTERQ------------------------------------
A0A8D0JTL2_BCL2L11-04      RPGAPTSL-QTERQ------------------------------------
A0A8D1A276_BCL2L11-05      RPGAPTSL-QTERQ------------------------------------
A0A4X1VRX9_BCL2L11-04      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JJW3_BCL2L11-03      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JTL2_BCL2L11-03      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D1A276_BCL2L11-04      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A8D0JJW3_BCL2L11-06      RPGAPTSL-QTERQ------------------------------------
A0A8D1A276_BCL2L11-03      RPGAPTSL-QTERQ------------------------------------
A0A8D0JJW3_BCL2L11-05      RPGAPTSL-QTERQ--G--NPE----------------------------
A0A803KLJ9_BCL2L11-03      RRGAPTSL-SSPFQ--G--NQS----------------------------
                                                                             

A0A4W3IWD3_BCL2L11-01      --------------------------------------------------
A0A4W3IWD3_BCL2L11-02      --------------------------------------------------
A0A4W3IWD3_BCL2L11-03      --------------------------------------------------
M3XHJ5_BCL2L11-01          --------------------------------R----W-RD-------R-
A0A3B5M375_BCL2L11-01      APQAGASTAGGGGGGEGEGR-R----------G----E-PD-------S-
A0A3P9N073_BCL2L11-01      APQAGASTAGGGGGG----G-R----------G----E-PD-------S-
A0A3B3QC78_BCL2L11-01      --------------------------------------------------
A0A803WCD8_BCL2L11-01      --------------------------------------------------
A0A4W6ETK4_BCL2L11-03      --------------------------------A----E-LW-------PP
A0A8D3BD31_BCL2L11-01      --------------------------------------------------
A0A8D0D024_BCL2L11-01      --------------------------------A----D--W-------PY
A0A3B4V919_BCL2L11-01      --------------------------------A----E-PW-------PP
A0A3B4XZH1_BCL2L11-01      --------------------------------A----E-TI-------A-
A0A8C3MHM7_BCL2L11-01      --------------------------------------------------
A0A8B9I6Q1_BCL2L11-01      --------------------------------------------------
A0A8C4J5J5_BCL2L11-01      --------------------------------------------------
A0A8C3Q5R4_BCL2L11-01      --------------------------------------------------
A0A3P8RLE2_BCL2L11-01      ---------------------G----------G----E-PD-------S-
A0A3Q1CI15_BCL2L11-01      ---------------------H----------G----S-PD-------S-
A0A3Q1ELG4_BCL2L11-01      ---------------------G----------G----E-PD-------S-
A0A669C520_BCL2L11-01      ---------------------G----------G----E-PD-------S-
A0A3Q3K6I5_BCL2L11-01      ---FGHPG---------SAG-G----------G----E-PV-------S-
A0A3Q2SZH6_BCL2L11-01      AQPPGAVTAA-------GGG-G----------G----E-PD-------S-
A0A3B3VNE0_BCL2L11-01      APQTGASTAGGGGGGG-GGG-G----------G----E-PD-------A-
A0A671W556_BCL2L11-01      ---SGQPS---------TSG-G----------G----E-PD-------S-
A0A673CKA1_BCL2L11-01      ---PGFTG---------PTGEG----------R----E-PD-------S-
A0A667ZMY7_BCL2L11-01      ---RGHAA---------P-P-G----------G----K-GD-------S-
A0A3Q3B113_BCL2L11-01      ---RGRAP---------SAA-G----------G----E-PE-------S-
A0A803SRF0_BCL2L11-01      --------------------------------------------------
A0A3Q3SYA1_BCL2L11-01      ---------------------------------------SV-------S-
A0A3B5QAM1_BCL2L11-02      APQAGASTAGGGGGGEGGGR-R----------G----E-PD-------S-
A0A4W6ETK4_BCL2L11-02      ---FGHRG---------STG-G----------G----ELAD-------S-
A0A3Q3ESW6_BCL2L11-01      ---FGRTD---------STG-G----------G----E-PD-------S-
A0A8P4G4W6_BCL2L11-01      ---VGRRS---------SSG-G----------G----E-PD-------S-
A0A3Q1ICY2_BCL2L11-01      ---FGRPD---------SSG-G----------G----E-PE-------S-
A0A673XGV4_BCL2L11-01      -----------------S--------------C----E-GD-------Q-
A0A4W4H3Y1_BCL2L11-01      -----------------P--------------N----Q-GD-------Q-
A0A4W4H3Y1_BCL2L11-02      -----------------P--------------N----Q-GD-------Q-
A0A8C8F2F2_BCL2L11-01      -----------------S--------------C----E-GD-------Q-
A0A4W5NF23_BCL2L11-01      -----------------S--------------C----E-GD-------Q-
A0A3B4BSH7_BCL2L11-01      -----------------P--------------G----E-GD-------P-
A0A4W5R3N6_BCL2L11-02      -----------------F--------------S----E-GD-------Q-
B2KKY9_BCL2L11-01          -----------------P--------------G----E-GD-------P-
A0A4W5R3N6_BCL2L11-03      -----------------F--------------S----E-GD-------Q-
A0A8C1CBG6_BCL2L11-01      -----------------P--------------S----E-GD-------P-
W5UEE7_BCL2L11-01          -----------------H--------------R----E-LE-------V-
A0A3B4BSH7_BCL2L11-03      -----------------P--------------G----E-GD-------P-
A0A8C9VIN6_BCL2L11-01      -----------------P--------------G----R-GD-------Q-
A0A3B1JXK6_BCL2L11-01      -----------------P--------------G----D-GD-------P-
A0A3B4BSH7_BCL2L11-02      -----------------P--------------G----E-GD-------P-
A0A8L0DSD4_BCL2L11-01      -----------------F--------------S----E-GE-------Q-
A0A3P8XIA2_BCL2L11-01      -----------------S--------------C----E-GN-------Q-
A0A673IWZ7_BCL2L11-01      -----------------P--------------S----D-GD-------P-
A0A8C0B3C7_BCL2L11-01      --------------------------------------------------
A0A8D0FSN5_BCL2L11-01      --------------------------------------------------
A0A8C2TYI5_BCL2L11-01      --------------------------------------------------
A0A803VLS8_BCL2L11-01      --------------------------------------------------
G1MV54_BCL2L11-01          --------------------------------------------------
A0A8D2NVM3_BCL2L11-01      --------------------------------------------------
A0A8C5UI47_BCL2L11-01      -------------------------------------V-AA---------
A0A8C0FLD7_BCL2L11-01      --------------------------------------------------
A0A8C3JX57_BCL2L11-01      --------------------------------------------------
A0A8C3DG03_BCL2L11-01      --------------------------------------------------
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
A0A669QMB4_BCL2L11-01      ----------------------------------------R-------P-
A0A8C5IZK3_BCL2L11-01      --------------------------------------------------
A0A8C3TPU0_BCL2L11-01      --------------------------------------------------
A0A8B9MPS6_BCL2L11-01      ----------------------------------------A-------A-
A0A8C9EIW6_BCL2L11-01      ----------------------------------------R-------P-
A0A2K5CA52_BCL2L11-10      --------------------------------------------------
A0A8V0Z3E3_BCL2L11-01      --------------------------------------------------
A0A8B9T738_BCL2L11-02      --------------------------------------------------
A0A8C3BDR3_BCL2L11-01      -----------------SSS-SSSSSSSPSSSA----A-AR-------P-
A0A8B9VXZ3_BCL2L11-01      --------------------------------------------------
A0A8C2TW35_BCL2L11-01      ----------------------------------------R-------P-
U3IW89_BCL2L11-01          --------------------------------------------------
A0A663E970_BCL2L11-01      --------------------------------------------------
A0A8V0Z3R2_BCL2L11-01      ----------------------------------------R-------P-
A0A8B9VVW8_BCL2L11-01      --------------------------------------------------
A0A8C3BDR3_BCL2L11-02      -----------------SSS-SSSSSSSPSSSA----A-AR-------P-
A0A663MLZ1_BCL2L11-01      --------------------------------------------------
A0A8B9EP68_BCL2L11-01      --------------------------------------------------
A0A5F8H037_BCL2L11-02      -------------------------------SG----E-GD-------S-
A0A672TST9_BCL2L11-01      ----------------------------------------A-------T-
A0A674H354_BCL2L11-01      ----------------------------------------P-------V-
A0A8C5STS5_BCL2L11-02      --------------------------------G----E-RD-------S-
A0A2K5NTQ5_BCL2L11-07      --------------------------------------------------
A0A7M4F197_BCL2L11-01      --------------------------------------------------
A0A8C0UNY9_BCL2L11-01      --------------------------------------------------
A0A671FCV3_BCL2L11-02      --------------------------------G----E-GD-------R-
A0A8C4REW7_BCL2L11-02      --------------------------------G----E-VS-------Q-
A0A8D0C9E7_BCL2L11-02      --------------------------------G----E-QD-------S-
A0A5F9C9V3_BCL2L11-01      --------------------------------------------------
A0A8C5QSK2_BCL2L11-01      --------------------------------N----E-GG-------S-
A0A4X1VRX9_BCL2L11-05      --------------------------------G----E-GD-------R-
A0A8C8SQS1_BCL2L11-01      --------------------------------------------------
A0A8D0C9E7_BCL2L11-01      --------------------------------G----E-QD-------S-
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A803KLJ9_BCL2L11-02      --------------------------------D----E-GG-------S-
A0A6I8NCK5_BCL2L11-04      --------------------------------G----G-GE-------S-
A0A8C3X5Q0_BCL2L11-03      --------------------------------G----E-GD-------R-
A0A0P6J9X4_BCL2L11-04      --------------------------------GSPEVE-GD-------R-
A0A5F5PK35_BCL2L11-02      --------------------------------G----E-GD-------R-
A0A8C3RZA1_BCL2L11-01      --------------------------------G----E-GDFAQQPSGS-
A0A803KLJ9_BCL2L11-01      --------------------------------D----E-GG-------S-
A0A8D2Q5M7_BCL2L11-01      --------------------------------G----E-WD-------I-
A0A8C4REW7_BCL2L11-01      --------------------------------G----E-VS-------Q-
A0A0P6J9X4_BCL2L11-01      --------------------------------GSPEVE-GD-------R-
A0A2R8M6L7_BCL2L11-01      -----------------GNH-G----------G----E-GD-------S-
A0A6I9LW27_BCL2L11-01      -----------------G---G----------G----E-GD-------R-
A0A8C6HGQ3_BCL2L11-02      --------------------------------G----E-GD-------R-
A0A8C2QK28_BCL2L11-02      --------------------------------G----D-GD-------R-
G3SU55_BCL2L11-01          --------------------------------G----E-GD-------S-
A0A8C4LFQ1_BCL2L11-07      --------------------------------G----E-GD-------R-
A0A8D2MQT6_BCL2L11-01      --------------------------------------------------
A0A8C9JC73_BCL2L11-04      --------------------------------G----E-GD-------R-
A0A8C8ZU60_BCL2L11-01      -----------------GSR-E----------G----E-GD-------R-
A0A2R8M6L7_BCL2L11-08      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-05      -----------------GNH-G----------G----E-GD-------S-
A0A8C3TPU0_BCL2L11-03      --------------------------------------------------
A0A8C0RM03_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-03      --------------------------------------------------
A0A2K5CA52_BCL2L11-05      -----------------GNH-G----------G----E-GD-------S-
A0A8B7EUP7_BCL2L11-06      -----------------GSR-E----------G----E-GD-------R-
A0A1U7SU38_BCL2L11-04      -----------------GSP-G----------G----E-GD-------R-
A0A8D1A276_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A8C9PPC0_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A2R8M6L7_BCL2L11-02      -----------------GNH-G----------G----E-GD-------S-
A0A8C6HGQ3_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A8C2P0X3_BCL2L11-02      --------------------------------G----E-GD-------R-
A0A8B9QMZ1_BCL2L11-01      --------------------------------G----E-GD-------P-
A0A5F5PK35_BCL2L11-05      --------------------------------G----E-GD-------R-
A0A8B7EUP7_BCL2L11-05      -----------------GSR-E----------G----E-GD-------R-
A0A0P6J9X4_BCL2L11-03      --------------------------------------------------
A0A7N4NUH6_BCL2L11-03      --------------------------------G----E-GD-------S-
A0A8C3FX85_BCL2L11-02      --------------------------------G----E-GD-------F-
A0A0P6J9X4_BCL2L11-05      -----------------GSP-E----------V----E-GD-------R-
A0A4X1VMQ3_BCL2L11-03      --------------------------------G----E-GD-------R-
A0A8I5ZK47_BCL2L11-03      --------------------------------G----E-GD-------R-
A0A8C3TPU0_BCL2L11-02      --------------------------------------------------
F7HHA1_BCL2L11-02          -----------------GNH-G----------G----E-GD-------S-
A0A8I3N1T0_BCL2L11-03      -----------------G-------------------E-GD-------R-
O54918_BCL2L11-03          --------------------------------------------------
A0A7N5JE15_BCL2L11-02      --------------------------------------------------
A0A4X2L9J9_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-03      --------------------------------------------------
A0A8C3TPU0_BCL2L11-04      --------------------------------------------------
A0A8C9NMA1_BCL2L11-01      --------------------------------------------------
A0A7M4F197_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-03      -----------------G-------------------E-GD-------R-
A0A7N5JE15_BCL2L11-04      --------------------------------------------------
A0A8I3N1T0_BCL2L11-01      --------------------------------------------------
A0A3Q7S5V2_BCL2L11-01      --------------------------------------------------
G1PDJ5_BCL2L11-01          --------------------------------------------------
A0A8C4VJX6_BCL2L11-01      --------------------------------------------------
A0A8C3DC27_BCL2L11-01      --------------------------------------------------
A0A2K6KJM8_BCL2L11-10      --------------------------------------------------
A0A8C4TR55_BCL2L11-01      --------------------------------------------------
A0A0C4DH20_BCL2L11-12      --------------------------------------------------
K7GA86_BCL2L11-01          --------------------------------------------------
A0A8I5ZK47_BCL2L11-01      --------------------------------------------------
A0A8C2UYE1_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-01      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-03      --------------------------------------------------
A0A8B9T738_BCL2L11-01      --------------------------------------------------
A0A7N5JE15_BCL2L11-07      --------------------------------------------------
A0A673SRF7_BCL2L11-04      --------------------------------------------------
A0A6I9LW27_BCL2L11-03      --------------------------------------------------
A0A8C2P0X3_BCL2L11-04      --------------------------------------------------
A0A452U4S4_BCL2L11-01      --------------------------------------------------
A0A0D9RWE0_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-09      --------------------------------------------------
A0A5F8H037_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-08      --------------------------------------------------
A0A7N4NUH6_BCL2L11-01      --------------------------------------------------
A0A8B7EUP7_BCL2L11-07      --------------------------------------------------
A0A8C2P0X3_BCL2L11-05      --------------------------------------------------
A0A8C6QXX9_BCL2L11-03      --------------------------------------------------
A0A1U7SU38_BCL2L11-07      --------------------------------------------------
A0A6I8NCK5_BCL2L11-01      --------------------------------------------------
A0A8B9YZT6_BCL2L11-01      --------------------------------------------------
A0A4X1VMQ3_BCL2L11-05      --------------------------------------------------
A0A0P6J9X4_BCL2L11-02      --------------------------------------------------
A0A6I8NCK5_BCL2L11-03      --------------------------------------------------
A0A6I8NCK5_BCL2L11-05      --------------------------------------------------
A0A673SRF7_BCL2L11-02      --------------------------------------------------
A0A7N5JE15_BCL2L11-01      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-01      --------------------------------------------------
A0A2J8SGU7_BCL2L11-06      --------------------------------------------------
A0A7N5JE15_BCL2L11-06      -----------------G-------------------E-GD-------R-
A0A7N5JE15_BCL2L11-05      -----------------G-------------------E-GD-------R-
A0A2K5CA52_BCL2L11-03      -----------------GNH-G----------G----E-GD-------S-
A0A2K5CA52_BCL2L11-09      --------------------------------------------------
A0A2K5CA52_BCL2L11-08      -----------------GNH-G----------G----E-GD-------S-
A0A2K5CA52_BCL2L11-07      -----------------GNH-G----------G----E-GD-------S-
A0A2K5CA52_BCL2L11-06      -----------------GNH-G----------G----E-GD-------S-
A0A2K5CA52_BCL2L11-04      -----------------GNH-G----------G----E-GD-------S-
A0A2K5CA52_BCL2L11-02      --------------------------------------------------
A0A663E983_BCL2L11-01      --------------------------------------------------
A0A8B9HBP0_BCL2L11-01      -----------------P--------------G----D-GD-------P-
A0A8B8Z6B1_BCL2L11-04      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A8B8Z6B1_BCL2L11-02      --------------------------------------------------
A0A8B8Z6B1_BCL2L11-03      -----------------G-------------------E-GD-------R-
L8IVA4_BCL2L11-01          --------------------------------------------------
L8IVA4_BCL2L11-02          --------------------------------G----E-GD-------R-
A0A2R8M6L7_BCL2L11-04      -----------------GNH-G----------G----E-GD-------S-
A0A2R8M6L7_BCL2L11-05      -----------------GNH-G----------G----E-GD-------S-
A0A2R8M6L7_BCL2L11-06      -----------------GNH-G----------G----E-GD-------S-
A0A2R8M6L7_BCL2L11-07      --------------------------------------------------
A0A2R8M6L7_BCL2L11-03      --------------------------------------------------
A0A8C0L5G0_BCL2L11-02      -----------------G-------------------E-GD-------R-
A0A8C0L5G0_BCL2L11-01      --------------------------------------------------
A0A8C0NKD6_BCL2L11-04      --------------------------------------------------
A0A8C0NKD6_BCL2L11-03      --------------------------------------------------
A0A8C0NKD6_BCL2L11-02      -----------------G-------------------E-GD-------R-
A0A8C0S6I7_BCL2L11-02      --------------------------------------------------
A0A8C0S6I7_BCL2L11-04      --------------------------------------------------
A0A8C0S6I7_BCL2L11-01      --------------------------------------------------
A0A452FCR6_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A452FCR6_BCL2L11-02      --------------------------------------------------
A0A8C2P0X3_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A8C2P0X3_BCL2L11-03      --------------------------------------------------
A0A3G3M2M0_BCL2L11-01      -----------------P--------------S----D-GD-------P-
A0A1U7SU38_BCL2L11-03      -----------------GSP-G----------G----E-GD-------R-
A0A1U7SU38_BCL2L11-06      -----------------GSP-G----------G----E-GD-------R-
A0A1U7SU38_BCL2L11-05      -----------------GSP-G----------G----E-GD-------R-
A0A1U7SU38_BCL2L11-01      -----------------GSP-G----------G----E-GD-------R-
A0A1U7SU38_BCL2L11-02      --------------------------------------------------
A0A250YBV9_BCL2L11-01      -----------------GSP-A----------G----E-GD-------R-
A0A250YBV9_BCL2L11-02      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-04      --------------------------------------------------
A0A8C3X5Q0_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A8C3X5Q0_BCL2L11-02      -----------------G-------------------E-GD-------R-
A0A8C3X5Q0_BCL2L11-05      --------------------------------------------------
A0A286XJN2_BCL2L11-02      --------------------------------------------------
A0A286XJN2_BCL2L11-01      -----------------G-------------------A-GD-------R-
A0A2K5Q1U2_BCL2L11-08      -----------------GNH-G----------G----E-GD-------S-
A0A2K5Q1U2_BCL2L11-10      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-02      -----------------GNH-G----------G----E-GD-------S-
A0A2K5Q1U2_BCL2L11-04      -----------------GNH-G----------G----E-GD-------S-
A0A2K5Q1U2_BCL2L11-05      -----------------GNH-G----------G----E-GD-------S-
A0A2K5Q1U2_BCL2L11-06      -----------------GNH-G----------G----E-GD-------S-
A0A2K5Q1U2_BCL2L11-01      --------------------------------------------------
A0A2K5Q1U2_BCL2L11-03      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-01      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-03      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-06      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-08      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-09      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-10      --------------------------------------------------
A0A2K5NTQ5_BCL2L11-04      -----------------GNH-G----------G----E-GD-------S-
A0A2K5NTQ5_BCL2L11-02      --------------------------------------------------
A0A8C0QRC8_BCL2L11-01      --------------------------------G----E-GDFAQQPSGS-
A0A8C3RZA1_BCL2L11-02      --------------------------------------------------
A0A8C2UYE1_BCL2L11-03      --------------------------------------------------
A0A8C2UYE1_BCL2L11-01      --------------------------------------------------
A0A8C3FX85_BCL2L11-01      --------------------------------G----E-GD-------F-
A0A2K5HZ87_BCL2L11-03      -----------------GNH-G----------G----E-GD-------S-
A0A2K5HZ87_BCL2L11-10      --------------------------------------------------
A0A2K5HZ87_BCL2L11-09      --------------------------------------------------
A0A2K5HZ87_BCL2L11-07      --------------------------------------------------
A0A8C2QK28_BCL2L11-01      --------------------------------------------------
A0A8C3NS85_BCL2L11-01      ----------------------------------------P-------V-
A0A8C1CBG6_BCL2L11-02      -----------------P--------------S----E-GD-------P-
A0A8C2L5J3_BCL2L11-02      -----------------P--------------S----D-GD-------P-
A0A8C2L5J3_BCL2L11-01      -----------------P--------------S----D-GD-------P-
B8JK68_BCL2L11-01          -----------------P--------------G----E-GD-------P-
A0A2Y9Q753_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A2Y9Q753_BCL2L11-02      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-03      --------------------------------G----E-GD-------R-
A0A8C4LFQ1_BCL2L11-08      --------------------------------G----E-GD-------R-
A0A8C4LFQ1_BCL2L11-06      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-05      -----------------G-------------------E-GD-------R-
A0A8C4LFQ1_BCL2L11-04      --------------------------------------------------
A0A8C4LFQ1_BCL2L11-02      --------------------------------G----E-GD-------R-
A0A5F5PK35_BCL2L11-04      --------------------------------G----E-GD-------R-
A0A8C4TR55_BCL2L11-03      ----------------------------------------A-------A-
A0A8C4TR55_BCL2L11-02      ----------------------------------------A-------A-
A0A2I2UX96_BCL2L11-04      --------------------------------------------------
A0A2I2UX96_BCL2L11-02      --------------------------------------------------
A0A2I2UX96_BCL2L11-03      -----------------G-------------------E-GD-------R-
A0A2I2UX96_BCL2L11-01      -----------------G-------------------E-GD-------R-
A0A8C4VJX6_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-03      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-06      -----------------GNH-G----------G----E-GD-------S-
A0A2I2Y4B3_BCL2L11-01      -----------------GNH-G----------G----E-GD-------S-
A0A2I2Y4B3_BCL2L11-02      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-04      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-09      --------------------------------------------------
A0A2I2Y4B3_BCL2L11-08      -----------------GNH-G----------G----E-GD-------S-
A0A0P6J9X4_BCL2L11-06      -----------------GSP-E----------V----E-GD-------R-
A0A0P6J9X4_BCL2L11-07      --------------------------------GSPEVE-GD-------R-
A0A0P6J9X4_BCL2L11-08      -----------------GSP-E----------V----E-GD-------R-
A0A0C4DH20_BCL2L11-01      -----------------GNH-G----------G----E-GD-------S-
A0A0C4DH20_BCL2L11-09      --------------------------------------------------
A0A0C4DH20_BCL2L11-07      --------------------------------------------------
A0A0C4DH20_BCL2L11-06      -----------------GNH-G----------G----E-GD-------S-
A0A0C4DH20_BCL2L11-03      --------------------------------------------------
A0A0C4DH20_BCL2L11-02      --------------------------------------------------
Q6JTU4_BCL2L11-01          --------------------------------------------------
A0A4W5R3N6_BCL2L11-01      -----------------F--------------S----E-GD-------Q-
A0A287DFJ0_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A287DFJ0_BCL2L11-02      --------------------------------------------------
A0A8C5L6N3_BCL2L11-02      -----------------G-------------------E-GD-------R-
A0A4W6ETK4_BCL2L11-01      ---FGHRG---------STG-G----------G----ELAD-------S-
A0A8C5STS5_BCL2L11-01      --------------------------------G----E-RD-------S-
A0A667H9R7_BCL2L11-04      -----------------G-------------------E-GD-------R-
A0A667H9R7_BCL2L11-03      --------------------------------G----E-GD-------R-
A0A667H9R7_BCL2L11-01      -----------------G-------------------E-GD-------R-
A0A2K5X1Y3_BCL2L11-04      --------------------------------------------------
A0A2K5X1Y3_BCL2L11-07      -----------------GNH-G----------G----E-GD-------S-
A0A2K5X1Y3_BCL2L11-08      --------------------------------------------------
F7HHA1_BCL2L11-03          --------------------------------------------------
A0A2K6E1Z6_BCL2L11-04      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-09      --------------------------------------------------
A0A2K5Z7V3_BCL2L11-10      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-02      --------------------------------------------------
A0A8C5YNZ8_BCL2L11-01      --------------------------------G----E-GD-------R-
A0A8B7EUP7_BCL2L11-04      -----------------GSR-E----------G----E-GD-------R-
A0A8B7EUP7_BCL2L11-01      -----------------GSR-E----------G----E-GD-------R-
A0A8B7EUP7_BCL2L11-02      --------------------------------------------------
A0A8C6C635_BCL2L11-01      --------------------------------------------------
A0A8C6DRY6_BCL2L11-02      -------------------------------------E-GD-------R-
A0A8C6DRY6_BCL2L11-03      --------------------------------------------------
A0A8C6DRY6_BCL2L11-01      -------------------------------------E-GD-------R-
O54918_BCL2L11-06          --------------------------------------------------
O54918_BCL2L11-05          --------------------------------------------------
O54918_BCL2L11-04          --------------------------------G----E-GD-------R-
A0A8C6HGQ3_BCL2L11-03      --------------------------------------------------
M3YDI3_BCL2L11-01          --------------------------------------------------
A0A8C6VGF4_BCL2L11-01      --------------------------------G----E-RD-------S-
A0A8C6QXX9_BCL2L11-01      -----------------G-------------------E-GD-------R-
A0A8C6QXX9_BCL2L11-02      --------------------------------------------------
A0A8C7BAK5_BCL2L11-01      -----------------G-------------------E-GD-------R-
A0A8C7BAK5_BCL2L11-04      --------------------------------------------------
A0A8C7BAK5_BCL2L11-03      --------------------------------------------------
A0A8C7BAK5_BCL2L11-02      -----------------G-------------------E-GD-------R-
A0A2I3GAA1_BCL2L11-08      --------------------------------------------------
A0A2I3GAA1_BCL2L11-02      --------------------------------------------------
A0A8C7HIL6_BCL2L11-02      -----------------F--------------S----E-GE-------Q-
A0A8C7HIL6_BCL2L11-01      -----------------F--------------S----E-GE-------Q-
A0A8C7L4D1_BCL2L11-01      -----------------S--------------C----E-GD-------Q-
A0A8C7V9R7_BCL2L11-01      -----------------S--------------C----E-WD-------Q-
A0A8C8FY48_BCL2L11-01      -----------------F--------------S----E-GE-------Q-
A0A6I8NCK5_BCL2L11-02      --------------------------------------------------
A0A5F9C9V3_BCL2L11-02      ---------------------------------------GD-------R-
H0XW23_BCL2L11-01          -----------------GNP-E----------V----E-GD-------R-
A0A8C8AGU8_BCL2L11-01      --------------------------------------------------
A0A2R9BZX9_BCL2L11-05      --------------------------------------------------
A0A8C8Y6N0_BCL2L11-01      -----------------G-------------------E-GD-------R-
A0A096NYC3_BCL2L11-01      -----------------GNH-G----------G----E-GD-------S-
A0A096NYC3_BCL2L11-02      --------------------------------------------------
A0A6I9LW27_BCL2L11-02      --------------------------------------------------
A0A8C9CBP3_BCL2L11-03      --------------------------------G----E-GD-------R-
A0A2Y9T3Y6_BCL2L11-03      -----------------G-------------------E-GD-------R-
A0A2Y9T3Y6_BCL2L11-02      --------------------------------G----E-GD-------R-
A0A2Y9T3Y6_BCL2L11-01      --------------------------------------------------
A0A8C9I5G9_BCL2L11-06      --------------------------------------------------
A0AA35K6G8_BCL2L11-01      --------------------------------------------------
A0A670KEZ9_BCL2L11-01      --------------------------------G----E-RD-------T-
A0A3B3YII5_BCL2L11-02      APQAGASTAGGGGGGG-GGG-R----------G----E-PD-------S-
A0A2J8SGU7_BCL2L11-05      --------------------------------------------------
A0A2J8SGU7_BCL2L11-02      -----------------GNH-G----------G----E-GD-------S-
A0A2J8SGU7_BCL2L11-01      -----------------GNH-G----------G----E-GD-------S-
A0A8C8ZU60_BCL2L11-02      --------------------------------------------------
A0A8C8ZU60_BCL2L11-04      --------------------------------------------------
A0A8C8ZU60_BCL2L11-03      -----------------GSR-E----------G----E-GD-------R-
A0A2K6GE22_BCL2L11-04      -----------------GSR-E----------G----E-GD-------R-
A0A2K6GE22_BCL2L11-05      -----------------GSR-E----------G----E-GD-------R-
A0A2K6GE22_BCL2L11-02      --------------------------------------------------
A0A2K6GE22_BCL2L11-06      --------------------------------------------------
A0A2K6GE22_BCL2L11-01      -----------------GSR-E----------G----E-GD-------R-
A0A2K6GE22_BCL2L11-03      -----------------GSR-E----------G----E-GD-------R-
A0A670Y3D3_BCL2L11-01      --------------------------------G----E-RD-------S-
A0A8I5ZK47_BCL2L11-04      --------------------------------------------------
A0A8I5ZK47_BCL2L11-02      --------------------------------------------------
O8849