Dataset for protein Bim of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

362 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      GRKTGARARCAPPPPPPEHVRAAACPRRTLAAGREAAVRRAGSLPHAGPG
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      -----------------ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPL
A0A287AEC6_BCL2L11      -----------------ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPL
A0A287AEC6_BCL2L11      -----------------ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPL
A0A3Q2GRS5_BCL2L11      --------------------MFPAAAAGAARARGAARGAL----------
A0A3Q2GRS5_BCL2L11      --------------------MFPAAAAGAARARGAARGAL----------
A0A7M4F197_BCL2L11      --------------------------------------------------
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      WGGGVRACGAPGGGPKCGSGRDCARRGAGKGSARSALSRELRPRCWILGC
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------PATWGG
A0A7N5JE15_BCL2L11      --------------------------------------------TRSAGA
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      CSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRRAQR
A0A287AEC6_BCL2L11      CSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRRAQR
A0A287AEC6_BCL2L11      CSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRRAQR
A0A3Q2GRS5_BCL2L11      -----------------------GCP------------AERGGGGRAAS-
A0A3Q2GRS5_BCL2L11      -----------------------GCP------------AERGGGGRAAS-
A0A7M4F197_BCL2L11      -----------RSGRSPRRPGPAQTCCAQHIRENNGLGRGRGRAAPPRRR
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      AAGRQVSPPCPETPPPPPSPGSGRAVGAGLAPWLSSGARARCGGFAELRR
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      GSRQGSRGVRAGTEAGRAGGAGAARVRETPAAVAAGAAFGGEFVNNRLAF
A0A7N5JE15_BCL2L11      GP------AASAGEPGRATLAFTCWSLKAPAAAAAAAARRG---------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      GTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGA
A0A287AEC6_BCL2L11      GTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGA
A0A287AEC6_BCL2L11      GTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGA
A0A3Q2GRS5_BCL2L11      -----------GRLCAVLAPLSASPGLCLPRC---LSGDNQGAPGRRKAR
A0A3Q2GRS5_BCL2L11      -----------GRLCAVLAPLSASPGLCLPRC---LSGDNQGAPGRRKAR
A0A7M4F197_BCL2L11      PLLLAGCGAGTARTRRSLALPVPTQQVSGRAGRARSGAAWLASFTSKCNG
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      FFHWRDSAFSLHRLRPRFQGGCSVRALLDVSGGALPCPALPGPRLRCRHQ
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      GGLTRRRRLRRRRLLAVARSDRARANWERGHPAPAARGGRRCRRRRAQCA
A0A7N5JE15_BCL2L11      ---------------------------GAGRACPRAGAGLRGGGARGDWV
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      ASLSWAAGLRRFHFAPRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLT
A0A287AEC6_BCL2L11      ASLSWAAGLRRFHFAPRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLT
A0A287AEC6_BCL2L11      ASLSWAAGLRRFHFAPRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLT
A0A3Q2GRS5_BCL2L11      AG-----------------------------RRGARARTRRSEGKGRI--
A0A3Q2GRS5_BCL2L11      AG-----------------------------RRGARARTRRSEGKGRI--
A0A7M4F197_BCL2L11      FCRRPADSRSAPVGTAGGFWSVEKGSALLSYFFVCLFVCLFVRSSCGRCF
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      QPHDPDGERPRAAGPAPPVGHPHSLAVPPGGAVPSGACSSVSELVAEDPP
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      RRSGRXAEALGCPAERGGGRAASGRLCAAPGALNASPGYCLLRSLRADGQ
A0A7N5JE15_BCL2L11      RALGRQSE-LSCGAVQVSLRSAQP---PSLGLVKALRPASPLPPLPPDSH
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      ----------MFPAAATRAARARGAARGAVGCPAERSGGLAGRRGLCAAP
A0A2Y9Q753_BCL2L11      ----------MFPAAAVGVARTGDAACGALSCPAERGSGRAASCRLSAAP
M3YDI3_BCL2L11-01       ----------MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAP
F7HHA1_BCL2L11-02       ----------MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAP
A0A096NYC3_BCL2L11      ----------MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAP
A0A2K5X1Y3_BCL2L11      ----------MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAP
F7HHA1_BCL2L11-03       ----------MFPAAAAGAARARGAACGALGCPAECGGGLAGRRGLCAAP
A0A096NYC3_BCL2L11      ----------MFPAAAAGAARGRGAACGALGCPAECGGGLAGRRGLCAAP
A0A2K5X1Y3_BCL2L11      ----------MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAP
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A669C520_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------MPTEES
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      VALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNAR
A0A287AEC6_BCL2L11      VALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNAR
A0A287AEC6_BCL2L11      VALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNAR
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      ASSHFPDLILSDGACFSELGDGAVWLQSPDVVSLWSRESLLAMLSLSLQG
A0A672TST9_BCL2L11      --------------------------------------------------
A0A674H354_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      AAGARGVDVFAVCRAHGCARTRVPVASGCGWDLDVRAALGEEKGGICGGR
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      GAPGRRRTRAGRRGARARARTRRSEG--------------------KGRT
A0A7N5JE15_BCL2L11      SHPARASPTAASIAAGCSLRPAPAATPSAPFPWPSSPQCLTLTLGLRNAR
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      GTLNPSPGLCLLHCLRGDGQGPPGRRKARVGRRGAPSRARTLRSEGKART
A0A2Y9Q753_BCL2L11      GAPTASPGLCLPGRLRVDGQGAPGRRRARAGRRRAPARTR--RSEGKGRT
M3YDI3_BCL2L11-01       GALKASPRLCLPRFFRAEGQGAPGRRRTRAGRRGARARTR--RSEGKGRT
F7HHA1_BCL2L11-02       GTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKART
A0A096NYC3_BCL2L11      GTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKART
A0A2K5X1Y3_BCL2L11      GTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKART
F7HHA1_BCL2L11-03       GTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKART
A0A096NYC3_BCL2L11      GTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAQTLRSEGKART
A0A2K5X1Y3_BCL2L11      GTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKART
A0A674IAI8_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      ----------------------MPLSVRSYLWIWLGSPGAGLGDLAPIRR
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      MGPEWGTRPAACNRCICARSCAPAQYLIPGSQSPLGVSDFCKSALSKEHI
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
G3H020_BCL2L11-02       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
F7HHA1_BCL2L11-01       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-02       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
A0A669QMB4_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
A0A670KEZ9_BCL2L11      --------------------------------------------------
A0A670Y3D3_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A672PQD1_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A671M057_BCL2L11      --------------------------------------------------
A0A672L1R2_BCL2L11      --------------------------------------------------
A0A671SJ75_BCL2L11      --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      -----------------------------LLSARKARFSVCPCSSPEDRI
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A4W5NF23_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A1S3SAH9_BCL2L11      --------------------------------------------------
A0A673WET2_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
A0A4W5R3N6_BCL2L11      ------------------------------------MTLHRQNNKNSLTL
A0A4W5R3N6_BCL2L11      ------------------------------------MTLHRQNNKNSLTL
A0A669C520_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      ----------------------------------------------MLTV
A0A3B5QAM1_BCL2L11      ----------------------------------------------MLTV
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      -------------------MYIYICICTYKYITDSLTSCYSRSQRLCRAT
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      ------------------------------------------------MV
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A671W556_BCL2L11      --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      ----MAKQPPEVKAQRDG-----EGGRLPPAEG-----------PGPAAQ
A0A803WCD8_BCL2L11      ----RSRGPGRVGSGRVR-----HGRR-----------------------
M3XHJ5_BCL2L11-01       LQFDKDQGTSDVISECGH---------LHPTQR-----------PDQPPF
G1MV54_BCL2L11-01       -----GMKSPEVCSECTLAN---TGTRLQHAHR-----------------
A0A3Q1ELG4_BCL2L11      ----SSSAASPAAPHADT-----TEGGGADPEPVGAAGVSAKTSRSNSTG
A0A3Q1CI15_BCL2L11      ----PTKSGPDAAARCFT-----SGSRCRDSERL----------PPNPSH
A0A3B3QC78_BCL2L11      MGQILLTIPCSVCSAEDKITRMAESRNPVAEQT-----------PIQAGP
A0A667ZMY7_BCL2L11      -LSDVTAAQTPRAAPANE-----SGGRCRGHAA-----------P-----
A0A287AEC6_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A287AEC6_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A287AEC6_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q2GRS5_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q2GRS5_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A7M4F197_BCL2L11      KKDQMAKQPSDLNSKCGS-----EDRQLQPRER-----------PSQPQP
A0A672TST9_BCL2L11      ----MAKQPPEVKAQRDG-----DGG-----EG-----------PGPAAQ
A0A674H354_BCL2L11      ----MAKQPPEVKARRDG-----EGGRLPAAEG-----------PGPGAQ
A0A3Q7S5V2_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
O43521_BCL2L11-13       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-16       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDR-----EGGQLQPTER-----------PTQPQ-
A0A7N5JE15_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A7N5JE15_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A5F8H037_BCL2L11      ----MAKQPSDLNSECDR-----EGGQLQPTER-----------PTQPQQ
A0A5F9C9V3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2Y9Q753_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
M3YDI3_BCL2L11-01       KKDQMAKQPSDVSSECDR-----EGGQLQPVER-----------P--PQ-
F7HHA1_BCL2L11-02       KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A096NYC3_BCL2L11      KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
F7HHA1_BCL2L11-03       KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A096NYC3_BCL2L11      KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      KKDQMAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A674IAI8_BCL2L11      ----MAKQSSDLNSECNR-----EGGQFQSIER-----------PSQPQH
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDR-----EGGQLQPTER-----------PTQPQ-
A0A2K6GE22_BCL2L11      ----MAKQPSDVGSECDR-----EGGQLQSVER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-20       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-07       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-22       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
C1KGB8_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A673SRF7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2I2UX96_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A667H9R7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A7N5JE15_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
U6CTE3_BCL2L11-04       ----MAKQPSDVSSECDR-----EGGQLQPVER-----------P--PQ-
A0A3Q2GRS5_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A287AEC6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4X1VMQ3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A671FCV3_BCL2L11      ----MAKQPSDASSECDR-----EGGQLQPAER-----------P--PQ-
O54918_BCL2L11-06       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
O54918_BCL2L11-08       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
O54918_BCL2L11-05       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
C1KGB7_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
U6CTE3_BCL2L11-03       ----MAKQPSDVSSECDR-----EGGQLQPVER-----------P--PQ-
A0A0D9RWE0_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-09       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-14       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A3Q1MV27_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2K6GE22_BCL2L11      ----MAKQPSDVGSECDR-----EGGQLQSVER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A286XJN2_BCL2L11      ----MAKQPSDVSCECDR-----EGGQLQPAER-----------P--SQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-04       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2Y9T3Y6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQTAER-----------P--PQ-
A0A452SBG5_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4X1VMQ3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2I2UX96_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A667H9R7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q7S5V2_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
G3H020_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A287DFJ0_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2D2G6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2G3J8_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
L8IVA4_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q1MV27_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2D2G6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2G3J8_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A452FCR6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-23       ------KQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-03       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A096NYC3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O54918_BCL2L11-03       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A452U4S4_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q2GRS5_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
O43521_BCL2L11-17       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A096NYC3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-02       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-15       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A7N5JE15_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A673SRF7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A7N5JE15_BCL2L11      KKDQMAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
O43521_BCL2L11-01       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-08       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-21       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-12       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-06       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-18       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A667H9R7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A671FCV3_BCL2L11      ----MAKQPSDASSECDR-----EGGQLQPAER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2K6GE22_BCL2L11      ----MAKQPSDVGSECDR-----EGGQLQSVER-----------P--PQ-
A0A2K6GE22_BCL2L11      ----MAKQPSDVGSECDR-----EGGQLQSVER-----------P--PQ-
O54918_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
G3H020_BCL2L11-02       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
F7HHA1_BCL2L11-01       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-05       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2K6GE22_BCL2L11      ----MAKQPSDVGSECDR-----EGGQLQSVER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5CA52_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Q1U2_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R8M6L7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6TRJ7_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A096NYC3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-11       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-19       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5NTQ5_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5HZ87_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5X1Y3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K5Z7V3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A096NYC3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6KJM8_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2K6QIJ1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I2Y4B3_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
O43521_BCL2L11-10       ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3GAA1_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2R9BZX9_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A2I3S5F6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A1U7SU38_BCL2L11      ----MAKQPSVVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4X1VMQ3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
C1KGB6_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q2GRS5_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A673SRF7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A671FCV3_BCL2L11      ----MAKQPSDASSECDR-----EGGQLQPAER-----------P--PQ-
A0A2Y9T3Y6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQTAER-----------P--PQ-
A0A7N5JE15_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
U6CTE3_BCL2L11-02       ----MAKQPSDVSSECDR-----EGGQLQPVER-----------P--PQ-
A0A4X1VMQ3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2I2UX96_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A667H9R7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A287DFJ0_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2K6GE22_BCL2L11      ----MAKQPSDVGSECDR-----EGGQLQSVER-----------P--PQ-
A0A5F9C9V3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2D2G6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2G3J8_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
L8IVA4_BCL2L11-02       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A3Q1MV27_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2D2G6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A4W2G3J8_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A452FCR6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
W5PY58_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A286XJN2_BCL2L11      ----MAKQPSDVSCECDR-----EGGQLQPAER-----------P--SQ-
A0A286XJN2_BCL2L11      ----MAKQPSDVSCECDR-----EGGQLQPAER-----------P--SQ-
H0XW23_BCL2L11-01       ----MAKQPSDVGSECDR-----EGGQLQPAER-----------P--PQ-
A0A671FCV3_BCL2L11      ----MAKQPSDASSECDR-----EGGQLQPAER-----------P--PQ-
A0A2Y9Q753_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2Y9T3Y6_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQTAER-----------P--PQ-
U6CTE3_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPVER-----------P--PQ-
A0A4X1VMQ3_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A673SRF7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A7N5JE15_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A2I2UX96_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
A0A667H9R7_BCL2L11      ----MAKQPSDVSSECDR-----EGGQLQPAER-----------P--PQ-
U3IW89_BCL2L11-01       ----GGAGKHGAGTGRDG-----RGGQRQPRA------------------
A0A3Q2U844_BCL2L11      ----MAKQPPEAKAPRDR-----RAGRLPPGEG-----------PGPAVP
A0A669QMB4_BCL2L11      ----MAKQPPEAKAPRDR-----RAGRLPPGEG-----------PGPAVP
A0A2K6E1Z6_BCL2L11      ----MAKQPSDVSSECDR-----EGRQLQPAER--------------PPQ
A0A5F8H037_BCL2L11      ----MAKQPSDLNSECDR-----EGGQLQPTER-----------PTQPQQ
A0A4X2L9J9_BCL2L11      ----MAKQPSDLNSECHR-----EGGQLHPTER-----------PTQPQQ
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDR-----EGGQLQPTER-----------PTQP-Q
A0A7N4NUH6_BCL2L11      ----MAKQPSDLNSECDR-----EGGQLQPTER-----------PTQP-Q
G3SU55_BCL2L11-01       ----MAKQPSDVSSECDR-----EGGQLQPAER-----------PPQPPQ
A0A670KEZ9_BCL2L11      ----MAKQSSDLTSECGR-----EGGQLQPAER-----------PAQ--H
A0A670Y3D3_BCL2L11      ----MAKQSSDLNSECER-----EGGQLQPAER-----------PAQPHH
A0A6I8NCK5_BCL2L11      ----MAKQPSDLNSECDS-----EGGRLEPAEG-----------PAQPPQ
A0A6I8NCK5_BCL2L11      ----MAKQPSDLNSECDS-----EGGRLEPAEG-----------PAQPPQ
A0A6I8NCK5_BCL2L11      ----MAKQPSDLNSECDS-----EGGRLEPAEG-----------PAQPPQ
A0A6I8NCK5_BCL2L11      ----MAKQPSDLNSECDS-----EGGRLEPAEG-----------PAQPPQ
A0A6I8NCK5_BCL2L11      ----MAKQPSDLNSECDS-----EGGRLEPAEG-----------PAQPPQ
A0A3Q3SYA1_BCL2L11      MATEESGDPPAGDPRVSAQTSRSNGG-----------TDQSSVSP-----
A0A3G3M2M0_BCL2L11      MSDT-SREQTPGNVPASRGSGESAGVGAALRPGHFDFPQPSDGDP-----
A0A672PQD1_BCL2L11      MSDTSSREQTPG-----RGSGESAGGAAVLGSGHFDFPQPSDGDP-----
A0A673NIJ7_BCL2L11      --------------------------------------------P-----
B2KKY9_BCL2L11-01       MSDTS-REQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDP-----
B8JK68_BCL2L11-01       MSDTS-REQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDP-----
A0A671M057_BCL2L11      MSDTS------REQTPGRGSGESAGGGAVVRSGYFDFPQPSDGDP-----
A0A672L1R2_BCL2L11      MSDTS------REQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDP-----
A0A671SJ75_BCL2L11      VSDTT--TQTLANGPASRGSGESAGGGAVLRSGHFDFPQPSDGDP-----
A0A673IWZ7_BCL2L11      MADSTILKQTLANGPASRGSGESAGGGAVLRSEHFDFPQPSDGDP-----
A0A4W3IWD3_BCL2L11      --------------------------RCSQFQF-----------H--TLT
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------MCSGV-V-----------K--EYP
A0A3P8RLE2_BCL2L11      --------ANRTPSLVGPEQKKRNGGNLRGGGA-----------D--PEP
A0A673CKA1_BCL2L11      -----------------VAPCVKSLKRAYCSAS-----------G--ELS
A0A7M4F197_BCL2L11      -----MGWDGAAAGRLLLAAAP----SCSPAAG-----------R--AQR
K7GA86_BCL2L11-01       -----MGRAGRGPGAAQSVQAPRRVPAFCPVAG-----------G--SER
A0A4W4H3Y1_BCL2L11      ------IRQNRANGPAFLK--------EQGESG-----------E--N-T
A0A3B4BSH7_BCL2L11      --------MQNSNYCCF----------EQGESG-----------Q--S-S
A0A3B4BSH7_BCL2L11      ----MSRRSNRAGRPAFLK--------EQGESG-----------Q--S-S
A0A3B4BSH7_BCL2L11      HHLPHYLRSNRAGRPAFLK--------EQGESG-----------Q--S-S
A0A3B1JXK6_BCL2L11      ----MSRPSNRATRPPFLK--------EQGERG-----------Q--SGG
A0A4W4H3Y1_BCL2L11      -----RIRQNRANGPAFLK--------EQGESG-----------E--N-T
A0A4W5NF23_BCL2L11      -----MNHNIGPNVSTTLI--------ERRKSG-----------E--SHP
A0A4W5R3N6_BCL2L11      -MTDSSRQQNQSNGSTILI--------ERGKYG-----------E--LNP
A0A1S3SAH9_BCL2L11      -MSDSSRQQNQSNGSTILI--------ERGKYG-----------E--LNP
A0A673WET2_BCL2L11      -MSDSSRQQNQSNGSTILI--------ERGKYG-----------E--LNP
A0A3P8XIA2_BCL2L11      MFD-SSRPQNRSNGTTTLI--------GRGKIG-----------E--SHP
A0A673XGV4_BCL2L11      QNKIYKKRGYYCNLWVAIM--------DQGESG-----------E--SHP
A0A4W5R3N6_BCL2L11      ILDLSYRQQNQSNGSTILI--------ERGKYG-----------E--LNP
A0A4W5R3N6_BCL2L11      ILDLSYRQQNQSNGSTILI--------ERGKYG-----------E--LNP
A0A669C520_BCL2L11      --YLFENADMQADCGLRIYFWLFLCDAAEVTLG-----------L--PHA
A0A3Q3ESW6_BCL2L11      -MHRPSRPPNRLDGSPTVT-------ESHGTRG-----------D--PPQ
A0A3P9N073_BCL2L11      --------------------------------------------D--PAS
A0A3Q3B113_BCL2L11      -MRSPSRPPNLRDGSTEVK-------ATEGSSG-----------G--APP
A0A3B5M375_BCL2L11      TLCSSNRPPNLLDGSTEVT-------PAEGTGG-----------D--PAS
A0A3B5QAM1_BCL2L11      TLCSSNRPPNLLDGSTEVT-------PAEGTGG-----------D--PAS
A0A3B5QAM1_BCL2L11      --MHSLRPPNLLDGSTEVT-------PAEGTGG-----------D--PAS
A0A4W6ETK4_BCL2L11      -------MKAQADGAA-LF-------IQQTTKP-----------V--RWL
A0A4W6ETK4_BCL2L11      DMQPPSRPPNQSDGSTEVT-------AREESGG-----------D--PHV
A0A4W6ETK4_BCL2L11      -----QRPPNQSDGSTEVT-------AREESGG-----------D--PHV
A0A3B4V919_BCL2L11      -------MKAQADGAA-LF-------IQQTTKP-----------V--RWL
A0A3B4XZH1_BCL2L11      -------MKAQADGAA-LF-------IQQTTKP-----------V--RWL
A0A3Q2SZH6_BCL2L11      TLCSSNRPPNLRDGSTEVT-------PPEGTGG-----------D--PAS
A0A3B3VNE0_BCL2L11      --MHSSRPPNLLDGSTEVT-------PAEGTGG-----------D--PAS
A0A3B3YII5_BCL2L11      --MHSLRPPNLLDGSTEVT-------PAEGTGG-----------D--PAS
A0A3B3YII5_BCL2L11      --MHSLRPPNLLDGSTEVT-------PAEGTGG-----------D--PAS
A0A3Q3K6I5_BCL2L11      --MHLSRPPNRSDGSTAVT-------ATEES-G-----------D--PPS
A0A3Q1ICY2_BCL2L11      ---MDPRQPNRSDGSTAVT-------ATGESGG-----------D--PPP
A0A671W556_BCL2L11      -MQHPSRPPNSSDGSTAVT-------AGQGSGG-----------D--PSP
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      LRPGAPAALPGS--------------------------------------
A0A803WCD8_BCL2L11      -------ALPAE--------------------------------------
M3XHJ5_BCL2L11-01       VKQEGCYCIISP----------------------LSKVIALVRWRDRSLL
G1MV54_BCL2L11-01       -----TASLDFV---PV---------------------------------
A0A3Q1ELG4_BCL2L11      GEPDSPSWSR----------------------------------------
A0A3Q1CI15_BCL2L11      GSPDSPSWSRAQ--------------------------------------
A0A3B3QC78_BCL2L11      RTAKVPGQLQAT---PR---------------------------------
A0A667ZMY7_BCL2L11      --PGGKGDSPSR--------------------------------------
A0A287AEC6_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A287AEC6_BCL2L11      LRPGAPTSLQTE---RQGNPE-------GEGDRCPQG-------------
A0A287AEC6_BCL2L11      LRPGAPTSLQTE---RQGNPE-------GEGDRCPQG-------------
A0A3Q2GRS5_BCL2L11      LRPGAPTSLQIE---QQ---------------------------------
A0A3Q2GRS5_BCL2L11      LRPGAPTSLQIE---QQGNPG-------GEGDRCPQG-------------
A0A7M4F197_BCL2L11      VRPGAPTSIQTQ---YQ---------------------------------
A0A672TST9_BCL2L11      LRPGAPAALPGSAATAT---------------------------------
A0A674H354_BCL2L11      LRPGAPAALPG-AGPVS---------------------------------
A0A3Q7S5V2_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
O43521_BCL2L11-13       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-16       LRPGAPTSLQTE---PQVS-------------LCHPGWSALVRSWLTATS
A0A7N4NUH6_BCL2L11      LRPGAPTSIQTQ---YQ---------------------------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A5F8H037_BCL2L11      LRPGAPTSIQTQ---YQGNS--------GEGDSCSPS-------------
A0A5F9C9V3_BCL2L11      LRPGAPTSLQSE---PQ---------------------------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCLHG-------------
A0A2Y9Q753_BCL2L11      LRPGAPISLQTE---RQ---------------------------------
M3YDI3_BCL2L11-01       LRPGAPTSLQTE---QQ---------------------------------
F7HHA1_BCL2L11-02       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A096NYC3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
F7HHA1_BCL2L11-03       LRPGAPTSLQTE---PQ---------------------------------
A0A096NYC3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A674IAI8_BCL2L11      LRPGAPTSIQTQ---YQGNHSGEGDFTQQPSGSSSPS-------------
A0A7N4NUH6_BCL2L11      LRPGAPTSIQTQ---YQ---------------------------------
A0A2K6GE22_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-20       LRPGAPTSLQTE---PQ---------------------------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-07       LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-22       LRPGAPTSLQTE---PQ---------------------------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
C1KGB8_BCL2L11-01       LRPGAPTSLQTE---RQ---------------------------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A673SRF7_BCL2L11      LRPGAPTSLQTQ---RQ---------------------------------
A0A2I2UX96_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A667H9R7_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
U6CTE3_BCL2L11-04       LRPGAPTSLQTE---QQ---------------------------------
A0A3Q2GRS5_BCL2L11      LRPGAPTSLQIE---QQ---------------------------------
A0A287AEC6_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A4X1VMQ3_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A671FCV3_BCL2L11      LRPGAPTSVQIE---RQ---------------------------------
O54918_BCL2L11-06       LRPGAPTSLQTE---PQ---------------------------------
O54918_BCL2L11-08       LRPGAPTSLQTE---PQ---------------------------------
O54918_BCL2L11-05       LRPGAPTSLQTE---PQ---------------------------------
C1KGB7_BCL2L11-01       LRPGAPTSLQTE---RQ---------------------------------
U6CTE3_BCL2L11-03       LRPGAPTSLQTE---QQ---------------------------------
A0A0D9RWE0_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-09       LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-14       LRPGAPTSLQTE---PQ---------------------------------
A0A3Q1MV27_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A2K6GE22_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A286XJN2_BCL2L11      LRAGAPTSLQTE---PQ---------------------------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-04       LRPGAPTSLQTE---PQ---------------------------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2Y9T3Y6_BCL2L11      LRPGAPISLQTE---RQ---------------------------------
A0A452SBG5_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A4X1VMQ3_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A2I2UX96_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A667H9R7_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A3Q7S5V2_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
G3H020_BCL2L11-01       LRPGAPTSLQTE---PQ---------------------------------
A0A287DFJ0_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A4W2D2G6_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A4W2G3J8_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
L8IVA4_BCL2L11-01       LRPGAPTSLQTE---RQ---------------------------------
A0A3Q1MV27_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A4W2D2G6_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A4W2G3J8_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A452FCR6_BCL2L11      LRPGAPTSLQTE---RQ---------------------------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-23       LRPGAPTSLQTE---PQ---------------------------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-03       LRPGAPTSLQTE---PQ---------------------------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A096NYC3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O54918_BCL2L11-03       LRPGAPTSLQTE---PQ---------------------------------
A0A452U4S4_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A3Q2GRS5_BCL2L11      LRPGAPTSLQIE---QQ---------------------------------
O43521_BCL2L11-17       LRPGAPTSLQTE---PQ---------------------------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A096NYC3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-02       LRPGAPTSLQTE---PQ---------------------------------
O43521_BCL2L11-15       LRPGAPTSLQTE---PQ---------------------------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQ---------------------------------
A0A673SRF7_BCL2L11      LRPGAPTSLQTQ---RQ---------------------------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCLHG-------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCLHG-------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQ---------------------------------
O43521_BCL2L11-01       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-08       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-21       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-12       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-06       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-18       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A667H9R7_BCL2L11      LRPGAPTSLQTE---QQGNPE-------GEGDRCPQG-------------
A0A671FCV3_BCL2L11      LRPGAPTSVQIE---RQGNPE-------GEGDRCPHG-------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQGNPEGSPG---GEGDRCPHG-------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQGNPEGSPG---GEGDRCPHG-------------
A0A2K6GE22_BCL2L11      LRPGAPTSLQTE---PQGNPEGSRE---GEGDRCSHG-------------
A0A2K6GE22_BCL2L11      LRPGAPTSLQTE---PQGNPEGSRE---GEGDRCSHG-------------
O54918_BCL2L11-01       LRPGAPTSLQTE---PQGNPDG-------EGDRCPHG-------------
G3H020_BCL2L11-02       LRPGAPTSLQTE---PQGNPDG-------DGDRCPHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCLHG-------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
F7HHA1_BCL2L11-01       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-05       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQGNPEGSPG---GEGDRCPHG-------------
A0A2K6GE22_BCL2L11      LRPGAPTSLQTE---PQGNPEGSRE---GEGDRCSHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCLHG-------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5CA52_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Q1U2_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R8M6L7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCLHG-------------
A0A2K6TRJ7_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A096NYC3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-11       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-19       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5NTQ5_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5HZ87_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5X1Y3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K5Z7V3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A096NYC3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2K6KJM8_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2K6QIJ1_BCL2L11      LRPGAPTSLQTE---PQGNPEDNHG---GEGDSCPHG-------------
A0A2I2Y4B3_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
O43521_BCL2L11-10       LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3GAA1_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2R9BZX9_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A2I3S5F6_BCL2L11      LRPGAPTSLQTE---PQGNPEGNHG---GEGDSCPHG-------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQGNPEGSPG---GEGDRCPHG-------------
A0A1U7SU38_BCL2L11      LRPGAPTSLQTE---PQGNPEGSPG---GEGDRCPHG-------------
A0A4X1VMQ3_BCL2L11      LRPGAPTSLQTE---RQGNPE-------GEGDRCPQG-------------
C1KGB6_BCL2L11-01       LRPGAPTSLQTE---RQGNPE-------GEGDRCPQG-------------
A0A3Q2GRS5_BCL2L11      LRPGAPTSLQIE---QQGNPG-------GEGDRCPQG-------------
A0A673SRF7_BCL2L11      LRPGAPTSLQTQ---RQGNPE-------GEGDRCPQG-------------
A0A671FCV3_BCL2L11      LRPGAPTSVQIE---RQGNPE-------GEGDRCPHG-------------
A0A2Y9T3Y6_BCL2L11      LRPGAPISLQTE---RQGNPE-------GEGDRCPQG-------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQGNPE-------GEGDRCPQG-------------
U6CTE3_BCL2L11-02       LRPGAPTSLQTE---QQGNPE-------GEGDRCPQG-------------
A0A4X1VMQ3_BCL2L11      LRPGAPTSLQTE---RQGNPE-------GEGDRCPQG-------------
A0A2I2UX96_BCL2L11      LRPGAPTSLQTE---QQGNPE-------GEGDRCPQG-------------
A0A667H9R7_BCL2L11      LRPGAPTSLQTE---QQGNPE-------GEGDRCPQG-------------
A0A287DFJ0_BCL2L11      LRPGAPTSLQTE---PQGNPEG-------EGDRCPHG-------------
A0A2K6GE22_BCL2L11      LRPGAPTSLQTE---PQGNPEGSRE---GEGDRCSHG-------------
A0A5F9C9V3_BCL2L11      LRPGAPTSLQSE---PQGNPEG---------DRCAHG-------------
A0A4W2D2G6_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCLQG-------------
A0A4W2G3J8_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
L8IVA4_BCL2L11-02       LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
A0A3Q1MV27_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
A0A4W2D2G6_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCLQG-------------
A0A4W2G3J8_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
A0A452FCR6_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
W5PY58_BCL2L11-01       LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
A0A286XJN2_BCL2L11      LRAGAPTSLQTE---PQGNPEG-------AGDRSPHG-------------
A0A286XJN2_BCL2L11      LRAGAPTSLQTE---PQGNPEG-------AGDRSPHG-------------
H0XW23_BCL2L11-01       LRPGAPTSLHTE---PQGNPEGNPE---VEGDRCPQG-------------
A0A671FCV3_BCL2L11      LRPGAPTSVQIE---RQGNPEG-------EGDRCPHG-------------
A0A2Y9Q753_BCL2L11      LRPGAPISLQTE---RQGNPEG-------EGDRCPQG-------------
A0A2Y9T3Y6_BCL2L11      LRPGAPISLQTE---RQGNPEG-------EGDRCPQG-------------
U6CTE3_BCL2L11-01       LRPGAPTSLQTE---QQGNPEG-------EGDRCPQG-------------
A0A4X1VMQ3_BCL2L11      LRPGAPTSLQTE---RQGNPEG-------EGDRCPQG-------------
A0A673SRF7_BCL2L11      LRPGAPTSLQTQ---RQGNPEG-------EGDRCPQG-------------
A0A7N5JE15_BCL2L11      LRPGAPTSLQTE---QQGNPEG-------EGDRCPQG-------------
A0A2I2UX96_BCL2L11      LRPGAPTSLQTE---QQGNPEG-------EGDRCPQG-------------
A0A667H9R7_BCL2L11      LRPGAPTSLQTE---QQGNPEG-------EGDRCPQG-------------
U3IW89_BCL2L11-01       --------------------------------------------------
A0A3Q2U844_BCL2L11      LRPGAPAALPGA--------------------------------------
A0A669QMB4_BCL2L11      LRPGAPAALPGA--------------------------------------
A0A2K6E1Z6_BCL2L11      LRPGAPTSLQTDPGPFA---------------------------------
A0A5F8H037_BCL2L11      LRPGAPTSIQTQ---YQ---------------------------------
A0A4X2L9J9_BCL2L11      LRPGAPTSIQTQ---YQ---------------------------------
A0A7N4NUH6_BCL2L11      LRPGAPTSIQTQ---YQGN-SGEGDSCSPS--------------------
A0A7N4NUH6_BCL2L11      LRPGAPTSIQTQ---YQGN-SGEGDSCSPS--------------------
G3SU55_BCL2L11-01       LRPGAPTSLLTE---PQGNPDGEGDSCPQG--------------------
A0A670KEZ9_BCL2L11      LRPGAPTSLQTV---YQGNHSGERDTSSPS--------------------
A0A670Y3D3_BCL2L11      LRPGAPTSLQTE---YQGNHLGERDSSSPG--------------------
A0A6I8NCK5_BCL2L11      LRPGAPTSIRTQ---YQGNLSGGGESCS----------------------
A0A6I8NCK5_BCL2L11      LRPGAPTSIRTQ---YQ---------------------------------
A0A6I8NCK5_BCL2L11      LRPGAPTSIRTQ---YQ---------------------------------
A0A6I8NCK5_BCL2L11      LRPGAPTSIRTQ---YQ---------------------------------
A0A6I8NCK5_BCL2L11      LRPGAPTSIRTQ---YQ---------------------------------
A0A3Q3SYA1_BCL2L11      SRGRTRSIAHLD--------------------------------------
A0A3G3M2M0_BCL2L11      LRGGIAMSNSHQ--------------------------------------
A0A672PQD1_BCL2L11      LRGGIAMSSSHQ--------------------------------------
A0A673NIJ7_BCL2L11      LRGGISMSNSHQ--------------------------------------
B2KKY9_BCL2L11-01       LRGGISMSNN-Q--------------------------------------
B8JK68_BCL2L11-01       LRGGISMSNN-Q--------------------------------------
A0A671M057_BCL2L11      LRGGISMSNSHQ--------------------------------------
A0A672L1R2_BCL2L11      LRGGIAMSSSHQ--------------------------------------
A0A671SJ75_BCL2L11      LRGGIAMSNSHQ--------------------------------------
A0A673IWZ7_BCL2L11      LRGGIAMSNSHQ--------------------------------------
A0A4W3IWD3_BCL2L11      DKREGRQGVPSDFPINTTCENI----------------------------
A0A4W3IWD3_BCL2L11      ------------MQSSRSTQNI----------------------------
A0A4W3IWD3_BCL2L11      GMSRGELSGQSDFPINTTCENI----------------------------
A0A3P8RLE2_BCL2L11      VGAAGVSAKTSRLNSTGGEPDSPSWSRAQ---------------------
A0A673CKA1_BCL2L11      PGFTGPTGEGRE-PDSPSQIGVKAT-------------------------
A0A7M4F197_BCL2L11      GPAALSPSQSQH-SKFRAEPGGLGAELLG------------SQVSLQNVM
K7GA86_BCL2L11-01       AAARFPAPAGAD-SERR----GLAEELL----------------------
A0A4W4H3Y1_BCL2L11      GVGTASRPEQFD-CSHPNQGD-QFRGGIT---------------------
A0A3B4BSH7_BCL2L11      GAASSRAAEQCE-QPEPGEGD-PVRGGIT---------------------
A0A3B4BSH7_BCL2L11      GAASSRAAEQCE-QPEPGEGD-PVRGGIT---------------------
A0A3B4BSH7_BCL2L11      GAASSRAAEQCE-QPEPGEGD-PVRGGIT---------------------
A0A3B1JXK6_BCL2L11      GGGTLSRAEQCE-QPEPGDGD-PVRGPPA---------------------
A0A4W4H3Y1_BCL2L11      GVGTASRPEQFD-CSHPNQGD-QFRG--G---------------------
A0A4W5NF23_BCL2L11      GGGAASRAEPSD-NPQSCEGDQQSRGGIM---------------------
A0A4W5R3N6_BCL2L11      GGGAASGAEPTD-IPQFSEGDQQSRGGIM---------------------
A0A1S3SAH9_BCL2L11      GGGAASGAEPTD-NPQFSERDQQSRGGIM---------------------
A0A673WET2_BCL2L11      GGGAASGAEPTD-NPQFSERDQQSRGGIM---------------------
A0A3P8XIA2_BCL2L11      CGGATSSSKLSD-YPQSCEGNQQSRGGIM---------------------
A0A673XGV4_BCL2L11      GGGAASRAEPSD-NPQSCEGDQQSLGGIM---------------------
A0A4W5R3N6_BCL2L11      GGGAASGAEPTD-IPQFSEGDQQSRGGIM---------------------
A0A4W5R3N6_BCL2L11      GGGAASGAEPTD-IPQFSEGDQQSRGGIM---------------------
A0A669C520_BCL2L11      ------FPIRQT-EMYLPPVGATGAQTSRLNRGSTGGGEPDSPSWCR---
A0A3Q3ESW6_BCL2L11      TSRSDNSGGRN--------FGRTDSTGGG-----------EPDSPSRCRF
A0A3P9N073_BCL2L11      SARTPRSSKHTE-RSCAPQAGASTAGGGGGGG----RGEPDSDSPPCT--
A0A3Q3B113_BCL2L11      SAGAARGSAHAT-R---PVRGRAPSAAGG-----------EPESPACS--
A0A3B5M375_BCL2L11      SARTPRSSKHTE-RSRAPQAGASTAGGGGGGEGEGRRGEPDSDSPPCS--
A0A3B5QAM1_BCL2L11      SARTPRSSKHTE-RSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPCS--
A0A3B5QAM1_BCL2L11      SARTPRSSKHTE-RSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPCS--
A0A4W6ETK4_BCL2L11      DRSNGKRGERRR-STRRRCRWSLGANVPF-ERRRRRRRAEL--WPPRLHR
A0A4W6ETK4_BCL2L11      DGAAGASAQTSR-SNDGGG----GGERSF-GHRGSTGGGELADSPPRCRT
A0A4W6ETK4_BCL2L11      DGAAGASAQTSR-SNDGGG----GGERSF-GHRGSTGGGELADSPPRCRT
A0A3B4V919_BCL2L11      DRSNGKRGERRG-STTRRCRWSPSAKPQF-ERQRRAEP-----WPPRLHR
A0A3B4XZH1_BCL2L11      DRSNGKRGERRG-STTRRCRWSPGAKPQF-ERQRRAET-----IA-----
A0A3Q2SZH6_BCL2L11      SARTPRLSKHRE-GSCAQPPGAVTAAGGG-G------GEPDSDSPPRSIS
A0A3B3VNE0_BCL2L11      SARTPRSSKHTE-RSCAPQTGASTAGGGG-GGGGGGGGEPDADSPPCSVS
A0A3B3YII5_BCL2L11      SARTPRSSKHTE-RSCAPQAGASTAGGGG-GGGGGGRGEPDSDSPPCSVS
A0A3B3YII5_BCL2L11      SARTPRSSKHTE-RSCAPQAGASTAGGGG-GGGGGGRGEPDSDSPPCSVS
A0A3Q3K6I5_BCL2L11      VGAAGTSAQSSR-SNGGSERSFGHPGSAG-G------GEPVSPSRCRTKA
A0A3Q1ICY2_BCL2L11      VGAAGVSTPTSR-SNDGGERRFGRPDSSG-G------GEPESQSRCRTKS
A0A671W556_BCL2L11      AGAAGASAQTSR-SDTGGVPSSGQPSTSG-G------GEPDSPCWRRGKT
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       STLMGGLLLPPSPCPFVTRSPFFIF-----------MRRSLVLSTSSSGY
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      ----------ASLGVFQTRSIFHLP-----------RRSSSGYFSADGSD
A0A3Q1CI15_BCL2L11      ----------ASLGVFQTRSIFHLP-----------RRSSSGYFSADGAD
A0A3B3QC78_BCL2L11      ---------------------------------------FSTLSASSSGY
A0A667ZMY7_BCL2L11      -GAGPPISPTNSLSGYQLRSPLF-----------------RHLSRSSSGY
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      -SPQGPLAPPTSPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A287AEC6_BCL2L11      -SPQGPLAPPTSPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      -SPLGPLAPPASPGPFATRSPFFIF-----------VRRSSLLSRSSSGY
A0A7M4F197_BCL2L11      --------------------------------------------------
A0A672TST9_BCL2L11      -AGPPPRGPPASPGPFATRSPLFIF-----------VRRSPLLSRSSSGY
A0A674H354_BCL2L11      -AGAAARGPPASPGPFATRSPLFIF-----------VRRSPLLPRSSSGY
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-13       -SPQGPLAPPASPG------------------------------------
O43521_BCL2L11-16       NSQVQAVLLPQPPK------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      -SPQGPFAPPTSPSPFATRSPLFIF-----------LRRSPLLPRSSSGY
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2Y9Q753_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       --------------------------------------------------
F7HHA1_BCL2L11-02       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A096NYC3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5X1Y3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
F7HHA1_BCL2L11-03       --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A674IAI8_BCL2L11      -SPQGPFAPPSSPSPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-04       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
G3H020_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
L8IVA4_BCL2L11-01       --------------------------------------------------
A0A3Q1MV27_BCL2L11      --------------------------------------------------
A0A4W2D2G6_BCL2L11      --------------------------------------------------
A0A4W2G3J8_BCL2L11      --------------------------------------------------
A0A452FCR6_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2R8M6L7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A7N5JE15_BCL2L11      --------------------------------------------------
O43521_BCL2L11-01       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5Q1U2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5Q1U2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5NTQ5_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5HZ87_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I2Y4B3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-08       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-21       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5Z7V3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3GAA1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2R9BZX9_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3S5F6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5NTQ5_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I2Y4B3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-12       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5Z7V3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3GAA1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2R9BZX9_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3S5F6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5HZ87_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5NTQ5_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5HZ87_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I2Y4B3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-06       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-18       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5Z7V3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3GAA1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2R9BZX9_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3S5F6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5Q1U2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A667H9R7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A671FCV3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A1U7SU38_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A1U7SU38_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2K6GE22_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2K6GE22_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
O54918_BCL2L11-01       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
G3H020_BCL2L11-02       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2R8M6L7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5Q1U2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5NTQ5_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5HZ87_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5X1Y3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
F7HHA1_BCL2L11-01       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5Z7V3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I2Y4B3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-05       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3GAA1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2R9BZX9_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3S5F6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A1U7SU38_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2K6GE22_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2R8M6L7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5Q1U2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5CA52_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5Q1U2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2R8M6L7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K6TRJ7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSVLSRSSSGY
A0A2K5NTQ5_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5HZ87_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5X1Y3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5Z7V3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A096NYC3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I2Y4B3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-11       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-19       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2R9BZX9_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3S5F6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5NTQ5_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5HZ87_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5X1Y3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6E1Z6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K5Z7V3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A096NYC3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6KJM8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2K6QIJ1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I2Y4B3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
O43521_BCL2L11-10       -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3GAA1_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2R9BZX9_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A2I3S5F6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------MRRSSLLSRSSSGY
A0A1U7SU38_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A1U7SU38_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4X1VMQ3_BCL2L11      -SPQGPLAPPTSPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
C1KGB6_BCL2L11-01       -SPQGPLAPPTSPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A3Q2GRS5_BCL2L11      -SPLGPLAPPASPGPFATRSPFFIF-----------VRRSSLLSRSSSGY
A0A673SRF7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A671FCV3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2Y9T3Y6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A7N5JE15_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
U6CTE3_BCL2L11-02       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4X1VMQ3_BCL2L11      -SPQGPLAPPTSPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2I2UX96_BCL2L11      -SPQGPLAPPASPGPFATRSPFFIF-----------VRRSSLLSRSSSGY
A0A667H9R7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A287DFJ0_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2K6GE22_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A5F9C9V3_BCL2L11      -SPQGPLAPSASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4W2D2G6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4W2G3J8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
L8IVA4_BCL2L11-02       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A3Q1MV27_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4W2D2G6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4W2G3J8_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A452FCR6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
W5PY58_BCL2L11-01       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A286XJN2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A286XJN2_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
H0XW23_BCL2L11-01       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A671FCV3_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2Y9Q753_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2Y9T3Y6_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
U6CTE3_BCL2L11-01       -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A4X1VMQ3_BCL2L11      -SPQGPLAPPTSPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A673SRF7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A7N5JE15_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A2I2UX96_BCL2L11      -SPQGPLAPPASPGPFATRSPFFIF-----------VRRSSLLSRSSSGY
A0A667H9R7_BCL2L11      -SPQGPLAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
U3IW89_BCL2L11-01       --------------------------------------RSPLLSRSSSGY
A0A3Q2U844_BCL2L11      ----ARPASPGSPGPFAIRSPLFFF-----------VRRSPLLPRSSSGY
A0A669QMB4_BCL2L11      ----ARPASPGSPGPFAIRSPLFFF-----------VRRSPLLPRSSSGY
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A5F8H037_BCL2L11      --------------------------------------------------
A0A4X2L9J9_BCL2L11      --------------------------------------------------
A0A7N4NUH6_BCL2L11      -SPQGPFAPPTSPSPFATRSPLFIF-----------VRRSPLLPRSSSGY
A0A7N4NUH6_BCL2L11      -SPQGPFAPPTSPSPFATRSPLFIF-----------VRRSPLLPRSSSGY
G3SU55_BCL2L11-01       -SPQGPQAPPASPGPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A670KEZ9_BCL2L11      -SPQGPLAPPSSPSPFATRSPLFIF-----------VRRSPLLSRSSSGY
A0A670Y3D3_BCL2L11      -SPQGPLAPPSSPSPFATRSPLFMF-----------VRRSPLLSRSSSGY
A0A6I8NCK5_BCL2L11      ---QGPFPPSSSPRPFATRSPLFIF-----------VRRSSLLSRSSSGY
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      ------------------SLSVFHT-----------RSIFQLPRRSSSGY
A0A3G3M2M0_BCL2L11      ------------------SRS----------------PMSRTFSRSSSGY
A0A672PQD1_BCL2L11      ------------------SRS----------------PMCRTFSRSSSGY
A0A673NIJ7_BCL2L11      ------------------SRS----------------PMCRTFSRSSSGY
B2KKY9_BCL2L11-01       ------------------SRS----------------PMNRTFSRSSSGY
B8JK68_BCL2L11-01       ------------------SRS----------------PMNRTFSRSSSGY
A0A671M057_BCL2L11      ------------------SRS----------------PMCRTFSRSSSGY
A0A672L1R2_BCL2L11      ------------------SRS----------------PMSRTFSRSSSGY
A0A671SJ75_BCL2L11      ------------------SRS----------------PMSRTFSRSSSGY
A0A673IWZ7_BCL2L11      ------------------SRS----------------PMSRTFSRSSSGY
A0A4W3IWD3_BCL2L11      ----------QLSPAFITTCPLFNT--NFFRTPYSPVSPSSRTSRLSSGY
A0A4W3IWD3_BCL2L11      ----------QLSPAFITTCPLFNT--NFFRTPYSPVSPSSRTSRLSSGY
A0A4W3IWD3_BCL2L11      ----------QLSPAFITTCPLFNT--NFFRTPYSPVSPSSRTSRLSSGY
A0A3P8RLE2_BCL2L11      ----------ASLGVFQTRS-IFHL-----------------PRRSSSGY
A0A673CKA1_BCL2L11      -------LLSDSLSRFQMRS-IFRG------------------RRRSSGY
A0A7M4F197_BCL2L11      AFVGGRLTP-GAL--RSGPLGVFGLWKKAGKKDQMAKQPSDLNSKCGSED
K7GA86_BCL2L11-01       ------LEP-DSLLFRQSLSASYSL--DAGKGDQMAKQPSDLNSECDGEG
A0A4W4H3Y1_BCL2L11      ----------SSLSGYHSRSPLFRT-----------------LSRSSSGY
A0A3B4BSH7_BCL2L11      -------MP-NSLLGYQSRSPLFRT-----------------LSRSSSGY
A0A3B4BSH7_BCL2L11      -------MP-NSLLGYQSRSPLFRT-----------------LSRSSSGY
A0A3B4BSH7_BCL2L11      -------MP-NSLLGYQSRSPLFRT-----------------LSRSSSGY
A0A3B1JXK6_BCL2L11      -------LH-NSLLGYQTRSPLFRT-----------------LSRSSSGY
A0A4W4H3Y1_BCL2L11      -------IT-SSLSGYHSRSPLFRT-----------------LSRSSSGY
A0A4W5NF23_BCL2L11      -------IP-NSLLGFQSRSPVFRT-----------------LYRSSSGY
A0A4W5R3N6_BCL2L11      -------MP-NSLLGFQSRSPVFRT-----------------LSRSSSGY
A0A1S3SAH9_BCL2L11      -------MP-NSLLGFQSRSPLFRT-----------------LSRSSSGY
A0A673WET2_BCL2L11      -------MP-NSLLGFQSRSPLFRT-----------------LSRSSSGY
A0A3P8XIA2_BCL2L11      -------MPTNSLLGFQSRSPLFRT-----------------TSTSSSGY
A0A673XGV4_BCL2L11      -------IP-NSLLGFQSRSPVFRT-----------------LSRSSSGY
A0A4W5R3N6_BCL2L11      -------MP-NSLLGFQSRSPVFRT-----------------LSRSSSGY
A0A4W5R3N6_BCL2L11      -------MP-NSLLGFQSRSPVFRT-----------------LSRSSSGY
A0A669C520_BCL2L11      -------TP-KSFDVFQSRT-IFRF-----------------PRRSSSGY
A0A3Q3ESW6_BCL2L11      KPVS---PV-DSLGVFQKRS-IFHL-----------------PRRASSGY
A0A3P9N073_BCL2L11      --VS----P-ASLDVFRSRS-IFRP-----------------PRRSSSGY
A0A3Q3B113_BCL2L11      --SN---PP-AGLDVFRSRS-IFRF-----------------PRRSSSGY
A0A3B5M375_BCL2L11      --VS----P-ASLDVFRSRS-IFRP-----------------TRRSSSGY
A0A3B5QAM1_BCL2L11      --VS----P-ASLDVFRSRS-IFRP-----------------PRRSSSGY
A0A3B5QAM1_BCL2L11      --VS----P-ASLDVFRSRS-IFRP-----------------PRRSSSGY
A0A4W6ETK4_BCL2L11      RRRAGGLAA-PVLGVFQKRS-IFSY-----------------PRRSSSGY
A0A4W6ETK4_BCL2L11      KAIS---PL-DSLGVFQKRS-IFSY-----------------PRRSSSGY
A0A4W6ETK4_BCL2L11      KAIS---PL-DSLGVFQKRS-IFSY-----------------PRRSSSGY
A0A3B4V919_BCL2L11      RRRAR--LA-APVQNHSHLS-CQHF-----------------SRRSSSGY
A0A3B4XZH1_BCL2L11      ---TS--PG-NSLGVFQKRS-IFSY-----------------PRRSSSGY
A0A3Q2SZH6_BCL2L11      PN-----SL-D---VFQRRS-IF---------------------RKSSGY
A0A3B3VNE0_BCL2L11      PA-----SL-D---VFRSRS-IFRP-----------------PRRSSSGY
A0A3B3YII5_BCL2L11      PA-----SL-D---VFRSRS-IFRP-----------------PRRSSSGY
A0A3B3YII5_BCL2L11      PA-----SL-D---VFRSRS-IFRP-----------------PRRSSSGY
A0A3Q3K6I5_BCL2L11      IA-----PL-DSLSVFHTRS-IFHL-----------------PRRSSSGY
A0A3Q1ICY2_BCL2L11      SS-----SS-DGLGVF--RS-VFRL-----------------PRRSSSGY
A0A671W556_BCL2L11      IS-----PL-DSLGVFQTRS-IFHL-----------------PRRASSGY
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      --------------------------------------------------
A0A803SRF0_BCL2L11      --------------------------------------------------
A0A663E983_BCL2L11      --------------------------------------------------
A0A663MLZ1_BCL2L11      --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
A0A663E970_BCL2L11      -------R---SPA--------------------P-LSCDKATQTPSPPC
A0A803WCD8_BCL2L11      -------R---SPA--------------------PALGCDKATQTPSPPC
M3XHJ5_BCL2L11-01       FTFD-SDIVH-SPA--------------------P-VSVHKATQTPSPSS
G1MV54_BCL2L11-01       -----------SNA--------------------LFLLCA----------
A0A3Q1ELG4_BCL2L11      SVPS-SPL---SPK--------------------R-LTADKTTQTPSPSG
A0A3Q1CI15_BCL2L11      SVPS-SPL---SPK--------------------R-LTADKATQTPSPSG
A0A3B3QC78_BCL2L11      HSLD-ISL---PNS--------------------PFMTHNKSTQTPSPSN
A0A667ZMY7_BCL2L11      FSYD-GDSLPGSPR--------------------P-ATVDKATQTPSPSG
A0A287AEC6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A287AEC6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A287AEC6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q2GRS5_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q2GRS5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7M4F197_BCL2L11      --------------------------------------------------
A0A672TST9_BCL2L11      FSFD-AER---SPA--------------------P-LSCDKATQTPSPPC
A0A674H354_BCL2L11      FSFD-AER---SPA--------------------P-LGCDKATQTPSPPC
A0A3Q7S5V2_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N5JE15_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N5JE15_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A5F8H037_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A5F9C9V3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R8M6L7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2Y9Q753_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
M3YDI3_BCL2L11-01       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
F7HHA1_BCL2L11-02       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A096NYC3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
F7HHA1_BCL2L11-03       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A096NYC3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A674IAI8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-05       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
C1KGB7_BCL2L11-01       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
U6CTE3_BCL2L11-03       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A0D9RWE0_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-09       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-14       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q1MV27_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6GE22_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A1U7SU38_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A286XJN2_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K6TRJ7_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-04       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2Y9T3Y6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A452SBG5_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4X1VMQ3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2UX96_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A667H9R7_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q7S5V2_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
G3H020_BCL2L11-01       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A287DFJ0_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2D2G6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2G3J8_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
L8IVA4_BCL2L11-01       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q1MV27_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2D2G6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2G3J8_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A452FCR6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2I3GAA1_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6TRJ7_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-23       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-03       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K5CA52_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A096NYC3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O54918_BCL2L11-03       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A452U4S4_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q2GRS5_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-17       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6TRJ7_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A096NYC3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-02       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-15       ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3GAA1_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N5JE15_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R8M6L7_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A673SRF7_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R8M6L7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R8M6L7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N5JE15_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-08       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-21       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3GAA1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-12       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3GAA1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-06       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-18       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3GAA1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A667H9R7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A671FCV3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A1U7SU38_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A1U7SU38_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6GE22_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6GE22_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O54918_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
G3H020_BCL2L11-02       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R8M6L7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
F7HHA1_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-05       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3GAA1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A1U7SU38_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6GE22_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R8M6L7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5CA52_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Q1U2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPTC
A0A2R8M6L7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6TRJ7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A096NYC3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-11       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-19       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5NTQ5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5HZ87_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5X1Y3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6E1Z6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K5Z7V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A096NYC3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6KJM8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2Y4B3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
O43521_BCL2L11-10       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3GAA1_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2R9BZX9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I3S5F6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A1U7SU38_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A1U7SU38_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4X1VMQ3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
C1KGB6_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q2GRS5_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A673SRF7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A671FCV3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2Y9T3Y6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N5JE15_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
U6CTE3_BCL2L11-02       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4X1VMQ3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2UX96_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A667H9R7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A287DFJ0_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2K6GE22_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A5F9C9V3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2D2G6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2G3J8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
L8IVA4_BCL2L11-02       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A3Q1MV27_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2D2G6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4W2G3J8_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A452FCR6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
W5PY58_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A286XJN2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A286XJN2_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
H0XW23_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A671FCV3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2Y9Q753_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2Y9T3Y6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
U6CTE3_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4X1VMQ3_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A673SRF7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N5JE15_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A2I2UX96_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A667H9R7_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
U3IW89_BCL2L11-01       FSFE-AER---SPA--------------------P-MSCDKATQTPSPPC
A0A3Q2U844_BCL2L11      FSFE-AER---SPA--------------------P-MSCDKATQTPSPPC
A0A669QMB4_BCL2L11      FSFE-AER---SPA--------------------P-MSCDKATQTPSPPC
A0A2K6E1Z6_BCL2L11      ------TR---SP-------------------------CDKSTQTPSPPC
A0A5F8H037_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A4X2L9J9_BCL2L11      ------DR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N4NUH6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A7N4NUH6_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
G3SU55_BCL2L11-01       FSFD-TDR---SPA--------------------P-MSCDKSTQTPSPPC
A0A670KEZ9_BCL2L11      FSFD-TDR---SPA--------------------P-MSCDKATQTPSPPC
A0A670Y3D3_BCL2L11      FSFD-IDR---SPA--------------------P-MNCDKATQTPSPPC
A0A6I8NCK5_BCL2L11      FSFD-TDR---SPP--------------------P-VSCDKSTQTPSPHC
A0A6I8NCK5_BCL2L11      ------DR---SPP--------------------P-VSCDKSTQTPSPHC
A0A6I8NCK5_BCL2L11      ------DR---SPP--------------------P-VSCDKSTQTPSPHC
A0A6I8NCK5_BCL2L11      ------DR---SPP--------------------P-VSCDKSTQTPSPHC
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      FSSD-GDS---LPS--------------------SPLSPRPVTADKATQT
A0A3G3M2M0_BCL2L11      FSVD-SDS---VPG--------------------SPLLPNISEAQDDQND
A0A672PQD1_BCL2L11      FSVD-SDS---VPG--------------------SPLMPNISEAQDGPND
A0A673NIJ7_BCL2L11      FSVD-SDS---VPS--------------------SPLMPNISEAQDGQND
B2KKY9_BCL2L11-01       FSVD-SDS---VPG--------------------SPLMPNISEAQDGQND
B8JK68_BCL2L11-01       FSVD-SDS---VPG--------------------SPLMPNISEAQDGQND
A0A671M057_BCL2L11      FSVD-SDS---VPG--------------------SPLMPNISEAQDGQND
A0A672L1R2_BCL2L11      FSVD-SDS---VPS--------------------SPLMPNISEAQDGQND
A0A671SJ75_BCL2L11      FSVD-SDS---MPS--------------------SPLMPNISEAQDGQND
A0A673IWZ7_BCL2L11      FSVD-SDS---VPS--------------------SPLMPNISEAQDGQND
A0A4W3IWD3_BCL2L11      FTFDVDIGLMARPT-----------------------SCDKSTQTPSPTC
A0A4W3IWD3_BCL2L11      FTFDVDIGLMARPT-----------------------SCDKSTQTPSPTC
A0A4W3IWD3_BCL2L11      FTFDVDIGLMARPT-----------------------SCDKSTQTPSPTC
A0A3P8RLE2_BCL2L11      FSADGADSVPSSPL-----------------SPKR-LTADKATQTPSPSG
A0A673CKA1_BCL2L11      FSYE-SDSLPDSPP-----------------SPRP-MTADKATQTPSLTA
A0A7M4F197_BCL2L11      RQLQ-PRERPSQPQPVRPGAPTSIQTQYQDRSPAP-MSCDKSTQTPSPPC
K7GA86_BCL2L11-01       GQFQ-SIERPSQPQHLRPGAPTSIQTQYQDRSPVP-MSCDKSTQTPSPPC
A0A4W4H3Y1_BCL2L11      FSFD-SE--PSSPL----------------------MTHSTSTQTPS---
A0A3B4BSH7_BCL2L11      FSFE-SE--PSSPL----------------------LTSPSLSVCSTELW
A0A3B4BSH7_BCL2L11      FSFE-SE--PSSPL----------------------VTHSASTQTPSPSS
A0A3B4BSH7_BCL2L11      FSFE-SE--PSSPL----------------------VTHSASTQTPSPSS
A0A3B1JXK6_BCL2L11      FSFD-SE--PSSPL----------------------LMHSASTQTPSPSS
A0A4W4H3Y1_BCL2L11      FSFD-SE--PSSPL----------------------MTHSTSTQTPSPSS
A0A4W5NF23_BCL2L11      FSFD-SDSIPSSPL----------------------LKDNKSTQTPSPSS
A0A4W5R3N6_BCL2L11      FSFD-SDSIPSSPL----------------------LKDNKSTQTPSPSS
A0A1S3SAH9_BCL2L11      FSFD-SDSIPSSPV----------------------LKDNKSTQTPSPSS
A0A673WET2_BCL2L11      FSFD-SDSIPSSPL----------------------LKDNKSTQTPSPSS
A0A3P8XIA2_BCL2L11      FSFD-CDSIPSSPL----------------------LRNNKSTQTPSPSS
A0A673XGV4_BCL2L11      FSFD-SDSIPSSPL----------------------LKD-KSTQTPSPSS
A0A4W5R3N6_BCL2L11      FSFD-SDSIPSSPL----------------------LKDNKSTQTPSPSS
A0A4W5R3N6_BCL2L11      FSFD-SDSIPSSPL----------------------LKDNKSTQTPSPSS
A0A669C520_BCL2L11      FSSD-CDSLPSSPL-----------------SPKP-VMSDKAIQTPSPTG
A0A3Q3ESW6_BCL2L11      FSYD-GDSLPSSPL-----------------SPRP-LTADKATQTPSPSG
A0A3P9N073_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKTTQTPSPTG
A0A3Q3B113_BCL2L11      FSFE-GDSLPSSPL-----------------SPKP-VTAEKATQTPSPTG
A0A3B5M375_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKATQTPSLTG
A0A3B5QAM1_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKATQTPSLTG
A0A3B5QAM1_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKATQTPSLTG
A0A4W6ETK4_BCL2L11      FSFD-GESLPSSPL-----------------SPRP-ATADRATQTPSPTS
A0A4W6ETK4_BCL2L11      FSFD-GESLPSSPL-----------------SPRP-ATADRATQTPSPTS
A0A4W6ETK4_BCL2L11      FSFD-GESLPSSPL-----------------SPRP-ATADRATQTPSPTS
A0A3B4V919_BCL2L11      FSFD-SDSLPSSPL-----------------SPRP-ATVERTTQTPSPTS
A0A3B4XZH1_BCL2L11      FSFD-SDSLPTSPL-----------------SPRP-ATAERTTQTPSPTS
A0A3Q2SZH6_BCL2L11      FSFD-CESLPSTPL-----------------SPHP-LTADKATQTASPTG
A0A3B3VNE0_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKATQTPSPTG
A0A3B3YII5_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKATQTPSPTG
A0A3B3YII5_BCL2L11      FSFD-CDSLPSSPL-----------------SPHP-VTADKATQTPSPTG
A0A3Q3K6I5_BCL2L11      FSND-SDSVPSSPL-----------------SPRP-VTADKVTQTPSPSS
A0A3Q1ICY2_BCL2L11      FSYD-SDSQPSSPL-----------------SPRP-VTFDRATQTPSPTG
A0A671W556_BCL2L11      FSSD-GDSLPSSPL-----------------SPRP-LTVDRATQTPSPTG
                                                                          

Q6JTU4_BCL2L11-01       ----------------------------------------MRQAEPADMR
A0A803VLS8_BCL2L11      ---------------------------------------MFHKAAVPEVQ
A0A803SRF0_BCL2L11      ------------------------------------------------MQ
A0A663E983_BCL2L11      -------------------------------------ITQAAPFSPEDVQ
A0A663MLZ1_BCL2L11      -------------------------------------GSQAAPFSSKDVQ
G1PDJ5_BCL2L11-01       -------------------------------------SMQQSQALPVDMR
A0A663E970_BCL2L11      QALSHCLSAMGD-------------------------------SSLGFLL
A0A803WCD8_BCL2L11      QALSHCLSAMGKLRGG--------------SPSSSSSSSSSSPGSASWLP
M3XHJ5_BCL2L11-01       QLIVHVQHCL---------------------------AQREQHPETHGKN
G1MV54_BCL2L11-01       ---------------A---------------------SRWRSHSLAEEIQ
A0A3Q1ELG4_BCL2L11      QVIRHALERMAG---E---------------------AHRGGPETQRQQH
A0A3Q1CI15_BCL2L11      QVIKHALERMTD---E---------------------AHGGGPGT--QQH
A0A3B3QC78_BCL2L11      HLVCIYLSSV-----------------------------TRTLSMLPDMR
A0A667ZMY7_BCL2L11      QAVTH----------A---------------------VLRLTEEHPHGEH
A0A287AEC6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A287AEC6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A287AEC6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A3Q2GRS5_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A3Q2GRS5_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A7M4F197_BCL2L11      ---------------A---------------------SRWQYRSIPEDMQ
A0A672TST9_BCL2L11      QALSHCLSAM-----A---------------------SRWQSPSRAEDLQ
A0A674H354_BCL2L11      QALSHCLSAM-----A---------------------SRWQSHSPAEEVQ
A0A3Q7S5V2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      QAFNHYLSAMGKQDHA---------------------SMRQSQSIPADMR
A0A7N5JE15_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A7N5JE15_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A5F8H037_BCL2L11      QAFNHYLSAMGKQDHA---------------------SMRQSQSIPADMR
A0A5F9C9V3_BCL2L11      QAFNHYLSAM-----G---------------------KQSLGKTKPAYGC
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2Y9Q753_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
M3YDI3_BCL2L11-01       QAFNHYLSAM-----A---------------------SRRQSQAVPADMR
F7HHA1_BCL2L11-02       QAFNHYLSAM-----A---------------------SRRQAE--PADMR
A0A096NYC3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQAE--PADMR
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQAE--PADMR
F7HHA1_BCL2L11-03       QAFNHYLSAM-----A---------------------SRRQAE--PADMR
A0A096NYC3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQAE--PADMR
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQAE--PADMR
A0A674IAI8_BCL2L11      QAFNHYLSAM-----A---------------------SRWESPSVREDMQ
A0A7N4NUH6_BCL2L11      ---------------A---------------------SMRQSQSIPADMR
A0A2K6GE22_BCL2L11      ---------------A---------------------SMRQFQAEPADMR
A0A2R8M6L7_BCL2L11      ---------------A---------------------SMRQSQAEPAGMR
A0A2K5Q1U2_BCL2L11      ---------------A---------------------SMRQSQAEPAGMR
O43521_BCL2L11-20       ---------------A---------------------SMR--QAEPADMR
A0A2I2Y4B3_BCL2L11      ---------------A---------------------SMR--QAEPADMR
O43521_BCL2L11-07       ---------------A---------------------SMR--QAEPADMR
O43521_BCL2L11-22       ---------------A---------------------SMR--QAEPADMR
A0A2I3GAA1_BCL2L11      ---------------A---------------------SMR--QAEPADMR
A0A2R9BZX9_BCL2L11      ---------------A---------------------SMR--QAEPADMR
A0A2I3S5F6_BCL2L11      ---------------A---------------------SMR--QAEPADMR
A0A2K5NTQ5_BCL2L11      ---------------A---------------------SRR--QAEPADMR
A0A2K5X1Y3_BCL2L11      ---------------A---------------------SRR--QAEPADMR
A0A2K5Z7V3_BCL2L11      ---------------A---------------------SRR--QAEPADMR
A0A2K5HZ87_BCL2L11      ---------------A---------------------SRR--QAEPADMR
A0A2K6KJM8_BCL2L11      ---------------A---------------------SRR--QAEPADMR
A0A2K6QIJ1_BCL2L11      ---------------A---------------------SRR--QAEPADMR
C1KGB8_BCL2L11-01       ---------------A---------------------SMRQSQAEPADMR
A0A1U7SU38_BCL2L11      ---------------E---------------------SMRQSQAEPPDMR
A0A673SRF7_BCL2L11      ---------------A---------------------SMRQSQAAPADMR
A0A2I2UX96_BCL2L11      ---------------A---------------------SMRQPQAVPADMR
A0A667H9R7_BCL2L11      ---------------A---------------------SMRQPQAVPADMR
A0A7N5JE15_BCL2L11      ---------------A---------------------SMRQSQAVPADMR
U6CTE3_BCL2L11-04       ---------------A---------------------SRRQSQAVPADMR
A0A3Q2GRS5_BCL2L11      ---------------A---------------------SMRQSQAVPADMR
A0A287AEC6_BCL2L11      ---------------A---------------------SMRQSQAEPADMR
A0A4X1VMQ3_BCL2L11      ---------------A---------------------SMRQSQAEPADMR
A0A671FCV3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQPQALPADLR
O54918_BCL2L11-06       ---------------A---------------------SIRQSQEEPEDLR
O54918_BCL2L11-08       ---------------A---------------------SIRQSQEEPEDLR
O54918_BCL2L11-05       QAFNHYLSAM-----A---------------------SIRQSQEEPEDLR
C1KGB7_BCL2L11-01       QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
U6CTE3_BCL2L11-03       QAFNHYLSAM-----A---------------------SRRQSQAVPADMR
A0A0D9RWE0_BCL2L11      QAFNHYLSAM-----A---------------------SRRQAE--PADMR
O43521_BCL2L11-09       QAFNHYLSAM-----A---------------------SMRQAE--PADMR
O43521_BCL2L11-14       QAFNHYLSAM-----A---------------------SMRQAE--PADMR
A0A3Q1MV27_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A2K6GE22_BCL2L11      QAFNHYLSAM-----A---------------------SMRQFQAEPADMR
A0A1U7SU38_BCL2L11      QAFNHYLSAM-----E---------------------SMRQSQAEPPDMR
A0A286XJN2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAGPPHLR
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
O43521_BCL2L11-04       QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2Y9T3Y6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A452SBG5_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQDVPADMR
A0A4X1VMQ3_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A2I2UX96_BCL2L11      QAFNHYLSAM-----A---------------------SMRQPQAVPADMR
A0A667H9R7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQPQAVPADMR
A0A3Q7S5V2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
G3H020_BCL2L11-01       QAFNHYLSAM-----A---------------------SIRQSQEEPADIR
A0A287DFJ0_BCL2L11      QAFNHYLSAM-----A---------------------SMRESQAEPADMR
A0A4W2D2G6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A4W2G3J8_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
L8IVA4_BCL2L11-01       QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A3Q1MV27_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A4W2D2G6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A4W2G3J8_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A452FCR6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----G---------------------DIS----------
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----D---------------------EAAGSSL------
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSL--ALRR
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSLRIALHR
O43521_BCL2L11-23       QAFNHYLSAM-----D---------------------DSAGSSLRIALHR
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----D---------------------DSAGSSLRIALHR
O43521_BCL2L11-03       QAFNHYLSAM-----D---------------------DSAGSSLRIALHR
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----D---------------------DSAGSSLRIALHR
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----D---------------------DSAGSSLRIALHR
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSLRIALHR
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSLGIALHR
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSLGIALRR
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----D---------------------EATESSLGIALRR
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSLGIALHR
A0A096NYC3_BCL2L11      QAFNHYLSAM-----D---------------------EATGSSLGIALHR
O54918_BCL2L11-03       QAFNHYLSAM-----D---------------------Q--LENLNQVAQN
A0A452U4S4_BCL2L11      QAFNHYLSAM-----D---------------------LWTVERHLETAL-
A0A3Q2GRS5_BCL2L11      QAFNHYLSAM------------------------------VRAIEEVVV-
O43521_BCL2L11-17       QAFNHYLSAM------------------------------VREIEEVVV-
A0A2K5CA52_BCL2L11      QAFNHYLSAM---------------------------------GDISLWF
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDSSL-F
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----V---------------------VIRMDIGDISLWF
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDTSLWF
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDTSLWF
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDTSLWF
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDLSLCF
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDLSLCF
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDSSLWF
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDSSLWF
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDSSLWF
A0A096NYC3_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDSSLWF
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----V---------------------VILEDIGDLSLWF
O43521_BCL2L11-02       QAFNHYLSAM-----V---------------------VILEDIGDLSLCF
O43521_BCL2L11-15       QAFNHYLSAM-----V---------------------VILEDIGDLSLCF
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----V---------------------VILEDVGDISLWF
A0A7N5JE15_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A673SRF7_BCL2L11      QAINHYLSAM-----A---------------------SMRQSQAAPADMR
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A7N5JE15_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
O43521_BCL2L11-01       Q-------------------------------------------------
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----A---------------------DWD----------
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----A---------------------DWD----------
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----A---------------------DWA----------
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
O43521_BCL2L11-08       QAFNHYLSAM-----A---------------------NWD----------
O43521_BCL2L11-21       QAFNHYLSAM-----A---------------------NWD----------
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----A---------------------NWD----------
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
O43521_BCL2L11-12       QAFNHYLSAM-----G---------------------IFE----------
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----G---------------------IFE----------
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----G---------------------VFE----------
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
O43521_BCL2L11-06       QAFNHYLSAM-----V---------------------REIEEVVV-----
O43521_BCL2L11-18       QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A667H9R7_BCL2L11      QAFNHYLSAM-------------------------------GLFE-----
A0A671FCV3_BCL2L11      QAFNHYLSAM-------------------------------GLPE-----
A0A1U7SU38_BCL2L11      QAFNHYLSAM-------------------------------GLFE-----
A0A1U7SU38_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
A0A2K6GE22_BCL2L11      QAFNHYLSAM-------------------------------GIFE-----
A0A2K6GE22_BCL2L11      QAFNHYLSAM-----V---------------------REIEEVVV-----
O54918_BCL2L11-01       QAFNHYLSAM-----A---------------------SIRQSQEEPEDLR
G3H020_BCL2L11-02       QAFNHYLSAM-----A---------------------SIRQSQEEPADIR
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
F7HHA1_BCL2L11-01       QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
O43521_BCL2L11-05       QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A1U7SU38_BCL2L11      QAFNHYLSAM-----E---------------------SMRQSQAEPPDMR
A0A2K6GE22_BCL2L11      QAFNHYLSAM-----A---------------------SMRQFQAEPADMR
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5CA52_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5Q1U2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2R8M6L7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K6TRJ7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPAGMR
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A096NYC3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
O43521_BCL2L11-11       QAFNHYLSAM-----A---------------------SMR--QAEPADMR
O43521_BCL2L11-19       QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2K5NTQ5_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5HZ87_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5X1Y3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K5Z7V3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A096NYC3_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6KJM8_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2K6QIJ1_BCL2L11      QAFNHYLSAM-----A---------------------SRR--QAEPADMR
A0A2I2Y4B3_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
O43521_BCL2L11-10       QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2I3GAA1_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2R9BZX9_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A2I3S5F6_BCL2L11      QAFNHYLSAM-----A---------------------SMR--QAEPADMR
A0A1U7SU38_BCL2L11      QAFNHYLSAM-----E---------------------SMRQSQAEPPDMR
A0A1U7SU38_BCL2L11      QAFNHYLSAM-----E---------------------SMRQSQAEPPDMR
A0A4X1VMQ3_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
C1KGB6_BCL2L11-01       QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A3Q2GRS5_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A673SRF7_BCL2L11      QAINHYLSAM-----A---------------------SMRQSQAAPADMR
A0A671FCV3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQPQALPADLR
A0A2Y9T3Y6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A7N5JE15_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
U6CTE3_BCL2L11-02       QAFNHYLSAM-----A---------------------SRRQSQAVPADMR
A0A4X1VMQ3_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A2I2UX96_BCL2L11      QAFNHYLSAM-----A---------------------SMRQPQAVPADMR
A0A667H9R7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQPQAVPADMR
A0A287DFJ0_BCL2L11      QAFNHYLSAM-----A---------------------SMRESQAEPADMR
A0A2K6GE22_BCL2L11      QAFNHYLSAM-----A---------------------SMRQFQAEPADMR
A0A5F9C9V3_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADTR
A0A4W2D2G6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A4W2G3J8_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
L8IVA4_BCL2L11-02       QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A3Q1MV27_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A4W2D2G6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A4W2G3J8_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A452FCR6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
W5PY58_BCL2L11-01       QAFNHYLSAM-----A---------------------SMRQSQAVPADTR
A0A286XJN2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAGPPHLR
A0A286XJN2_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAGPPHLR
H0XW23_BCL2L11-01       QAFNHYLSAM-----A---------------------SMRQSQAEPADLR
A0A671FCV3_BCL2L11      QAFNHYLSAM-----A---------------------SRRQPQALPADLR
A0A2Y9Q753_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A2Y9T3Y6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
U6CTE3_BCL2L11-01       QAFNHYLSAM-----A---------------------SRRQSQAVPADMR
A0A4X1VMQ3_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAEPADMR
A0A673SRF7_BCL2L11      QAINHYLSAM-----A---------------------SMRQSQAAPADMR
A0A7N5JE15_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQAVPADMR
A0A2I2UX96_BCL2L11      QAFNHYLSAM-----A---------------------SMRQPQAVPADMR
A0A667H9R7_BCL2L11      QAFNHYLSAM-----A---------------------SMRQPQAVPADMR
U3IW89_BCL2L11-01       QAVSHYLSAM-----A---------------------SRWRSHSLAEEIQ
A0A3Q2U844_BCL2L11      QAVSHYLSAM-----A---------------------SRWRSHSLAEEIQ
A0A669QMB4_BCL2L11      QAVSHYLSAM-----A---------------------SRWRSHSLAEEIQ
A0A2K6E1Z6_BCL2L11      QAFNHYLSAM-----A---------------------SRRQAE--PADMR
A0A5F8H037_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQSIPADMR
A0A4X2L9J9_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQSIPADMR
A0A7N4NUH6_BCL2L11      QAFNHYLSAM-----A---------------------SMRQSQSIPADMR
A0A7N4NUH6_BCL2L11      QAFNHYLSAMGKQDHA---------------------SMRQSQSIPADMR
G3SU55_BCL2L11-01       QAINHYLSAM-----A---------------------SMRQSQALPADLR
A0A670KEZ9_BCL2L11      QAFSHYLSAM-----A---------------------YRWQSRSIPEDIR
A0A670Y3D3_BCL2L11      QAINHYLSAM-----A---------------------SRWQSRPIPEDMQ
A0A6I8NCK5_BCL2L11      QAFNHYLSAM-----A---------------------SIRQPQSVPEDMR
A0A6I8NCK5_BCL2L11      QAFNHYLSAM-----A---------------------SIRQPQSVPEDMR
A0A6I8NCK5_BCL2L11      QAFNHYLSAM-----A---------------------SIRQPQSVPEDMR
A0A6I8NCK5_BCL2L11      QAFNHYLSAM-----A---------------------SIRQPQSVPEDMR
A0A6I8NCK5_BCL2L11      ---------------A---------------------SIRQPQSVPEDMR
A0A3Q3SYA1_BCL2L11      PSLTSQ--------------------------------------------
A0A3G3M2M0_BCL2L11      EVWFAEPS-------H---------------------QHVQMAAPVGAMG
A0A672PQD1_BCL2L11      EVWFAEPS-------H---------------------QHAQMAAPVGAMG
A0A673NIJ7_BCL2L11      EVWFAEPS-------H---------------------QHAQMAAPVGAMG
B2KKY9_BCL2L11-01       EVWLSEHS-------H---------------------QHLQMAAPVAALP
B8JK68_BCL2L11-01       EVWLSEHS-------H---------------------QHLQMAAPVAALP
A0A671M057_BCL2L11      EVWFAEPS-------H---------------------QHAQMAAPVGAMG
A0A672L1R2_BCL2L11      EVWSAEPS-------H---------------------QHVQMAAPVGAMG
A0A671SJ75_BCL2L11      EVWSAEPS-------H---------------------QHVQMAAPVGAMG
A0A673IWZ7_BCL2L11      EVWSAEPS-------H---------------------QHVQMAAPVGAMG
A0A4W3IWD3_BCL2L11      QAIYLARQALAQAP-------LDHTSLSLMSVNFLGNHNRELEMMVMRYS
A0A4W3IWD3_BCL2L11      QAIYLARQA-------------------LAQAPHSQTHGKNL-LLCIFLP
A0A4W3IWD3_BCL2L11      QAIYLAHHT--------------SLSLISTNKQFLGNHNRELEMMVMRYS
A0A3P8RLE2_BCL2L11      QVIKHALERMTDEAHGGGPG-TQQHGELRLTYTREISCTFNLCNSFCTLF
A0A673CKA1_BCL2L11      QVMIHALERTAEAHGE-------------------------GAFLTHDVW
A0A7M4F197_BCL2L11      QAFNHYLSAMGKQDHA---------------------SRWQYRSIPEDMQ
K7GA86_BCL2L11-01       QAFNHYLSAMGKQDHA---------------------SRWESPSIREDMQ
A0A4W4H3Y1_BCL2L11      ---------------------------------------PSSQVIIHALQ
A0A3B4BSH7_BCL2L11      PLYNH--------------------------------HPPHGAAPAGDMR
A0A3B4BSH7_BCL2L11      QVITHALQRIAEARGN-----AQTF---ELWPLYNH-HPPHGAAPAGDMR
A0A3B4BSH7_BCL2L11      QVITHALQRIAEARGN-----AQTF---ELWPLYNH-HPPHGAAPAGDMR
A0A3B1JXK6_BCL2L11      QVIIHALQRISEARGD-----AQSF---ELCPGPNH-CPPHRAAAAGDMQ
A0A4W4H3Y1_BCL2L11      QVIIHALQRISEAQGN-----GQNY---ELWTG-----PPNEALSVRDMR
A0A4W5NF23_BCL2L11      QVITHALQRLSRALET-----RRDY---DVWPNPLRPYRARPPPTAGDMR
A0A4W5R3N6_BCL2L11      QIMTHALQRMSQAQET-----NRDY---DAWPNPLHPYRPRPQPTAGDMW
A0A1S3SAH9_BCL2L11      QVMTHALQRMSQAQET-----NRDY---DAWPNPLHPYRPRPPPTAGDMW
A0A673WET2_BCL2L11      QVMTHALQRMSQAQET-----NRDY---DAWPNPLHPYRPRPPPTAGDMW
A0A3P8XIA2_BCL2L11      QVITHAMRRLSKPQDT-----WRGY---EAWPTPHHPYRPRPPPIAGDMR
A0A673XGV4_BCL2L11      QVITHALQRMSRALET-----GRDYGKAHVWPNPLRPYRSRPPPTAGDMR
A0A4W5R3N6_BCL2L11      QIMTHALQRMSQAQET-----NRDY---DAWPNPLHPYRPRPQPTAGDMW
A0A4W5R3N6_BCL2L11      QIMTHALQRMSQAQET-----NRDY---DAWPNPLHPYRPRPQPTAGDMW
A0A669C520_BCL2L11      QVLIHALQRMGEVRGEGPGTQHGEHRL---------------FMYNSRIN
A0A3Q3ESW6_BCL2L11      QVMQHALQRMTEAHGGGPGT-QQQYGH------SPSLTSRRQRTAAGDMQ
A0A3P9N073_BCL2L11      QVMNHALQRMAVEHEIPKLN-VKGKEE------KGGRGGAFVIIPKRETN
A0A3Q3B113_BCL2L11      QVMNHALQRMAVEQGGGPGT-HRLHGS------SPNPSGTQARNAAGDME
A0A3B5M375_BCL2L11      QVMNHALQRMAVEHGG-----LGLQGE------QT---SVL--PPPPSET
A0A3B5QAM1_BCL2L11      QVMNHALQRMAVEHGG-----LGLHGQ------SPNHYSTI--NAARDMQ
A0A3B5QAM1_BCL2L11      QVMNHALQRMAVEHGG-----LGLHGQ------SPNHYSTI--NAARDMQ
A0A4W6ETK4_BCL2L11      QVMKHFLQRMTEAHGRGPGT-QQLHVDTPVLLLSPNPSSTQQRNAAGDMQ
A0A4W6ETK4_BCL2L11      QVMKHFLQRMTEAHGRGPGT-QQLHGS------SPNPSSTQQRNAAGDMQ
A0A4W6ETK4_BCL2L11      QVMKHFLQRMTEAHGRGPGT-QQLHGS------SPNPSSTQQRNAAGDMQ
A0A3B4V919_BCL2L11      QVMKHALQRMAEAHGGGARM-QQQH-------------------------
A0A3B4XZH1_BCL2L11      QVMKHALQRMAEAHGGGARM-QQQQHG-------------EHRHFASGDM
A0A3Q2SZH6_BCL2L11      QVMNHALQRMAAEHGGQPARILGLHGH------SFSARQG---NAARDMQ
A0A3B3VNE0_BCL2L11      QVMNHALQRMAVEHGG-----LGLHGH------SPNHYST--INAARDMQ
A0A3B3YII5_BCL2L11      QVMNHALQRMAVEHGG-----LGLHGH------SPNHYST--INAARDMQ
A0A3B3YII5_BCL2L11      QVMNHALQRMAVEHGG-----LGLHGH------SPNHYST--INAARDMQ
A0A3Q3K6I5_BCL2L11      QVMNHALQCMAEAHGGRPGT-HRQDAS------SPSPSSARQQNAIRDMQ
A0A3Q1ICY2_BCL2L11      QVMNHALQRLAEANGSDLRT-HQQHGS------DLSSSSTQQQNAAGDMQ
A0A671W556_BCL2L11      QVMQHALQRMAEERGPG--T-HQLHGH------SPSPSSTRPQNAAGDMQ
                                                                          

Q6JTU4_BCL2L11-01       PEIWIAQE--------LRRIGDEFNAYYARRLEK----------------
A0A803VLS8_BCL2L11      PEVWIAQE--------LRRIGDEFNASYCPR-------------------
A0A803SRF0_BCL2L11      PEIWIAQE--------LRRIGDEFNASHCPR-------------------
A0A663E983_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A663MLZ1_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
G1PDJ5_BCL2L11-01       PEMWIAQE--------LRRIGDEFNNSYRNP-------------------
A0A663E970_BCL2L11      LFLHK-------PRGVIGARVVQLPLVLVRPKIGA---------------
A0A803WCD8_BCL2L11      LLTWRGFPQSPAKRGSSGGCGGEAPGETCKG-------------------
M3XHJ5_BCL2L11-01       PLNFT---------------------------------------------
G1MV54_BCL2L11-01       PEIWIAQE--------LRRIGDEFNASYSLP---------RLGACPDAAP
A0A3Q1ELG4_BCL2L11      GELNDCRSCGQRKTSLTFS-----AVVFALA---------IVC---PCLL
A0A3Q1CI15_BCL2L11      GEL---RLTYTREISCTFNLCNSFCTLFSVT---------VFCHLQSLFA
A0A3B3QC78_BCL2L11      PEMLVARE--------LRRIGDKFNDIYING---------VSILLCPHCP
A0A667ZMY7_BCL2L11      RNSHTASHVDGPLPLRMIQ-------------------------------
A0A287AEC6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A287AEC6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A287AEC6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A3Q2GRS5_BCL2L11      PEVWIAQE--------LRRIGDEFNASYPRR---------V---------
A0A3Q2GRS5_BCL2L11      PEVWIAQE--------LRRIGDEFNASYPRR---------V---------
A0A7M4F197_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR---------R---------
A0A672TST9_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR---------R---------
A0A674H354_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR---------R---------
A0A3Q7S5V2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      PEIWIAQE--------LRRIGDEFNASYPRR---------N---------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A5F8H037_BCL2L11      PEIWIAQE--------LRRIGDEFNASYYPR---------RGFLDNNYQG
A0A5F9C9V3_BCL2L11      LHSCVCGVHVTCILLFLKGRGFPSAGCFPRC---------PPRPGLDWAR
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2Y9Q753_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
M3YDI3_BCL2L11-01       PEMWIAQE--------LRRIGDEFNAYYPRR---------V---------
F7HHA1_BCL2L11-02       PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A096NYC3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5X1Y3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
F7HHA1_BCL2L11-03       PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A096NYC3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5X1Y3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A674IAI8_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR---------R---------
A0A7N4NUH6_BCL2L11      PEIWIAQE--------LRRIGDEFNASYPRR---------NVIVTMWKFT
A0A2K6GE22_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A2K5Q1U2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
O43521_BCL2L11-20       PEIWIAQE--------LRRIGDEFNAYYARR---------MP--------
A0A2I2Y4B3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------LA--------
O43521_BCL2L11-07       PEIWIAQE--------LRRIGDEFNAYYARR---------LA--------
O43521_BCL2L11-22       PEIWIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2I3GAA1_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2R9BZX9_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2I3S5F6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2K5NTQ5_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2K5X1Y3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2K5Z7V3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2K5HZ87_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2K6KJM8_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LA--------
A0A2K6QIJ1_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LA--------
C1KGB8_BCL2L11-01       PEIWIAQE--------LRRIGDEFNAYYPRR---------VMLFSLPPFS
A0A1U7SU38_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A673SRF7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A2I2UX96_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A667H9R7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
U6CTE3_BCL2L11-04       PEMWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A3Q2GRS5_BCL2L11      PEVWIAQE--------LRRIGDEFNASYPRR---------LA--------
A0A287AEC6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A4X1VMQ3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------LA--------
A0A671FCV3_BCL2L11      PEIWIAQE--------LRRIGDEFNACYPRR---------AR--------
O54918_BCL2L11-06       PEIRIAQE--------LRRIGDEFNETYTRR---------V---------
O54918_BCL2L11-08       PEIRIAQE--------LRRIGDEFNETYTRR---------V---------
O54918_BCL2L11-05       PEIRIAQE--------LRRIGDEFNETYTRR---------V---------
C1KGB7_BCL2L11-01       PEIWIAQE--------LRRIGDEFNAYYPRR---------VM--------
U6CTE3_BCL2L11-03       PEMWIAQE--------LRRIGDEFNAYYPRR---------LE--------
A0A0D9RWE0_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------LE--------
O43521_BCL2L11-09       PEIWIAQE--------LRRIGDEFNAYYARR---------LE--------
O43521_BCL2L11-14       PEIWIAQE--------LRRIGDEFNAYYARR---------LE--------
A0A3Q1MV27_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K6GE22_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A1U7SU38_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------A---------
A0A286XJN2_BCL2L11      PEIWIAQE--------LRRIGDEFNASYPRR---------V---------
A0A2K5CA52_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K5Q1U2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K6TRJ7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K6QIJ1_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5NTQ5_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5HZ87_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6E1Z6_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5Z7V3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6KJM8_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2I2Y4B3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
O43521_BCL2L11-04       PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2R9BZX9_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2I3S5F6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2Y9T3Y6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A452SBG5_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4X1VMQ3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2I2UX96_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A667H9R7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A3Q7S5V2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
G3H020_BCL2L11-01       PEIWIAQE--------LRRIGDEFNESYRRR---------AN--------
A0A287DFJ0_BCL2L11      PEIWIAQE--------LRRIGDEFNLYYPRR---------V---------
A0A4W2D2G6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2G3J8_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
L8IVA4_BCL2L11-01       PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A3Q1MV27_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2D2G6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2G3J8_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A452FCR6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K5Q1U2_BCL2L11      ------------------------LWFSQGT---------EQ--------
A0A2I3GAA1_BCL2L11      EVQWPF------------------EWLAKSS-------------------
A0A2K6TRJ7_BCL2L11      EVQCPL------------------EWLAKSS-------------------
A0A2K5HZ87_BCL2L11      EVQ-----------------------------------------------
O43521_BCL2L11-23       EVQWPL------------------KWLAKSS-------------------
A0A2I2Y4B3_BCL2L11      EVQWPL------------------EWLAKSS-------------------
O43521_BCL2L11-03       EVQWPL------------------KWLAKSS-------------------
A0A2R9BZX9_BCL2L11      EVQWPL------------------KWLAKSS-------------------
A0A2I3S5F6_BCL2L11      EVQWPL------------------KWLAKSS-------------------
A0A2K5NTQ5_BCL2L11      EVQWPL------------------ECLASS--------------------
A0A2K5Z7V3_BCL2L11      EVQWPL------------------ECLASS--------------------
A0A2K5Q1U2_BCL2L11      EVQWPV------------------EWLAKSS-------------------
A0A2K5CA52_BCL2L11      EVQWPL------------------EWLAKSS-------------------
A0A2K5X1Y3_BCL2L11      EVQWPL------------------EWLASS--------------------
A0A096NYC3_BCL2L11      EVQWPL------------------EWLASS--------------------
O54918_BCL2L11-03       IHGDAW------------------YN------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      RFIFTFFD--------LYG-----HHHSQGT---------EQ--------
A0A2K5Z7V3_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A2K6TRJ7_BCL2L11      RFIFTFFD--------LYG-----YHHSQGT---------EQ--------
A0A2K6KJM8_BCL2L11      GFIFTGLD--------LYVVWIYIYHHSQDT---------EQ--------
A0A2K6QIJ1_BCL2L11      GFIFTGLD--------LYVVWIYIYHHSQDT---------EQ--------
A0A2K5HZ87_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A2R9BZX9_BCL2L11      GFIFTGLD--------LYG-----HHHSQDA---------EQ--------
A0A2I3S5F6_BCL2L11      GFIFTGLD--------LYG-----HHHSQDA---------EQ--------
A0A2K5NTQ5_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A2K5X1Y3_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A2K6E1Z6_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A096NYC3_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A2I2Y4B3_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
O43521_BCL2L11-02       GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
O43521_BCL2L11-15       GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A2I3GAA1_BCL2L11      GFIFTGLD--------LYG-----HHHSQDT---------EQ--------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------G---------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------VN--------
A0A673SRF7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------GE--------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------VN--------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------VN--------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       PEIRIAQE--------LRRIGDEFNETYTRR---------V---------
G3H020_BCL2L11-02       PEIWIAQE--------LRRIGDEFNESYRRR---------AN--------
A0A2K5CA52_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K5CA52_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K5Q1U2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K6TRJ7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K6TRJ7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2K6QIJ1_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6QIJ1_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5NTQ5_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5HZ87_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5X1Y3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
F7HHA1_BCL2L11-01       PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6E1Z6_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6E1Z6_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K5Z7V3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6KJM8_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2K6KJM8_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2I2Y4B3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
O43521_BCL2L11-05       PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2I3GAA1_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2R9BZX9_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A2I3S5F6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------V---------
A0A1U7SU38_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------A---------
A0A2K6GE22_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------M---------
A0A2K5CA52_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A2K5Q1U2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A2K6TRJ7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A2K5CA52_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------I---------
A0A2K5Q1U2_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------I---------
A0A2R8M6L7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------I---------
A0A2K6TRJ7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------I---------
A0A2K5NTQ5_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K5HZ87_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K5X1Y3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K6E1Z6_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K5Z7V3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A096NYC3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K6KJM8_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K6QIJ1_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2I2Y4B3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------M---------
O43521_BCL2L11-11       PEIWIAQE--------LRRIGDEFNAYYARR---------M---------
O43521_BCL2L11-19       PEIWIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2R9BZX9_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2I3S5F6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------M---------
A0A2K5NTQ5_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2K5HZ87_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2K5X1Y3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2K6E1Z6_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2K5Z7V3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A096NYC3_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2K6KJM8_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2K6QIJ1_BCL2L11      PEIRIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2I2Y4B3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------L---------
O43521_BCL2L11-10       PEIWIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2I3GAA1_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2R9BZX9_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------L---------
A0A2I3S5F6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYARR---------L---------
A0A1U7SU38_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------M---------
A0A1U7SU38_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A4X1VMQ3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
C1KGB6_BCL2L11-01       PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A3Q2GRS5_BCL2L11      PEVWIAQE--------LRRIGDEFNASYPRR---------L---------
A0A673SRF7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A671FCV3_BCL2L11      PEIWIAQE--------LRRIGDEFNACYPRR---------F---------
A0A2Y9T3Y6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
U6CTE3_BCL2L11-02       PEMWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A4X1VMQ3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A2I2UX96_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A667H9R7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------L---------
A0A287DFJ0_BCL2L11      PEIWIAQE--------LRRIGDEFNLYYPRR---------V---------
A0A2K6GE22_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A5F9C9V3_BCL2L11      PETWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2D2G6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2G3J8_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
L8IVA4_BCL2L11-02       PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A3Q1MV27_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2D2G6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4W2G3J8_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A452FCR6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
W5PY58_BCL2L11-01       PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A286XJN2_BCL2L11      PEIWIAQE--------LRRIGDEFNASYPRR---------V---------
A0A286XJN2_BCL2L11      PEIWIAQE--------LRRIGDEFNASYPRR---------V---------
H0XW23_BCL2L11-01       PEMWIAQE--------LRRIGDEFNAYYPTR---------V---------
A0A671FCV3_BCL2L11      PEIWIAQE--------LRRIGDEFNACYPRR---------V---------
A0A2Y9Q753_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2Y9T3Y6_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
U6CTE3_BCL2L11-01       PEMWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A4X1VMQ3_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A673SRF7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A7N5JE15_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A2I2UX96_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
A0A667H9R7_BCL2L11      PEIWIAQE--------LRRIGDEFNAYYPRR---------V---------
U3IW89_BCL2L11-01       PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A3Q2U844_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A669QMB4_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A2K6E1Z6_BCL2L11      PEIRIAQE--------LRRIGDEFNA-YYAR-------------------
A0A5F8H037_BCL2L11      PEIWIAQE--------LRRIGDEFNASYYPR-------------------
A0A4X2L9J9_BCL2L11      PEIWIAQE--------LRRIGDEFNA-YYPR-------------------
A0A7N4NUH6_BCL2L11      PEIWIAQE--------LRRIGDEFNASY-PR-------------------
A0A7N4NUH6_BCL2L11      PEIWIAQE--------LRRIGDEFNASY-PR-------------------
G3SU55_BCL2L11-01       PEIWIARE--------LRRIGDEFNA-YYPR-------------------
A0A670KEZ9_BCL2L11      PEIWIARE--------LQRIGDEFNASYSPR-------------------
A0A670Y3D3_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A6I8NCK5_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A6I8NCK5_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A6I8NCK5_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A6I8NCK5_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A6I8NCK5_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR-------------------
A0A3Q3SYA1_BCL2L11      ---VMNHA--------LQRLAEAHG------------------GGAGAHR
A0A3G3M2M0_BCL2L11      PEISVARE--------LRRIGDEFNRLYCQG---------AGAGGNNRAQ
A0A672PQD1_BCL2L11      PEMAVARE--------LRRIGDEFNRLYCQG---------AGAGGNNGAQ
A0A673NIJ7_BCL2L11      PEMAVARE--------LRRIGDEFNRLYCQG---------AGAGGNNGAQ
B2KKY9_BCL2L11-01       PEMVVARE--------LRRIGDEFNRLYCE-------------AGAGVNQ
B8JK68_BCL2L11-01       PEMVVARE--------LRRIGDEFNRLYCE-------------AGAGVNQ
A0A671M057_BCL2L11      PEMAVARE--------LRRIGDEFNRLYCQG---------AGAGGNNGAQ
A0A672L1R2_BCL2L11      PEMAVARE--------LRRIGDEFNRLYCQG---------AGAGGNNAAQ
A0A671SJ75_BCL2L11      PEMAVARE--------LRRIGDEFNRLYCQG---------AGAGGNNAAQ
A0A673IWZ7_BCL2L11      PEMAVARE--------LRRIGDEFNRLYCQG---------AGAGGNNAAQ
A0A4W3IWD3_BCL2L11      KQCVKGVH--------LKSTPFNFPVLLKSL-------------------
A0A4W3IWD3_BCL2L11      SMTAFNIE--------LDPRGKGFVIV-----------------------
A0A4W3IWD3_BCL2L11      KQCVKGVH--------LKSTPFNFPVLLKSL-------------------
A0A3P8RLE2_BCL2L11      SVTVFCHL--------QSLFASTLQNVL----------------------
A0A673CKA1_BCL2L11      LSVSVEYT--------LGEYAEELVRVLLRT-------------------
A0A7M4F197_BCL2L11      PEIWIAQE--------LRRIGDEFNASYCPR--------------RGFWD
K7GA86_BCL2L11-01       PEIWIAQE--------LRRIGDEFNASYCPR--------------RGFLD
A0A4W4H3Y1_BCL2L11      PELYVAQE--------LRRIGDDFNRIYFRG---------VMACFLACTF
A0A3B4BSH7_BCL2L11      PESYVAQE--------LRRIGDEFNELYFHG---------V-SQLHGCVA
A0A3B4BSH7_BCL2L11      PESYVAQE--------LRRIGDEFNELYFHG-----------AGRNGGRV
A0A3B4BSH7_BCL2L11      PESYVAQE--------LRRIGDEFNELYFHG----------VSQLHGCVA
A0A3B1JXK6_BCL2L11      AHWYIAQE--------LRRIGDEFNDLYFRG----------AGR-NGGGA
A0A4W4H3Y1_BCL2L11      AELYVAQE--------LRRIGDDFNRIYFRG----------VER-NGGAA
A0A4W5NF23_BCL2L11      PEILIGQE--------LRRIGDEFNNLFIHR---------RLAGRNGQVA
A0A4W5R3N6_BCL2L11      PETLIGQE--------LQRIGDEFNHLFIHG---------HLPGRNAQVA
A0A1S3SAH9_BCL2L11      PETLIGQE--------LQRIGDEFNDLVMHR---------LVDG-NGQVA
A0A673WET2_BCL2L11      PETLIGQE--------LQRIGDEFNDLVIHR---------LAEG-NGQVA
A0A3P8XIA2_BCL2L11      PEILIGQE--------LQRIGDEFNNLFIHG---------RLGARNGQVA
A0A673XGV4_BCL2L11      PEILIGQE--------LQRIGDEFNNLIIHR---------RLAGRNGQVA
A0A4W5R3N6_BCL2L11      PETLIGQE--------LQRIGDEFNHLFIHG---------HLPGRNAQVA
A0A4W5R3N6_BCL2L11      PETLIGQE--------LQRIGDEFNHLFIHGVSRYTTPALSLVYTHKGLE
A0A669C520_BCL2L11      VSARTWRS--------VTNDSEKMNKNILRM-------------------
A0A3Q3ESW6_BCL2L11      AEA-IGRD--------LQRIGDDYNRLLLW--------RMAGRHGRPEVH
A0A3P9N073_BCL2L11      QPI-LSC----------------------------------------VLP
A0A3Q3B113_BCL2L11      AES-FGRH--------LRTIGDEYNRLLLLR-------RMAGRPRRNIVP
A0A3B5M375_BCL2L11      STT-WEQ-----------------------------------------IA
A0A3B5QAM1_BCL2L11      SET-YGRQ--------LRAIGDEYNNLLMGR-------RMARGHQRNIVP
A0A3B5QAM1_BCL2L11      SET-YGRQ--------LRAIGDEYNNLLMGR-------RMARGHQRNIVP
A0A4W6ETK4_BCL2L11      TEAVIGQE--------LRRIGDDFNRLLLLR-------------------
A0A4W6ETK4_BCL2L11      TEAVIGQE--------LRRIGDDFNRLLLLR-------GVAGGHRPVVIP
A0A4W6ETK4_BCL2L11      TEAVIGQE--------LRRIGDDFNRLLLLR-------GVAGGHRPVVIP
A0A3B4V919_BCL2L11      ---------------------GELKPALLKH-------------------
A0A3B4XZH1_BCL2L11      QAEAVGQE--------LRRIGDDFNRLLLLR-------------------
A0A3Q2SZH6_BCL2L11      PER-FGRQ--------LRAIGDEYNNHLM---------RMAGRQQRDMVP
A0A3B3VNE0_BCL2L11      SET-FGRQ--------LRAIGDDYNNHLMVR-------RMARRHQRNIVP
A0A3B3YII5_BCL2L11      SEN-FGRQ--------LRAIGDDYNNHLM---------RMARRHQRNIVP
A0A3B3YII5_BCL2L11      SEN-FGRQ--------LRAIGDDYNNHLM---------RMARRHQRNIVP
A0A3Q3K6I5_BCL2L11      AEA-VGRE--------LRRIGDDYNNHLL---------ELADRRRRV---
A0A3Q1ICY2_BCL2L11      AVE-VGRE--------LRRIGDDFNNHLL---------EVAGRHRWVGIQ
A0A671W556_BCL2L11      AEA-IGRE--------LRRIGDDFNRQLLLR-------GVAGGQRRIVIN
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      ------------------RVT------------------------RTFPS
A0A803SRF0_BCL2L11      ------------------RVKHFLKKIICCNPILKLCMQRKVHIRMVYHA
A0A663E983_BCL2L11      ------------------RVT-FIFSLS--------ISLRTVSKREKLNH
A0A663MLZ1_BCL2L11      ------------------RVT-FIFLLS--------ISLHMASKREKLNH
G1PDJ5_BCL2L11-01       ------------------RRD-FLNVYREAEGHPQMVVLRLL--RYILRL
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       HPLLPLLSHQLILFEFICFSPALESAASLVDLLVFPPCCSRG--------
A0A3Q1ELG4_BCL2L11      SFLFTVCFRFCNKRVK----------------------------------
A0A3Q1CI15_BCL2L11      STLQNVLIRFINPNYFSTFWNRC---------------------------
A0A3B3QC78_BCL2L11      ------LRPTAMGQGATLTPYPGDNKNKESPLRSRSSWLHVRMGEVEQQE
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      ------------------------MLFSLPPFSPHTLPPPYI--------
A0A287AEC6_BCL2L11      ------------------------FLNNYQAAEAHPQMVILRLLRYIARL
A0A287AEC6_BCL2L11      ------------------------EQ------------------------
A0A3Q2GRS5_BCL2L11      ------------------------VLNHHQAAEAHPQMIILRLLRYIIRL
A0A3Q2GRS5_BCL2L11      ------------------------VLNHHQAAEAHPQMIILRLLRYIIRL
A0A7M4F197_BCL2L11      ---------------------------GFWDNQGVNHQIILRLLHYIIRL
A0A672TST9_BCL2L11      -----------------------VTFTFVLSISLHPVSKREKLNH-----
A0A674H354_BCL2L11      -----------------------GFLDQQVGNPQVMILRLLRLLHSIIRL
A0A3Q7S5V2_BCL2L11      ------FLNNYQAAEA------------------HPQMIILRLLRYIVRL
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------VIVTMWKFTERV
A0A7N5JE15_BCL2L11      ------FLNNYQAAEA------------------HPQMIILRLLRYIVRL
A0A7N5JE15_BCL2L11      ------FLNNYQAAEA------------------HPQMIILRLLRYIVRL
A0A5F8H037_BCL2L11      AGD-------------------------------HHQMVILRLLRYIIRL
A0A5F9C9V3_BCL2L11      PKPGAWNLALSLPPGWQGPS------------------------------
A0A2R8M6L7_BCL2L11      --MILSLPPFLLTPP-------------------PPHCIFFKKRQSGLS-
A0A2Y9Q753_BCL2L11      --F---LNNHQAAEG-------------------HPQMVILRLLRHIVRL
M3YDI3_BCL2L11-01       --F---LNNYPAAEA-------------------HPQMIILRLLRYIIRL
F7HHA1_BCL2L11-02       --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A096NYC3_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K5X1Y3_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
F7HHA1_BCL2L11-03       --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A096NYC3_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K5X1Y3_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A674IAI8_BCL2L11      ---------------------------GFLDNPAVNHQIVLRLLRSIIRL
A0A7N4NUH6_BCL2L11      ERV---LSIDKYIKVL----------------------------------
A0A2K6GE22_BCL2L11      --K---CLVPSI--------------------------------------
A0A2R8M6L7_BCL2L11      --K---LLASST--------------------------------------
A0A2K5Q1U2_BCL2L11      --K---LLASST--------------------------------------
O43521_BCL2L11-20       --L---PPD-----------------------------------------
A0A2I2Y4B3_BCL2L11      --K---LLASST--------------------------------------
O43521_BCL2L11-07       --K---LLASST--------------------------------------
O43521_BCL2L11-22       --K---LLASST--------------------------------------
A0A2I3GAA1_BCL2L11      --K---LLASST--------------------------------------
A0A2R9BZX9_BCL2L11      --K---LLSST---------------------------------------
A0A2I3S5F6_BCL2L11      --K---LLASST--------------------------------------
A0A2K5NTQ5_BCL2L11      --E---LLASST--------------------------------------
A0A2K5X1Y3_BCL2L11      --E---LLASST--------------------------------------
A0A2K5Z7V3_BCL2L11      --E---LLASST--------------------------------------
A0A2K5HZ87_BCL2L11      --K---LLASST--------------------------------------
A0A2K6KJM8_BCL2L11      --K---LLASST--------------------------------------
A0A2K6QIJ1_BCL2L11      --K---LLASST--------------------------------------
C1KGB8_BCL2L11-01       PHT---LPPPYI--------------------------------------
A0A1U7SU38_BCL2L11      --K---NLASSS--------------------------------------
A0A673SRF7_BCL2L11      --G---VPASSIL-------------------------------------
A0A2I2UX96_BCL2L11      --R---VPASYI--------------------------------------
A0A667H9R7_BCL2L11      --R---VPASYI--------------------------------------
A0A7N5JE15_BCL2L11      --R---IPASYLC-------------------------------------
U6CTE3_BCL2L11-04       --R---IPASCLC-------------------------------------
A0A3Q2GRS5_BCL2L11      --Q---CLAFYT--------------------------------------
A0A287AEC6_BCL2L11      --E---CLASHT--------------------------------------
A0A4X1VMQ3_BCL2L11      --E---CLASHT--------------------------------------
A0A671FCV3_BCL2L11      --F---VLGSHTEVPGIEAEKKGARTAVLAGLYPRSRFHVLRVTLTFFRA
O54918_BCL2L11-06       ------FANDYREAED------------------HPQMVILQLLRFIFRL
O54918_BCL2L11-08       ------FANDYREAED------------------HPQMVILQLLRFIFRL
O54918_BCL2L11-05       ------FANDYREAED------------------HPQMVILQLLRFIFRL
C1KGB7_BCL2L11-01       --L---FSLPPFSPHT------------------LPPPYI----------
U6CTE3_BCL2L11-03       --Q-----------------------------------------------
A0A0D9RWE0_BCL2L11      --K-----------------------------------------------
O43521_BCL2L11-09       --K-----------------------------------------------
O43521_BCL2L11-14       --K-----------------------------------------------
A0A3Q1MV27_BCL2L11      ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
A0A2K6GE22_BCL2L11      ------FLNNYQADED------------------HPQMLILRLLRYIVRL
A0A1U7SU38_BCL2L11      ------YLNNNQAAED------------------HPQMVLLRLLRYIVRL
A0A286XJN2_BCL2L11      ------FLNHYQPAED------------------QPQMVILRLLRYIIRL
A0A2K5CA52_BCL2L11      ------FLNNYQAAED------------------HPHMVILRLLRYIVRL
A0A2K5Q1U2_BCL2L11      ------FLNNYQAAED------------------HPHMVILRLLRYIVRL
A0A2K6TRJ7_BCL2L11      ------FLNNYQAAED------------------HPHMVILRLLRYIVRL
A0A2K6QIJ1_BCL2L11      ------FLNNYQAAEE------------------HPQMVILRLLRYIVRL
A0A2K5NTQ5_BCL2L11      ------FLNNYQAAED------------------HPQMVILRLLRYIVRL
A0A2K5HZ87_BCL2L11      ------FLNNYQAAED------------------HPQMVILRLLRYIVRL
A0A2K6E1Z6_BCL2L11      ------FLNNYQAAED------------------HPQMVILRLLRYIVRL
A0A2K5Z7V3_BCL2L11      ------FLNNYQAAED------------------HPQMVILRLLRYIVRL
A0A2K6KJM8_BCL2L11      ------FLNNYQAAED------------------HPQMVILRLLRYIVRL
A0A2I2Y4B3_BCL2L11      ------FLNNYQAAED------------------HPRMVILRLLRYIVRL
O43521_BCL2L11-04       ------FLNNYQAAED------------------HPRMVILRLLRYIVRL
A0A2R9BZX9_BCL2L11      ------FLNNYQAAED------------------HPRMVILRLLRYIVRL
A0A2I3S5F6_BCL2L11      ------FLNNYQAAED------------------HPRMVILRLLRYIVRL
A0A2Y9T3Y6_BCL2L11      ------FLNNHQAAEG------------------HPQMVILRLLRHIIRL
A0A452SBG5_BCL2L11      ------FLNNYQAAEA------------------HPQMIILRLLRYIIRL
A0A4X1VMQ3_BCL2L11      ------FLNNYQAAEA------------------HPQMVILRLLRYIARL
A0A2I2UX96_BCL2L11      ------FLNNYQAAEA------------------QPQMIILRLLRYIVRL
A0A667H9R7_BCL2L11      ------FLNNYQAAEA------------------QPQMIILRLLRYIVRL
A0A3Q7S5V2_BCL2L11      ------FLNNYQAAEA------------------HPQMIILRLLRYIVRL
G3H020_BCL2L11-01       --N---YQED-EDHPH------------------HPQMVILQLLRFIVRL
A0A287DFJ0_BCL2L11      ------FFNN-YQPED------------------RPQMVILRLLRCIIRL
A0A4W2D2G6_BCL2L11      ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
A0A4W2G3J8_BCL2L11      ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
L8IVA4_BCL2L11-01       ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
A0A3Q1MV27_BCL2L11      ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
A0A4W2D2G6_BCL2L11      ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
A0A4W2G3J8_BCL2L11      ------FVRH-QAVEG------------------HPQMVLLRVLRYIVRL
A0A452FCR6_BCL2L11      ------FVRH-QAIEG------------------HPQMVLLRVLRYLVRL
A0A2K5Q1U2_BCL2L11      --L---HHKYFS--------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --L---HHKYFS--------------------------------------
A0A2K5Z7V3_BCL2L11      --L---NHKDFS--------------------------------------
A0A2K6TRJ7_BCL2L11      --L---HHKYVS--------------------------------------
A0A2K6KJM8_BCL2L11      --L---NHRDFS--------------------------------------
A0A2K6QIJ1_BCL2L11      --L---NHRDFS--------------------------------------
A0A2K5HZ87_BCL2L11      --L---NHRDFS--------------------------------------
A0A2R9BZX9_BCL2L11      --L---NHKDFS--------------------------------------
A0A2I3S5F6_BCL2L11      --L---NHKDFS--------------------------------------
A0A2K5NTQ5_BCL2L11      --L---NHKDFS--------------------------------------
A0A2K5X1Y3_BCL2L11      --L---NHKDFS--------------------------------------
A0A2K6E1Z6_BCL2L11      --L---NHKDFS--------------------------------------
A0A096NYC3_BCL2L11      --L---NHKDFS--------------------------------------
A0A2I2Y4B3_BCL2L11      --L---NHKDFS--------------------------------------
O43521_BCL2L11-02       --L---NHKDFS--------------------------------------
O43521_BCL2L11-15       --L---NHKDFS--------------------------------------
A0A2I3GAA1_BCL2L11      --F---NHKDFS--------------------------------------
A0A7N5JE15_BCL2L11      --L---VAAGAADSG-------------------LPRIAPETCGPWQRHG
A0A2R8M6L7_BCL2L11      --W---ILPFCHRKE-------------------VCLEAFPVLPSKASQS
A0A673SRF7_BCL2L11      --G---PSMFTEPKR-------------------VCASAKAAVTEYDRLQ
A0A2R8M6L7_BCL2L11      --W---ILPFCHRKE-------------------VCLEAFPVLPSKASQS
A0A2R8M6L7_BCL2L11      --W---ILPFCHRKE-------------------VCLEAFPVLPSKASQS
A0A7N5JE15_BCL2L11      --F---LNNYQAAEA-------------------HPQMIILRLLRYIVRL
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --F---ANDYREAED-------------------HPQMVILQLLRFIFRL
G3H020_BCL2L11-02       --N---YQEDEDHPH-------------------HPQMVILQLLRFIVRL
A0A2K5CA52_BCL2L11      --F---LNNYQAAED-------------------HPHMVILRLLRYIVRL
A0A2K5CA52_BCL2L11      --F---LNNYQAAED-------------------HPHMVILRLLRYIVRL
A0A2R8M6L7_BCL2L11      --F---LNNYQAAED-------------------HPHMVILRLLRYIVRL
A0A2K5Q1U2_BCL2L11      --F---LNNYQAAED-------------------HPHMVILRLLRYIVRL
A0A2K6TRJ7_BCL2L11      --F---LNNYQAAED-------------------HPHMVILRLLRYIVRL
A0A2K6TRJ7_BCL2L11      --F---LNNYQAAED-------------------HPHMVILRLLRYIVRL
A0A2K6QIJ1_BCL2L11      --F---LNNYQAAEE-------------------HPQMVILRLLRYIVRL
A0A2K6QIJ1_BCL2L11      --F---LNNYQAAEE-------------------HPQMVILRLLRYIVRL
A0A2K5NTQ5_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K5HZ87_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K5X1Y3_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
F7HHA1_BCL2L11-01       --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K6E1Z6_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K6E1Z6_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K5Z7V3_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K6KJM8_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2K6KJM8_BCL2L11      --F---LNNYQAAED-------------------HPQMVILRLLRYIVRL
A0A2I2Y4B3_BCL2L11      --F---LNNYQAAED-------------------HPRMVILRLLRYIVRL
O43521_BCL2L11-05       --F---LNNYQAAED-------------------HPRMVILRLLRYIVRL
A0A2I3GAA1_BCL2L11      --F---LNNYQAAED-------------------HPRMVILRLLRYIVRL
A0A2R9BZX9_BCL2L11      --F---LNNYQAAED-------------------HPRMVILRLLRYIVRL
A0A2I3S5F6_BCL2L11      --F---LNNYQAAED-------------------HPRMVILRLLRYIVRL
A0A1U7SU38_BCL2L11      --Y---LNNNQAAED-------------------HPQMVLLRLLRYIVRL
A0A2K6GE22_BCL2L11      --P---LPSD----------------------------------------
A0A2K5CA52_BCL2L11      --E---K-------------------------------------------
A0A2R8M6L7_BCL2L11      --E---K-------------------------------------------
A0A2K5Q1U2_BCL2L11      --E---K-------------------------------------------
A0A2K6TRJ7_BCL2L11      --E---K-------------------------------------------
A0A2K5CA52_BCL2L11      --S---LPSD----------------------------------------
A0A2K5Q1U2_BCL2L11      --S---LPSD----------------------------------------
A0A2R8M6L7_BCL2L11      --S---LLPD----------------------------------------
A0A2K6TRJ7_BCL2L11      --S---LPPD----------------------------------------
A0A2K5NTQ5_BCL2L11      --S---LPPD----------------------------------------
A0A2K5HZ87_BCL2L11      --S---LPPD----------------------------------------
A0A2K5X1Y3_BCL2L11      --S---LPPD----------------------------------------
A0A2K6E1Z6_BCL2L11      --S---LPPD----------------------------------------
A0A2K5Z7V3_BCL2L11      --S---LPPD----------------------------------------
A0A096NYC3_BCL2L11      --S---LPPD----------------------------------------
A0A2K6KJM8_BCL2L11      --S---LPPD----------------------------------------
A0A2K6QIJ1_BCL2L11      --S---LPPD----------------------------------------
A0A2I2Y4B3_BCL2L11      --P---LPPD----------------------------------------
O43521_BCL2L11-11       --P---LPPD----------------------------------------
O43521_BCL2L11-19       --P---LPPD----------------------------------------
A0A2R9BZX9_BCL2L11      --P---LPPD----------------------------------------
A0A2I3S5F6_BCL2L11      --P---LPPD----------------------------------------
A0A2K5NTQ5_BCL2L11      --E---K-------------------------------------------
A0A2K5HZ87_BCL2L11      --E---K-------------------------------------------
A0A2K5X1Y3_BCL2L11      --E---K-------------------------------------------
A0A2K6E1Z6_BCL2L11      --E---K-------------------------------------------
A0A2K5Z7V3_BCL2L11      --E---K-------------------------------------------
A0A096NYC3_BCL2L11      --E---K-------------------------------------------
A0A2K6KJM8_BCL2L11      --E---K-------------------------------------------
A0A2K6QIJ1_BCL2L11      --E---K-------------------------------------------
A0A2I2Y4B3_BCL2L11      --E---K-------------------------------------------
O43521_BCL2L11-10       --E---K-------------------------------------------
A0A2I3GAA1_BCL2L11      --E---K-------------------------------------------
A0A2R9BZX9_BCL2L11      --E---K-------------------------------------------
A0A2I3S5F6_BCL2L11      --E---K-------------------------------------------
A0A1U7SU38_BCL2L11      --P---FPPD----------------------------------------
A0A1U7SU38_BCL2L11      --E---K-------------------------------------------
A0A4X1VMQ3_BCL2L11      --M---LFSLPPFSP-------------------HTLPPPYI--------
C1KGB6_BCL2L11-01       --M---LFSLPPFSP-------------------HTLPPPYI--------
A0A3Q2GRS5_BCL2L11      --E---Q-------------------------------------------
A0A673SRF7_BCL2L11      --E---Q-------------------------------------------
A0A671FCV3_BCL2L11      --G---Q-------------------------------------------
A0A2Y9T3Y6_BCL2L11      --E---Q-------------------------------------------
A0A7N5JE15_BCL2L11      --E---Q-------------------------------------------
U6CTE3_BCL2L11-02       --E---Q-------------------------------------------
A0A4X1VMQ3_BCL2L11      --E---Q-------------------------------------------
A0A2I2UX96_BCL2L11      --E---Q-------------------------------------------
A0A667H9R7_BCL2L11      --E---Q-------------------------------------------
A0A287DFJ0_BCL2L11      --F---FNNYQP-ED-------------------RPQMVILRLLRCIIRL
A0A2K6GE22_BCL2L11      --F---LNNYQADED-------------------HPQMLILRLLRYIVRL
A0A5F9C9V3_BCL2L11      --F---LNNYPAAEE-------------------QPQMVILRLLRYIVRL
A0A4W2D2G6_BCL2L11      --F---V-RHQAVEG-------------------HPQMVLLRVLRYIVRL
A0A4W2G3J8_BCL2L11      --F---V-RHQAVEG-------------------HPQMVLLRVLRYIVRL
L8IVA4_BCL2L11-02       --F---V-RHQAVEG-------------------HPQMVLLRVLRYIVRL
A0A3Q1MV27_BCL2L11      --F---V-RHQAVEG-------------------HPQMVLLRVLRYIVRL
A0A4W2D2G6_BCL2L11      --F---V-RHQAVEG-------------------HPQMVLLRVLRYIVRL
A0A4W2G3J8_BCL2L11      --F---V-RHQAVEG-------------------HPQMVLLRVLRYIVRL
A0A452FCR6_BCL2L11      --F---V-RHQAIEG-------------------HPQMVLLRVLRYLVRL
W5PY58_BCL2L11-01       --F---V-RHQAIEG-------------------HPQMVLLRVLRYLVRL
A0A286XJN2_BCL2L11      --F---LNHYQPAED-------------------QPQMVILRLLRYIIRL
A0A286XJN2_BCL2L11      --F---LNHYQPAED-------------------QPQMVILRLLRYIIRL
H0XW23_BCL2L11-01       --F---LHNYQAAED-------------------HPQMVILRLLRYIVRL
A0A671FCV3_BCL2L11      --F---LNNYRAAGA-------------------HPRMAVIRLLRYILRL
A0A2Y9Q753_BCL2L11      --F---LNNHQAAEG-------------------HPQMVILRLLRHIVRL
A0A2Y9T3Y6_BCL2L11      --F---LNNHQAAEG-------------------HPQMVILRLLRHIIRL
U6CTE3_BCL2L11-01       --F---LNNYPAAEA-------------------HPQMIILRLLRYIIRL
A0A4X1VMQ3_BCL2L11      --F---LNNYQAAEA-------------------HPQMVILRLLRYIARL
A0A673SRF7_BCL2L11      --F---LNNYQAAEA-------------------HPQMIILRLLRYIVRL
A0A7N5JE15_BCL2L11      --F---LNNYQAAEA-------------------HPQMIILRLLRYIVRL
A0A2I2UX96_BCL2L11      --F---LNNYQAAEA-------------------QPQMIILRLLRYIVRL
A0A667H9R7_BCL2L11      --F---LNNYQAAEA-------------------QPQMIILRLLRYIVRL
U3IW89_BCL2L11-01       ------R------------------------------VIFLFLLSISLHL
A0A3Q2U844_BCL2L11      ------R-------------------GFLDNRAGNPQVVILRLLHYII--
A0A669QMB4_BCL2L11      ------R------------------------------VIFLFLLSISL--
A0A2K6E1Z6_BCL2L11      ------R---------------VFLNN-YQAAEDHPQMVILRLLRYIVRL
A0A5F8H037_BCL2L11      ------R---------------A---------------------------
A0A4X2L9J9_BCL2L11      ------R---------------GFLDN-NYQADH--QMVILRLLRYIIRL
A0A7N4NUH6_BCL2L11      ------R---------------AVWHG---------------FKSFGIGV
A0A7N4NUH6_BCL2L11      ------R---------------GFLDNNYQAADDHHQMVILRLLHYIIRL
G3SU55_BCL2L11-01       ------R---------------AFLNN-YQAAEDHPQMVILRLLRYIVRL
A0A670KEZ9_BCL2L11      ------R---------------GFL-D-YQAVNH--QIIILRLLHYIVRL
A0A670Y3D3_BCL2L11      ------R---------------GLL-D-YQGVNH--QIIILRLLHYIVRF
A0A6I8NCK5_BCL2L11      ------R-----------------F-A-VRPE-VRRGLPSTPERTEREKN
A0A6I8NCK5_BCL2L11      ------R---------------EML-D-VRPDLLGLGINSTLPGDTLPHP
A0A6I8NCK5_BCL2L11      ------RTGMTGGLVFMGRLLSDMF-A-VRPE-VRRGLPSTPERTEREKN
A0A6I8NCK5_BCL2L11      ------R---------------GLL-D-NKSGRKQPPNGFCAPVTLHPPP
A0A6I8NCK5_BCL2L11      ------R---------------GLL-D-NKSGRKQPPNGFCAPVTLHPPP
A0A3Q3SYA1_BCL2L11      QHG---------------------------EHKH---LRSRLFTAHAEYT
A0A3G3M2M0_BCL2L11      LHA---------------------------PNEHAIIMWMNDLIGRVVQF
A0A672PQD1_BCL2L11      LHA---------------------------PNEHAIIMWMNDLIGRVVQF
A0A673NIJ7_BCL2L11      LRA---------------------------PNEHAIIMWMNDFIGRVVQF
B2KKY9_BCL2L11-01       LRA---------------------------PNEHAIVLWMNVIIGRLVHF
B8JK68_BCL2L11-01       LHA---------------------------PNEHAIVLWMNDIIGRLVHF
A0A671M057_BCL2L11      LRA---------------------------PNEHAIIMWMNDLIGRVVQF
A0A672L1R2_BCL2L11      LRA---------------------------PNEHAIIMWMNDLIGRVVQF
A0A671SJ75_BCL2L11      LRA---------------------------PNEHAIIMWMNDLIGRVVQF
A0A673IWZ7_BCL2L11      LRA---------------------------PNEHAIIMWMNDLIGRVVQF
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      ---------------------------------------IRFINPNYFST
A0A673CKA1_BCL2L11      ----RRQHSEGNKL-----------------HS------CKL--------
A0A7M4F197_BCL2L11      NQGVNH-------------------------QI------ILRLLHYIIRL
K7GA86_BCL2L11-01       NQAINH-------------------------QI------VLRLLHYIIRL
A0A4W4H3Y1_BCL2L11      VVLWINLWINPDPL-----------------FP------LTQYLKL----
A0A3B4BSH7_BCL2L11      GMQALSARDLHDQM-----------------FA------LS---------
A0A3B4BSH7_BCL2L11      Q---LPAEEEPAFM-----------------LW------LGLVIRRLLEV
A0A3B4BSH7_BCL2L11      G---MQALSNPVAF-----------------SI------LGLFRGH----
A0A3B1JXK6_BCL2L11      Q---LPAQNEPAFI-----------------LW------MGLLIERLRQF
A0A4W4H3Y1_BCL2L11      Q---QPAQNEPALL-----------------QW------IGLLIGRLLQL
A0A4W5NF23_BCL2L11      QGNLQQMHQEPAFL-----------------LW------MGLLIGRLLQI
A0A4W5R3N6_BCL2L11      QANLQQMHQEPAFL-----------------LW------MGLLIGRLLQI
A0A1S3SAH9_BCL2L11      QENLQQMHQEPAFL-----------------LW------MGLLIGRLLQI
A0A673WET2_BCL2L11      QENLQQMHQEPAFL-----------------LW------MGLLIGRLLQI
A0A3P8XIA2_BCL2L11      QANLPQMHQEPAFL-----------------LW------MGLLIGRLLQI
A0A673XGV4_BCL2L11      QGNLQHMHQEPAFL-----------------LW------MSLLIGRLLQI
A0A4W5R3N6_BCL2L11      QANLQQMHQEPAFL-----------------LW------MGLLIGRLLQI
A0A4W5R3N6_BCL2L11      EPQISKDDDNAPYI-----------------QK------MHHF-GRVSI-
A0A669C520_BCL2L11      -------------------------------FCYLVSYLRCVCFHPFLTV
A0A3Q3ESW6_BCL2L11      PNPQPHIQPEPTML-----------------LC------TGLMILLIGWI
A0A3P9N073_BCL2L11      VQLMIQQFSHATSIGIKKRKRVGYDDDYYHYYI------DCFFLKSVSKY
A0A3Q3B113_BCL2L11      LNLLPHIHQEPVAM-----------------LC------VSLLLLLIGRL
A0A3B5M375_BCL2L11      VNIGPVLFIRPIPM-----------------L-------VPIYHASTLRI
A0A3B5QAM1_BCL2L11      LNLMPHIQQEPVAM-----------------LC------VCLLLLLVGRI
A0A3B5QAM1_BCL2L11      LNLMPHIQQEPVAM-----------------LC------VCLLLLLVGRI
A0A4W6ETK4_BCL2L11      ---VSHHRHCVCVC-----------------VC------VCVCVCVCGR-
A0A4W6ETK4_BCL2L11      QQQLPHIHQEPTVL-----------------LC------VGILLLVIGRI
A0A4W6ETK4_BCL2L11      QQQLPHIHQEPTVL-----------------LC------VGILLLVIGRI
A0A3B4V919_BCL2L11      ---TKMTSQCCQTH-----------------FC-----------------
A0A3B4XZH1_BCL2L11      ---VSHHRWCVCVC-----------------VCVCACGCVCACGCVCGCV
A0A3Q2SZH6_BCL2L11      LNLMPHIQQEPVAM-----------------LC------VGLLLLLIGRI
A0A3B3VNE0_BCL2L11      LNLMPHIQQEPVAM-----------------LC------VCLLLLLVGRI
A0A3B3YII5_BCL2L11      LNLMPHIQQEPVAM-----------------LC------VCLLLLLVGRI
A0A3B3YII5_BCL2L11      LNLMPHIQQEPVAM-----------------LC------VCLLLLLVGRI
A0A3Q3K6I5_BCL2L11      ---VPRIHQELTIV-----------------LC------VGILVLVIGQI
A0A3Q1ICY2_BCL2L11      PIRLPHIHQDPTVL-----------------LC------VGLLLFVIGRI
A0A671W556_BCL2L11      PNQLPHIHQEPAML-----------------LC------VGLLLLLIGRI
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
A0A803VLS8_BCL2L11      ALPTPLRGKG----------------------------------------
A0A803SRF0_BCL2L11      FIKLSPR-------------------------------------------
A0A663E983_BCL2L11      LWKLVLW-------------------------------------------
A0A663MLZ1_BCL2L11      LWKLVLR-------------------------------------------
G1PDJ5_BCL2L11-01       VWRRM---------------------------------------------
A0A663E970_BCL2L11      --------------------------------------------------
A0A803WCD8_BCL2L11      --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3B3QC78_BCL2L11      IV------------------------------------------------
A0A667ZMY7_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      VWRMQ---------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      VRRLQ---------------------------------------------
A0A3Q2GRS5_BCL2L11      VRRLQ---------------------------------------------
A0A7M4F197_BCL2L11      IWRRQ---------------------------------------------
A0A672TST9_BCL2L11      LWKLPLR-------------------------------------------
A0A674H354_BCL2L11      IWRLH---------------------------------------------
A0A3Q7S5V2_BCL2L11      VWRLQ---------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
A0A7N4NUH6_BCL2L11      LSIDKYIKVL----------------------------------------
A0A7N5JE15_BCL2L11      VWRLQ---------------------------------------------
A0A7N5JE15_BCL2L11      VWRLQ---------------------------------------------
A0A5F8H037_BCL2L11      VWRMQ---------------------------------------------
A0A5F9C9V3_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2Y9Q753_BCL2L11      VWRMQ---------------------------------------------
M3YDI3_BCL2L11-01       VWRLQ---------------------------------------------
F7HHA1_BCL2L11-02       VWRMH---------------------------------------------
A0A096NYC3_BCL2L11      VWRMH---------------------------------------------
A0A2K5X1Y3_BCL2L11      VWRMH---------------------------------------------
F7HHA1_BCL2L11-03       VWRMH---------------------------------------------
A0A096NYC3_BCL2L11      VWRMH---------------------------------------------
A0A2K5X1Y3_BCL2L11      VWRMH---------------------------------------------
A0A674IAI8_BCL2L11      IWRLQ---------------------------------------------
A0A7N4NUH6_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-04       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      A-------------------------------------------------
O54918_BCL2L11-06       VWRRH---------------------------------------------
O54918_BCL2L11-08       VWRRH---------------------------------------------
O54918_BCL2L11-05       VWRRH---------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
U6CTE3_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-14       --------------------------------------------------
A0A3Q1MV27_BCL2L11      VWRMQ---------------------------------------------
A0A2K6GE22_BCL2L11      VWRRH---------------------------------------------
A0A1U7SU38_BCL2L11      VWRMY---------------------------------------------
A0A286XJN2_BCL2L11      VWRMH---------------------------------------------
A0A2K5CA52_BCL2L11      VWRMH---------------------------------------------
A0A2K5Q1U2_BCL2L11      VWRMH---------------------------------------------
A0A2K6TRJ7_BCL2L11      VWRMH---------------------------------------------
A0A2K6QIJ1_BCL2L11      VWRMH---------------------------------------------
A0A2K5NTQ5_BCL2L11      VWRMH---------------------------------------------
A0A2K5HZ87_BCL2L11      VWRMH---------------------------------------------
A0A2K6E1Z6_BCL2L11      VWRMH---------------------------------------------
A0A2K5Z7V3_BCL2L11      VWRMH---------------------------------------------
A0A2K6KJM8_BCL2L11      VWRMH---------------------------------------------
A0A2I2Y4B3_BCL2L11      VWRMH---------------------------------------------
O43521_BCL2L11-04       VWRMH---------------------------------------------
A0A2R9BZX9_BCL2L11      VWRMH---------------------------------------------
A0A2I3S5F6_BCL2L11      VWRMH---------------------------------------------
A0A2Y9T3Y6_BCL2L11      VWRMQ---------------------------------------------
A0A452SBG5_BCL2L11      VWRLQ---------------------------------------------
A0A4X1VMQ3_BCL2L11      VWRMQ---------------------------------------------
A0A2I2UX96_BCL2L11      VWRLQ---------------------------------------------
A0A667H9R7_BCL2L11      VWRLQ---------------------------------------------
A0A3Q7S5V2_BCL2L11      VWRLQ---------------------------------------------
G3H020_BCL2L11-01       VWRRH---------------------------------------------
A0A287DFJ0_BCL2L11      VWRMH---------------------------------------------
A0A4W2D2G6_BCL2L11      VWRMQ---------------------------------------------
A0A4W2G3J8_BCL2L11      VWRMQ---------------------------------------------
L8IVA4_BCL2L11-01       VWRMQ---------------------------------------------
A0A3Q1MV27_BCL2L11      VWRMQ---------------------------------------------
A0A4W2D2G6_BCL2L11      VWRMQ---------------------------------------------
A0A4W2G3J8_BCL2L11      VWRMQ---------------------------------------------
A0A452FCR6_BCL2L11      VWRMQ---------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      IKCTSPGRNVLKDSAQSGTFCLSKLCCSCKMFNPHLFPPVSLRWHWHSRL
A0A2R8M6L7_BCL2L11      AYWTTIRDRSINTCCAKAQRIISEIENVQDI-------------------
A0A673SRF7_BCL2L11      GRECINDRTAFIQSWRPEAWELGLAAPVCCARSF----------------
A0A2R8M6L7_BCL2L11      AYWTTIRDRSINTCCAKAQRIISALSFRTMPPLMPTSRWPVHLTVCGSLQ
A0A2R8M6L7_BCL2L11      AYWTTIRDRSINTCCAKAQRIISEI----------------------ENV
A0A7N5JE15_BCL2L11      VWRLQ---------------------------------------------
O43521_BCL2L11-01       --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       VWRRH---------------------------------------------
G3H020_BCL2L11-02       VWRRH---------------------------------------------
A0A2K5CA52_BCL2L11      VWRMH---------------------------------------------
A0A2K5CA52_BCL2L11      VWRMH---------------------------------------------
A0A2R8M6L7_BCL2L11      VWRMH---------------------------------------------
A0A2K5Q1U2_BCL2L11      VWRMH---------------------------------------------
A0A2K6TRJ7_BCL2L11      VWRMH---------------------------------------------
A0A2K6TRJ7_BCL2L11      VWRMH---------------------------------------------
A0A2K6QIJ1_BCL2L11      VWRMH---------------------------------------------
A0A2K6QIJ1_BCL2L11      VWRMH---------------------------------------------
A0A2K5NTQ5_BCL2L11      VWRMH---------------------------------------------
A0A2K5HZ87_BCL2L11      VWRMH---------------------------------------------
A0A2K5X1Y3_BCL2L11      VWRMH---------------------------------------------
F7HHA1_BCL2L11-01       VWRMH---------------------------------------------
A0A2K6E1Z6_BCL2L11      VWRMH---------------------------------------------
A0A2K6E1Z6_BCL2L11      VWRMH---------------------------------------------
A0A2K5Z7V3_BCL2L11      VWRMH---------------------------------------------
A0A2K6KJM8_BCL2L11      VWRMH---------------------------------------------
A0A2K6KJM8_BCL2L11      VWRMH---------------------------------------------
A0A2I2Y4B3_BCL2L11      VWRMH---------------------------------------------
O43521_BCL2L11-05       VWRMH---------------------------------------------
A0A2I3GAA1_BCL2L11      VWRMH---------------------------------------------
A0A2R9BZX9_BCL2L11      VWRMH---------------------------------------------
A0A2I3S5F6_BCL2L11      VWRMH---------------------------------------------
A0A1U7SU38_BCL2L11      VWRMY---------------------------------------------
A0A2K6GE22_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5CA52_BCL2L11      --------------------------------------------------
A0A2K5Q1U2_BCL2L11      --------------------------------------------------
A0A2R8M6L7_BCL2L11      --------------------------------------------------
A0A2K6TRJ7_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5HZ87_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K5Z7V3_BCL2L11      --------------------------------------------------
A0A096NYC3_BCL2L11      --------------------------------------------------
A0A2K6KJM8_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2I2Y4B3_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2R9BZX9_BCL2L11      --------------------------------------------------
A0A2I3S5F6_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A3Q2GRS5_BCL2L11      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A7N5JE15_BCL2L11      --------------------------------------------------
U6CTE3_BCL2L11-02       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A2I2UX96_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      VWRMH---------------------------------------------
A0A2K6GE22_BCL2L11      VWRRH---------------------------------------------
A0A5F9C9V3_BCL2L11      VWRMH---------------------------------------------
A0A4W2D2G6_BCL2L11      VWRMQ---------------------------------------------
A0A4W2G3J8_BCL2L11      VWRMQ---------------------------------------------
L8IVA4_BCL2L11-02       VWRMQ---------------------------------------------
A0A3Q1MV27_BCL2L11      VWRMQ---------------------------------------------
A0A4W2D2G6_BCL2L11      VWRMQ---------------------------------------------
A0A4W2G3J8_BCL2L11      VWRMQ---------------------------------------------
A0A452FCR6_BCL2L11      VWRMQ---------------------------------------------
W5PY58_BCL2L11-01       VWRMQ---------------------------------------------
A0A286XJN2_BCL2L11      VWRMH---------------------------------------------
A0A286XJN2_BCL2L11      VWRMH---------------------------------------------
H0XW23_BCL2L11-01       VWRLH---------------------------------------------
A0A671FCV3_BCL2L11      LWRMQ---------------------------------------------
A0A2Y9Q753_BCL2L11      VWRMQ---------------------------------------------
A0A2Y9T3Y6_BCL2L11      VWRMQ---------------------------------------------
U6CTE3_BCL2L11-01       VWRLQ---------------------------------------------
A0A4X1VMQ3_BCL2L11      VWRMQ---------------------------------------------
A0A673SRF7_BCL2L11      VWRLQR--------------------------------------------
A0A7N5JE15_BCL2L11      VWRLQR--------------------------------------------
A0A2I2UX96_BCL2L11      VWRLQ---------------------------------------------
A0A667H9R7_BCL2L11      VWRLQ---------------------------------------------
U3IW89_BCL2L11-01       VPRLPPPFPRPGSVAGGVCLVGAVQLGIKVTFFTLFSF------------
A0A3Q2U844_BCL2L11      --------R----------LIWRMQ-------------------------
A0A669QMB4_BCL2L11      --------PTKAPPVSGLAVNW----------------------------
A0A2K6E1Z6_BCL2L11      VWRMH---------------------------------------------
A0A5F8H037_BCL2L11      VWHCFKSFGIGVGSQL----------------------------------
A0A4X2L9J9_BCL2L11      VWRMQ---------------------------------------------
A0A7N4NUH6_BCL2L11      GSQL----------------------------------------------
A0A7N4NUH6_BCL2L11      VWRMQ---------------------------------------------
G3SU55_BCL2L11-01       VWR-----------------------------------------------
A0A670KEZ9_BCL2L11      IWRMQ---------------------------------------------
A0A670Y3D3_BCL2L11      IWRMQ---------------------------------------------
A0A6I8NCK5_BCL2L11      FFGT----------------------------------------------
A0A6I8NCK5_BCL2L11      GPDM----------------------------------------------
A0A6I8NCK5_BCL2L11      FFGT----------------------------------------------
A0A6I8NCK5_BCL2L11      RWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTVPHG-----
A0A6I8NCK5_BCL2L11      RWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTVPHG-----
A0A3Q3SYA1_BCL2L11      QVKQP---------------------------------------------
A0A3G3M2M0_BCL2L11      FLRRR---------------------------------------------
A0A672PQD1_BCL2L11      FLRRR---------------------------------------------
A0A673NIJ7_BCL2L11      FLRRR---------------------------------------------
B2KKY9_BCL2L11-01       FLRRR---------------------------------------------
B8JK68_BCL2L11-01       FLRRR---------------------------------------------
A0A671M057_BCL2L11      FLRRR---------------------------------------------
A0A672L1R2_BCL2L11      FLRRR---------------------------------------------
A0A671SJ75_BCL2L11      FLRRR---------------------------------------------
A0A673IWZ7_BCL2L11      FLRRR---------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A4W3IWD3_BCL2L11      --------------------------------------------------
A0A3P8RLE2_BCL2L11      FWKRC---------------------------------------------
A0A673CKA1_BCL2L11      --------------------------------------------------
A0A7M4F197_BCL2L11      IWRRQ---------------------------------------------
K7GA86_BCL2L11-01       IWRMQ---------------------------------------------
A0A4W4H3Y1_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B4BSH7_BCL2L11      LLRRR---------------------------------------------
A0A3B4BSH7_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      LHRRR---------------------------------------------
A0A4W4H3Y1_BCL2L11      LLRRR---------------------------------------------
A0A4W5NF23_BCL2L11      ILRRR---------------------------------------------
A0A4W5R3N6_BCL2L11      ILQRR---------------------------------------------
A0A1S3SAH9_BCL2L11      ILQRR---------------------------------------------
A0A673WET2_BCL2L11      ILQRR---------------------------------------------
A0A3P8XIA2_BCL2L11      IWRRR---------------------------------------------
A0A673XGV4_BCL2L11      ILRRR---------------------------------------------
A0A4W5R3N6_BCL2L11      ILQRR---------------------------------------------
A0A4W5R3N6_BCL2L11      --------------------------------------------------
A0A669C520_BCL2L11      ELSHEREPFFHYSDVLCLLFSHE---------------------------
A0A3Q3ESW6_BCL2L11      IYLRGNTNSHDHSQV-----------------------------------
A0A3P9N073_BCL2L11      DVA-----------------------------------------------
A0A3Q3B113_BCL2L11      MYLQGCTNSQNNSQV-----------------------------------
A0A3B5M375_BCL2L11      SALE----------------------------------------------
A0A3B5QAM1_BCL2L11      MYMQGNTSSHDHSQV-----------------------------------
A0A3B5QAM1_BCL2L11      MYMQGNTSSHDHSQV-----------------------------------
A0A4W6ETK4_BCL2L11      ----GG--------------------------------------------
A0A4W6ETK4_BCL2L11      IYLQGGMNNQDHAQV-----------------------------------
A0A4W6ETK4_BCL2L11      IYLQGGMNNQDHAQV-----------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      RVCGGGGGVE----------------------------------------
A0A3Q2SZH6_BCL2L11      MYLQGSTNSHDHSQV-----------------------------------
A0A3B3VNE0_BCL2L11      MYMQGNTSSHDHSQV-----------------------------------
A0A3B3YII5_BCL2L11      MYMQGNTSSHDHSQV-----------------------------------
A0A3B3YII5_BCL2L11      MYMQGNTSSHDHSQV-----------------------------------
A0A3Q3K6I5_BCL2L11      I-LQGSINSQDNSQV-----------------------------------
A0A3Q1ICY2_BCL2L11      IYSQGSTNSEGHSHV-----------------------------------
A0A671W556_BCL2L11      IYLQGSTDSQDHSQV-----------------------------------
                                                                          

Q6JTU4_BCL2L11-01       -----
A0A803VLS8_BCL2L11      -----
A0A803SRF0_BCL2L11      -----
A0A663E983_BCL2L11      -----
A0A663MLZ1_BCL2L11      -----
G1PDJ5_BCL2L11-01       -----
A0A663E970_BCL2L11      -----
A0A803WCD8_BCL2L11      -----
M3XHJ5_BCL2L11-01       -----
G1MV54_BCL2L11-01       -----
A0A3Q1ELG4_BCL2L11      -----
A0A3Q1CI15_BCL2L11      -----
A0A3B3QC78_BCL2L11      -----
A0A667ZMY7_BCL2L11      -----
A0A287AEC6_BCL2L11      -----
A0A287AEC6_BCL2L11      -----
A0A287AEC6_BCL2L11      -----
A0A3Q2GRS5_BCL2L11      -----
A0A3Q2GRS5_BCL2L11      -----
A0A7M4F197_BCL2L11      -----
A0A672TST9_BCL2L11      -----
A0A674H354_BCL2L11      -----
A0A3Q7S5V2_BCL2L11      -----
O43521_BCL2L11-13       -----
O43521_BCL2L11-16       -----
A0A7N4NUH6_BCL2L11      -----
A0A7N5JE15_BCL2L11      -----
A0A7N5JE15_BCL2L11      -----
A0A5F8H037_BCL2L11      -----
A0A5F9C9V3_BCL2L11      -----
A0A2R8M6L7_BCL2L11      -----
A0A2Y9Q753_BCL2L11      -----
M3YDI3_BCL2L11-01       -----
F7HHA1_BCL2L11-02       -----
A0A096NYC3_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
F7HHA1_BCL2L11-03       -----
A0A096NYC3_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
A0A674IAI8_BCL2L11      -----
A0A7N4NUH6_BCL2L11      -----
A0A2K6GE22_BCL2L11      -----
A0A2R8M6L7_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
O43521_BCL2L11-20       -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-07       -----
O43521_BCL2L11-22       -----
A0A2I3GAA1_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
C1KGB8_BCL2L11-01       -----
A0A1U7SU38_BCL2L11      -----
A0A673SRF7_BCL2L11      -----
A0A2I2UX96_BCL2L11      -----
A0A667H9R7_BCL2L11      -----
A0A7N5JE15_BCL2L11      -----
U6CTE3_BCL2L11-04       -----
A0A3Q2GRS5_BCL2L11      -----
A0A287AEC6_BCL2L11      -----
A0A4X1VMQ3_BCL2L11      -----
A0A671FCV3_BCL2L11      -----
O54918_BCL2L11-06       -----
O54918_BCL2L11-08       -----
O54918_BCL2L11-05       -----
C1KGB7_BCL2L11-01       -----
U6CTE3_BCL2L11-03       -----
A0A0D9RWE0_BCL2L11      -----
O43521_BCL2L11-09       -----
O43521_BCL2L11-14       -----
A0A3Q1MV27_BCL2L11      -----
A0A2K6GE22_BCL2L11      -----
A0A1U7SU38_BCL2L11      -----
A0A286XJN2_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-04       -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2Y9T3Y6_BCL2L11      -----
A0A452SBG5_BCL2L11      -----
A0A4X1VMQ3_BCL2L11      -----
A0A2I2UX96_BCL2L11      -----
A0A667H9R7_BCL2L11      -----
A0A3Q7S5V2_BCL2L11      -----
G3H020_BCL2L11-01       -----
A0A287DFJ0_BCL2L11      -----
A0A4W2D2G6_BCL2L11      -----
A0A4W2G3J8_BCL2L11      -----
L8IVA4_BCL2L11-01       -----
A0A3Q1MV27_BCL2L11      -----
A0A4W2D2G6_BCL2L11      -----
A0A4W2G3J8_BCL2L11      -----
A0A452FCR6_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2I3GAA1_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
O43521_BCL2L11-23       -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-03       -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
A0A096NYC3_BCL2L11      -----
O54918_BCL2L11-03       -----
A0A452U4S4_BCL2L11      -----
A0A3Q2GRS5_BCL2L11      -----
O43521_BCL2L11-17       -----
A0A2K5CA52_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
A0A2K6E1Z6_BCL2L11      -----
A0A096NYC3_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-02       -----
O43521_BCL2L11-15       -----
A0A2I3GAA1_BCL2L11      -----
A0A7N5JE15_BCL2L11      LPNLG
A0A2R8M6L7_BCL2L11      -----
A0A673SRF7_BCL2L11      -----
A0A2R8M6L7_BCL2L11      HRI--
A0A2R8M6L7_BCL2L11      QDI--
A0A7N5JE15_BCL2L11      -----
O43521_BCL2L11-01       -----
A0A2K5CA52_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-08       -----
O43521_BCL2L11-21       -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2I3GAA1_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-12       -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2I3GAA1_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-06       -----
O43521_BCL2L11-18       -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2I3GAA1_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A667H9R7_BCL2L11      -----
A0A671FCV3_BCL2L11      -----
A0A1U7SU38_BCL2L11      -----
A0A1U7SU38_BCL2L11      -----
A0A2K6GE22_BCL2L11      -----
A0A2K6GE22_BCL2L11      -----
O54918_BCL2L11-01       -----
G3H020_BCL2L11-02       -----
A0A2K5CA52_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2R8M6L7_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
F7HHA1_BCL2L11-01       -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-05       -----
A0A2I3GAA1_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A1U7SU38_BCL2L11      -----
A0A2K6GE22_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2R8M6L7_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K5CA52_BCL2L11      -----
A0A2K5Q1U2_BCL2L11      -----
A0A2R8M6L7_BCL2L11      -----
A0A2K6TRJ7_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A096NYC3_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-11       -----
O43521_BCL2L11-19       -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A2K5NTQ5_BCL2L11      -----
A0A2K5HZ87_BCL2L11      -----
A0A2K5X1Y3_BCL2L11      -----
A0A2K6E1Z6_BCL2L11      -----
A0A2K5Z7V3_BCL2L11      -----
A0A096NYC3_BCL2L11      -----
A0A2K6KJM8_BCL2L11      -----
A0A2K6QIJ1_BCL2L11      -----
A0A2I2Y4B3_BCL2L11      -----
O43521_BCL2L11-10       -----
A0A2I3GAA1_BCL2L11      -----
A0A2R9BZX9_BCL2L11      -----
A0A2I3S5F6_BCL2L11      -----
A0A1U7SU38_BCL2L11      -----
A0A1U7SU38_BCL2L11      -----
A0A4X1VMQ3_BCL2L11      -----
C1KGB6_BCL2L11-01       -----
A0A3Q2GRS5_BCL2L11      -----
A0A673SRF7_BCL2L11      -----
A0A671FCV3_BCL2L11      -----
A0A2Y9T3Y6_BCL2L11      -----
A0A7N5JE15_BCL2L11      -----
U6CTE3_BCL2L11-02       -----
A0A4X1VMQ3_BCL2L11      -----
A0A2I2UX96_BCL2L11      -----
A0A667H9R7_BCL2L11      -----
A0A287DFJ0_BCL2L11      -----
A0A2K6GE22_BCL2L11      -----
A0A5F9C9V3_BCL2L11      -----
A0A4W2D2G6_BCL2L11      -----
A0A4W2G3J8_BCL2L11      -----
L8IVA4_BCL2L11-02       -----
A0A3Q1MV27_BCL2L11      -----
A0A4W2D2G6_BCL2L11      -----
A0A4W2G3J8_BCL2L11      -----
A0A452FCR6_BCL2L11      -----
W5PY58_BCL2L11-01       -----
A0A286XJN2_BCL2L11      -----
A0A286XJN2_BCL2L11      -----
H0XW23_BCL2L11-01       -----
A0A671FCV3_BCL2L11      -----
A0A2Y9Q753_BCL2L11      -----
A0A2Y9T3Y6_BCL2L11      -----
U6CTE3_BCL2L11-01       -----
A0A4X1VMQ3_BCL2L11      -----
A0A673SRF7_BCL2L11      -----
A0A7N5JE15_BCL2L11      -----
A0A2I2UX96_BCL2L11      -----
A0A667H9R7_BCL2L11      -----
U3IW89_BCL2L11-01       -----
A0A3Q2U844_BCL2L11      -----
A0A669QMB4_BCL2L11      -----
A0A2K6E1Z6_BCL2L11      -----
A0A5F8H037_BCL2L11      -----
A0A4X2L9J9_BCL2L11      -----
A0A7N4NUH6_BCL2L11      -----
A0A7N4NUH6_BCL2L11      -----
G3SU55_BCL2L11-01       -----
A0A670KEZ9_BCL2L11      -----
A0A670Y3D3_BCL2L11      -----
A0A6I8NCK5_BCL2L11      -----
A0A6I8NCK5_BCL2L11      -----
A0A6I8NCK5_BCL2L11      -----
A0A6I8NCK5_BCL2L11      -----
A0A6I8NCK5_BCL2L11      -----
A0A3Q3SYA1_BCL2L11      -----
A0A3G3M2M0_BCL2L11      -----
A0A672PQD1_BCL2L11      -----
A0A673NIJ7_BCL2L11      -----
B2KKY9_BCL2L11-01       -----
B8JK68_BCL2L11-01       -----
A0A671M057_BCL2L11      -----
A0A672L1R2_BCL2L11      -----
A0A671SJ75_BCL2L11      -----
A0A673IWZ7_BCL2L11      -----
A0A4W3IWD3_BCL2L11      -----
A0A4W3IWD3_BCL2L11      -----
A0A4W3IWD3_BCL2L11      -----
A0A3P8RLE2_BCL2L11      -----
A0A673CKA1_BCL2L11      -----
A0A7M4F197_BCL2L11      -----
K7GA86_BCL2L11-01       -----
A0A4W4H3Y1_BCL2L11      -----
A0A3B4BSH7_BCL2L11      -----
A0A3B4BSH7_BCL2L11      -----
A0A3B4BSH7_BCL2L11      -----
A0A3B1JXK6_BCL2L11      -----
A0A4W4H3Y1_BCL2L11      -----
A0A4W5NF23_BCL2L11      -----
A0A4W5R3N6_BCL2L11      -----
A0A1S3SAH9_BCL2L11      -----
A0A673WET2_BCL2L11      -----
A0A3P8XIA2_BCL2L11      -----
A0A673XGV4_BCL2L11      -----
A0A4W5R3N6_BCL2L11      -----
A0A4W5R3N6_BCL2L11      -----
A0A669C520_BCL2L11      -----
A0A3Q3ESW6_BCL2L11      -----
A0A3P9N073_BCL2L11      -----
A0A3Q3B113_BCL2L11      -----
A0A3B5M375_BCL2L11      -----
A0A3B5QAM1_BCL2L11      -----
A0A3B5QAM1_BCL2L11      -----
A0A4W6ETK4_BCL2L11      -----
A0A4W6ETK4_BCL2L11      -----
A0A4W6ETK4_BCL2L11      -----
A0A3B4V919_BCL2L11      -----
A0A3B4XZH1_BCL2L11      -----
A0A3Q2SZH6_BCL2L11      -----
A0A3B3VNE0_BCL2L11      -----
A0A3B3YII5_BCL2L11      -----
A0A3B3YII5_BCL2L11      -----
A0A3Q3K6I5_BCL2L11      -----
A0A3Q1ICY2_BCL2L11      -----
A0A671W556_BCL2L11      -----
                             

© 1998-2022Legal notice