Dataset for protein Bad of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
                                                    c p  s mgipkkpspasthapgarksg
                                                            ltgeraragpaptlavqntk
                                                             v tqkqsstcegq lglr 
                                                                p ll f  eh  aa  
                                                                n  i            
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------mFq-ipefepseqeds--------ssaerglgpspagd----p-sgsgkhhltap
setptrrsggpaggrrwrsdatmaak-tissdsdsepsdevrtgplplqeegdndqsaagt--rhl -qp-p-rqtrql-
kkdsgikrvrgsarggrwppvwaqsnmsh-d--pqdspggd        gpeklkkhsgtqeqggg eh-d-q----s-s
appgigekr nr stllayrs tdh- - tqggvt-tm--a        -gsgdsh-lt--arq   qalvlsprsq-vr
rgld  dal dd  s gmwap   tq n me t--gae s-        n--s-qelkqlsrks   gyqefkgnrtatn
  g           q p r r   fr k  - csh -- nm        ddt-sl-p--vk gp   hmvshdslnmlgg
                  h        d    n g iy  i        ttrrq-dampep ek   aghlcpfkwhp  
                  g               d  r  l        paknhnstwnrg st   vegpraagqyn  
                                                 k dygppneeae pw   rtaknv cpse  
                                                 f  qta   dsl nl   lrrcyh  acd  
                                                     m    kdf  e    peagn  l    
                                                     i         d        i       
                                                     e                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gll-dash-------qqeq-psssshhg--grga-----------ypaareed--eagtpee----gspfrgrsrsAppa
e-rgetgs       grgrlnte-hast vsa-evetreesrhsselqgtgdelldgmeetdphml-aatdseakh-e-n
-rpwtsat       -sipv-a-r---- i--d-yspswmrednen-sekmlate-vsagmpgggdlgselrqgq-t-a-
vi-r--ta       v-v-sa-gnqvys yatawmyspngegegr-f--nlql  gstgavs  e adla a---l   s
dakksepn       r lgqy ttttca lvgtst id  ailrdaddva--s  ktcl--l    vp   p  s    i
tfqnlp-l       p te s nlns e sqkrq   a   s atpsmm-at-  q-lvdd-    pl   v  n     
stnmgrqg       s q  r h ir   qe et          ndeessdip   pe-rg     rf   t  l     
nselpgv-       n -  m   ln    y wr          gfrpdpvan   m-sl       y            
pm  virq       e r      k                      vtgr g   iv t                    
 k  hqkr         h      g                      tlmq     e                       
    rnik         p      e                       rew     d                       
    nl i         w                               w                              
    m            n                               l                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          *  :                                                                  
lwaakkygrqLrrmsdefdssl-kg-lprpksagtatqm------------------------------rqspswwrylq
----qr-nqe ealgl-wvdlfdatemrkvrgrratkgw                              hhkkaptsfif
fck -- -vk kp pvt rggvke-qak--s-t-rnrki                              gr-st-favfr
    rh  -   t     qp-- l vp-tg-v-vshlp-                              v-nrg qgaaw
    l   c   k     -twp v d- altnp ---el                              stetf lnlck
    m   s         e-r  q  s vtial gvs-y                              qd -- k-i--
                  hvh       naqig ksg                                -y cw -ktv 
                  ant           d  lq                                lv a   t-  
                   ma                                                wa y   es  
                   i                                                 t  h       
                   c                                                            
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
shqerngg---sapsq----------------------------------------------------------------
awwdtelergsnnhhenhthrtepfrcvlrcssditvshvtagfqlpftrnslfqgwwfdlpvqdqrrqqlq        
-pkpsds-qhg-----sggrtnidllgm                                                    
g-r--t-rkdpvsaasvsaqpqd    w                                                    
 r-gp-ap s ymsldkpslear                                                         
 llsagq  r pllple rsgp                                                          
 yp l v    agqth  nta                                                           
  f m      dt qg  ip                                                            
  h e          a                                                                
                                                                                
                                                                                
                                                                                
                                                                                

    
....
    
----
    
    
    
    
    
    
    
    
    
    
    
    
© 1998-2020Legal notice