Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

209 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      ---------------------------------------MGTPENPLSAP
A0A673J9C6_BAD-01      --------------MKTYRSVGPMQLVSVLSISRRIR------------S
A0A4W5JLL9_BAD-02      -------------------MLSPSP-------------PLPFPTYPLSLS
A0A674DKC6_BAD-01      SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLP-LPLSLS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2J8TYJ3_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-03      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      THVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR-----------
A0A673J9C6_BAD-01      CSAAVSALAIFHNLATTVYAHDALLRTQRPPERERKRER-------GKIL
A0A4W5JLL9_BAD-02      ASPPVS----------------------------------------FPLS
A0A674DKC6_BAD-01      ASPSSSPLLCLSPSSLSCLSLSSLSSPLSPPSPLSLSLPLLLPSPLSPLS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2J8TYJ3_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-03      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTV--------------PVAQATRAGLPQY
A0A673J9C6_BAD-01      ELLLPCSVSCTVCELEVNCSCAATPHNTGACQDSSRNPNRA---------
A0A4W5JLL9_BAD-02      TSLFPSLSTSPLSLCPLSFISLY--------------PLSPHLFPLSL--
A0A674DKC6_BAD-01      SLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2J8TYJ3_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-03      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      WREAAGPG------------------------------------------
A0A673J9C6_BAD-01      -SESKHPD-----------TQITRKTVRRTP-------------------
A0A4W5JLL9_BAD-02      -HPSSPPS-----------HSFLVSPLSLTP-------------------
A0A674DKC6_BAD-01      PSPLSPPSPLSLPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      -----------------------------------------------MSP
A0A4W6EMZ7_BAD-02      ------------------------------------------------MY
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      ------------------------------------------------MK
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2J8TYJ3_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-03      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      ------------MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDT
A0A4W4DXF5_BAD-01      ------------MHNQYLLRLRKANFTRED--YKKVIKAKTLREEG--ET
Q6P7C5_BAD-01          ---------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGS
C1C3S9_BAD-01          --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      ----------------------------------MFYSFCHSPCDECFLT
A0A3B4DUY7_BAD-01      -----------------------MSNQYLQKLRRARFNCEEERYKKVIKT
A0A337SAW2_BAD-01      --------------------------------------------------
A0A673J9C6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      --------------------------------------------------
A0A674DKC6_BAD-01      LSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLTAFLFPL
A0A4W4HE29_BAD-01      -------------MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSY
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      ----------------------------------MSTAARAAAGTCDSTA
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      SSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLP-------------
A0A4W6EMZ7_BAD-02      RNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQF
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      CNNKCYHFIRL-----VFVKKQSVICAGYGTVNTFGPAYSRDSTENKISC
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      -------------------------------------------------M
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      ------------------------------------------------MN
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESE
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          ------------------GPPENPSPASTHAQGVRMSGAEHPEKK-----
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-02          -----------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGG
Q61337_BAD-01          -----------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGG
A0A287CT05_BAD-01      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
A0A287CT05_BAD-02      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
G5B6Q3_BAD-01          -----------------MRTPENPSPAPTNAEGLRKLELGIRRLES----
G5B6Q3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2J8TYJ3_BAD-02      ---------------------------------------MGTPENPSPAP
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-03      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      -------------------------MGSSGGKKLWLARPSPSTEEPLPLP
A0A287AEF3_BAD-01      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A4X1VE31_BAD-03      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      ---------------------------MGTPENPSAAPTTRKLSIRRRRR
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2J8TYJ3_BAD-01      ---------------------------------------MGTPENPSPAP
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      ------------------------------------------MAIINTII
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      LFRPLCWNSSGSTVFTM---EKTPPHSKEDD------ISPIDDHDESRWS
A0A4W4DXF5_BAD-01      PSNTSCWNPFRVTAFTM---EKA-PCGQRDD------ISALDDQDESRWS
Q6P7C5_BAD-01          DAGGRRWRPAAQSMFQI--PEF-EPSEQEDA--------STTDRGLGPSL
C1C3S9_BAD-01          -----MGDSPHKSMFSI--EEFPPTERGSAF--------SG---TNPPGF
A0A452IFQ4_BAD-01      -------------MFRI--QEFP----DEVF--------PGRGKEAPAPP
A0A674I2R9_BAD-01      -------------MFRI--QEFP----DEVF--------PGRGKESPLPP
A0A3P8YI30_BAD-01      ICNAFGQCLLRMDVFSLQAFKM---DHTQDCVGDIPENINEKYDLDHLGT
A0A3B4DUY7_BAD-01      LTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQDESNWS-ETVKN
A0A337SAW2_BAD-01      --QGPRDRAWAQSMFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A673J9C6_BAD-01      --TDSRNRLIMAQMFSI--SDN-ESD-TETS--------EDCEDSDLTKN
A0A4W5JLL9_BAD-02      LPPSSSVDVSMAQMFTI--SDS-ESEPSEEV--------GETEKDQLAAG
A0A674DKC6_BAD-01      LTSSSSVDVSMAQMFTI--SDS-ESEPSEEV--------GETEKDQSSAG
A0A4W4HE29_BAD-01      REFTSAAGQLSEVVFTM--AQMFTISDTESD--------TSEGPGDTDQQ
A0A3B4CPH6_BAD-01      ----------MAHMFTL--SDDSDTSEDLGD---------------ADQP
A0A3Q3FKT9_BAD-01      -MTLTASDVTMAAKFTISDSESGSEEEVKEE-------------ENDQSS
A0A3B1IH05_BAD-01      VSQPSKLDFTMDHMFTI--SDESDASEELGD---------------SDQP
A0A674AVP9_BAD-01      ------------------------MDHTHDC---------------VDEC
A0A1S3L0Z2_BAD-01      ------------------------MDYTHDC---------------VDEC
B5XEF1_BAD-01          ------------------------MDYTHDC---------------VDEC
A0A4W5MZR2_BAD-01      ------------------------MDHTHDC---------------VDEC
A0A060W8W7_BAD-01      ------------------------MDHIHDC---------------VDEC
E7FBJ6_BAD-01          -------------------MENTSHDHQDDS---------------STLD
A0A673J5Q9_BAD-01      -------------------MDNTLHDHQDDS---------------STWN
A0A671PX91_BAD-01      -------------------MDNTLHDHQDDS---------------STWN
A0A672LB88_BAD-01      -------------------MDNTLHDHQDDS---------------STWN
A0A673I6H5_BAD-01      -------------------MDKRLHGHQYDS---------------STLN
A0A671SBB4_BAD-01      -------------------MDKRLHDHQNDS---------------STLN
A0A672R7P6_BAD-01      -------------------MDKRLHDHRNDS---------------STLN
A0A3P8Y761_BAD-02      -MGCSTPYRNGISTSTILPHTTGTGDRLLPY--------GLFCLITIGTR
A0A3Q2QC80_BAD-01      -------DDTMAAKFTI-SDSDSEPPEEVEE--------EGNDQPADGK-
A0A4W6EMZ7_BAD-02      LLNLPSPDVTMAANFTI-SDSESEASEEVEE--------GEMNQSSTEQ-
A0A3Q3FKT9_BAD-02      ----------MAAKFTI-SDSESGSEEEVKE--------EENDQSSAVE-
A0A3Q3FKT9_BAD-03      LGVL---DVTMAAKFTI-SDSESGSEEEVKE--------EENDQSSAVE-
A0A3B5L9R9_BAD-01      ----------MDTKFTI-SDGESDPSEDVEE--------RGDLQLMQEK-
A0A667ZNC6_BAD-01      -----------MASFTI-SDGESDPSEEVGE--------SETDKSLNHQ-
A0A3P9B2E4_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A668V3Q4_BAD-01      ----------MAANFTI-SDSESETSEEVGE--------EENQQPAGQD-
I3K7B6_BAD-01          ----------MAANFTI-SDSESETSEEVGE--------EENQQPAGQD-
A0A3Q3C680_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------EENQQSAGQA-
A0A3P8QRJ7_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A3Q4GGN3_BAD-01      ----------MAANFKI-SDSDSETSEEVGE--------GENQQSARQV-
A0A3B4GXJ6_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A3Q2D5S0_BAD-01      AQSVETSDPIMAATFTI-SDSDTEPSEEVEE--------TRNKEPRIRN-
A0A3Q0QNQ2_BAD-01      ----------FIHFLPF-IQGRGQQPSHLLQ--------LIWGTPRHSQ-
A0A3P8WI83_BAD-02      VEVSIFPDVTMAAQFTI-SDSESEPEEEVEG--------GKIKHSLNDP-
A0A3P8WI83_BAD-01      ----------MAAQFTI-SDSESEPEEEVEG--------GKIKHSLNDP-
A0A3P9HNZ2_BAD-01      ----------MAAKFTI-SD-DSESSEEVEG--------GKLDLGAAGG-
A0A3B3BQF7_BAD-01      ----------MAAKFSI-SDNDSESSEEVEG--------GRLDLAASGGE
A0A672JQ68_BAD-01      ----------MAAKFSI-SDSESEPSEEVEE--------EETNE--TPA-
A0A2U9BAC9_BAD-01      ----------MAANFTI-SDSESEPSEEVEE--------GEVSQPWTGP-
A0A4W6EMZ7_BAD-01      ----------MAANFTI-SDSESEASEEVEE--------GEMNQSSTEQ-
A0A3B4VFC5_BAD-01      ----------MAANFTI-SDSESEPSEEVDE--------GEMSQSLTGQ-
A0A3B4W9T1_BAD-01      ----------MAANFTI-SDSESEPSEEVDE--------GEMSQSLTGQ-
A0A3Q1K1C7_BAD-01      ----------MAARFTI-SDSDSDPSEGMEE--------EGHNQSPPGQ-
A0A672YF93_BAD-01      ----------MAAKFTI-SDSESEPSEDLEE--------EQRRQPPTEQ-
A0A3Q1GWH9_BAD-01      ----------MAAKFSI-SDGDSEPEE--VE--------GENNHSPATE-
A0A3Q1CPU7_BAD-01      ----------MAAKFTI-SDSESEPSEEVEE--------GENNHSPATQ-
A0A3P8TWH6_BAD-01      ----------MAAKFTI-SDSESEPSEEVEE--------GENNHSPATQ-
H3D8J8_BAD-01          ----------MAAKFSLCSDSDSEPSEEVEE--------GERGSFSTS--
A0A6F9CQZ0_BAD-02      -------------MFTI-SDCKSEPSE-VGE--------TEKDKSAAGQ-
A0A6F9CA11_BAD-02      ----------MAQMFTI-SDSESEPSEDVGE--------TETDQSAAGK-
A0A1S3N9Q3_BAD-01      ----------MAQIFTI-SDSE---SEEVGE--------TENDQSSAGK-
A0A5F8GA49_BAD-01      TPSWPDDASRPVSMFQI--PEF-EPGEQEDG----------------SER
H3ANP3_BAD-03          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-01          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-02          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-04          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
G3VRY3_BAD-03          -------------MFQI--SEF-EPSE--------------------PGE
G3VRY3_BAD-02          -------------MFQI--SEF-EPSE--------------------PGE
G3VRY3_BAD-01          -------------MFQI--SEF-EPSE--------------------PGE
A0A4X2KAA5_BAD-01      -----------MSMFQI--SEF-EPSEQETP--------KEDGFAYAPGE
A0A672V9F8_BAD-01      ----------------M--GGPCEVVGCSPP--------VP------PSA
A0A674GQ16_BAD-01      -------------MLRL--DETPEDRGSPPP--------SPWGGSPSPSQ
A0A6I8NVP2_BAD-01      -------------MFQI--PEF-EPSERGDV--------CTP--GGDPSQ
G3TP47_BAD-01          -KGRRRSSGGLQSMFQI--PEF-EQSDREDS--------TPADRGLGPSP
Q61337_BAD-05          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-06          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-03          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-04          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-02          RRWRPA----AQSMFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-01          RRWRPA----AQSMFQI--PEF-EPSEQEDA--------SATDRGLGPSL
A0A287CT05_BAD-01      GRRRGWHPAWTQSMFQI--PEF-EPSEQEDS--------SSAEGGLGPSP
A0A287CT05_BAD-02      GRRRGWHPAWTQSMFQI--PEF-EPSEQEDS--------SSAEGGLGPSP
G5B6Q3_BAD-01          ----------AQSMFQI--PEF-EPSEQEDS--------SSEERALGPTP
G5B6Q3_BAD-02          -------------MFQI--PEF-EPSEQEDS--------SSEERALGPTP
G1P8C5_BAD-01          --------PTAQSMFQI--PEF-EHSEQEDS--------SPADRGLGPCP
A0A452ER54_BAD-02      ------YRAWAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
W5P8G9_BAD-01          --QGPRYRAWAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
Q61337_BAD-07          --------------XQI--PEF-EPSEQEDA--------SATDRGLGPSL
H0WVR2_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSSDRGLGPSP
A0A2K6GWV0_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAGRGLGPSP
F7DN67_BAD-01          -------------MFQI--PEF-EQSEPEDS--------SPADRGLGPSP
Q45KI9_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPANRGLGPSP
A0A3Q7SWS0_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPANRGLGPSP
B4DZQ9_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2J8TYJ3_BAD-02      THAQDVRQRGSQSMFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-02          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I3TBK7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2J8TYJ3_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
H0V608_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSEERGLGPSP
A0A2K5PDB1_BAD-01      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
U3F2S3_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5E6A6_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K6TG62_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5M0A7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A1D5QBW1_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6E7I4_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5XJR2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K6N196_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6PUL3_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5HKU7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A0D9R491_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5VCA1_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A4X1VE31_BAD-02      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-01      STGNRGPSLRAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A287AEF3_BAD-01      GRGRSRSGPASQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-03      GRGRSRQGYLSQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A671ELU4_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A452ER54_BAD-01      ESGGRQWAGPRGSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A452RJM6_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A384DJL2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
M3YNE7_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A667H8Z9_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A673V6P8_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A4W2C9A8_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4W2C9A8_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
F1MUT9_BAD-01          -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
Q3SYZ0_BAD-01          -------------MFQI--PEF-EQSEQEDS--------SRADRGLGPSP
A0A4U1FMC3_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A2Y9EHU3_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A2I3TBK7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-03          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5XJR2_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K6E7I4_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5PDB1_BAD-02      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
A0A2K5E6A6_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K6TG62_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5HKU7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6N196_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6PUL3_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2J8TYJ3_BAD-01      THAQDVRQRGSQSMFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5XJR2_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K6E7I4_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-04      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-04          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I3TBK7_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5E6A6_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5PDB1_BAD-03      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
A0A2K6TG62_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------MAFKMDHTQ--DCVGDIPENINE--------KYDLDHLGTTH
A0A4W5R1T6_BAD-01      HCGCPFSLQIFTMNHTH--DCVDDNPETMNE--------KDESDHSGTTH
A0A060W8P9_BAD-01      ------------MNHTH--DCVDDNPETMNE--------QDESDHSGTTH
B5X1T1_BAD-01          ------------MDHTH--DCVDDNPETMNE--------HDESDHSGTTH
A0A673ZHY7_BAD-01      ------------MDHTH--DCVDDNPETMNE--------QDESDHSGTTH
A0A671NP27_BAD-01      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A672SAE4_BAD-01      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A672SAE4_BAD-02      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A671RUV0_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQAKNNS
A0A673HRQ3_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQVKNNS
A0A672RGH0_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQVKNNS
Q4V925_BAD-02          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
Q4V925_BAD-03          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
A7MCM4_BAD-01          ----------MAHMFNI--SD-DSETETMED--------SEASSLDKHKS
Q4V925_BAD-01          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
Q4V925_BAD-04          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
A0A3B3QX41_BAD-01      -----MSGVTMAHMFTI--SG-NESDTSESD--------TPDVTANSQLG
A0A3Q3RXS8_BAD-01      ----------MAAKFS---IS-ESESDSSEE--------VEGGKQKKSSA
A0A3Q0QNQ2_BAD-02      -------------------MP-EPPRLVLFD--------VEEGQSPFREG
A0A3Q3WTY4_BAD-01      ----------MATNFTI--SS-DSESELSEE--------IEEGENSQLQT
A0A3P8Y761_BAD-01      ----------MENIFTI---S-DTESESSDV----------EETKKEWIA
A0A4W5JLL9_BAD-01      ----------MAQMFTI---S-DSESEPSEE--------VGETEKDQLAA
A0A3B5Q2N7_BAD-01      ----------MDTKFTI---S-DGESDPSED--------VEERGDLQLMQ
A0A087X8P8_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3UA11_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3YFR1_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3P9Q7C3_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3HDU2_BAD-01      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3P9KSL7_BAD-02      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3P9KSL7_BAD-01      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3B5BAL2_BAD-01      ----------MAAQFSI---S-GSESDP-EE--------VEEGENNHPPA
A0A665TUH3_BAD-01      ----------MSAQFTI---S-DSESDPSEE--------VEEGDMSQSL-
A0A674MXC1_BAD-04      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-01      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-02      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-03      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A671TL42_BAD-01      ----------MAANFTI--SS-ESDSEPSEE--------VEEGEHSQSPA
A0A3Q3AEL8_BAD-01      ----------MAAKFTI---S-DSESEPSDE--------VEEGKSKQPAA
A0A3Q3AEL8_BAD-02      ----------MAAKFTI---S-DSESEPSDE--------VEEGKSKQPAA
A0A1A8AQV0_BAD-01      ----------MAAHFTI---S-DSDSEPSEE--------VEEGEKKQPSA
G3Q8B3_BAD-01          ----------MAAHFTI---S-DSESEPSDG--------VEEREDGQLSS
A0A3Q2Y0E4_BAD-01      ----------MAANFSI---S-DSESEPSEE--------VEEGDDGQGAA
A0A3Q3R5S3_BAD-01      ----------MAANFTI---S-DSESESSEE--------VEEGKHSQSST
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------LEF------NNIRKD---------
A0A670YRG7_BAD-01      --------------------------LELRRRIGSDQLDSE---------
A0A3B1JLM2_BAD-01      EAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVR-LYSESQ---------
A0A4W4DXF5_BAD-01      ETIESDDSPRISNHHIMPNNTAT----EVGGRVR-LYSESQ---------
Q6P7C5_BAD-01          TEDQP-------GPYLAPGLLGSIVQQQ-------PGQAAN---------
C1C3S9_BAD-01          GGDPGHKSSPNLRRIKGKETR---------QRTE----------------
A0A452IFQ4_BAD-01      ESQRGHTPGSKQPDTPTAEVR---------SRIG----------------
A0A674I2R9_BAD-01      ESQRGHTPGSKQPDTPTAEVR---------SRIG----------------
A0A3P8YI30_BAD-01      THYPEFQFCNTSTNTSNRTLP------G--VRVR-LYSESQ---------
A0A3B4DUY7_BAD-01      GDSPQLDSQHSMASNISPASPDELSEVG--CRVR-LYSESQ---------
A0A337SAW2_BAD-01      TGDRP--RGPGKHQRTTPG--LL---GE--AGHQ-QGQPAS---------
A0A673J9C6_BAD-01      NS-GS--QQKTNHDLAVPD-RLK---GEQLGRHR--NLSMN---------
A0A4W5JLL9_BAD-02      KG-MT--GGPIGHALTVPEMRLA---GE--GRLR-MNSESQ---------
A0A674DKC6_BAD-01      KG-MT--GGPIGHTLTVPEMRLA---GE--GRLR-MNSESQ---------
A0A4W4HE29_BAD-01      GDSKEAEPSQSEQHLHVPNTLRGEWTAR--QRNHSMNEAEL---------
A0A3B4CPH6_BAD-01      EASKRAELSQSGQHPLVPERFRE---SR--QRNHSMNEDAL---------
A0A3Q3FKT9_BAD-01      AVEEP--HVPQRHSLTLPELRLA---GT--GRIR-LNSESH---------
A0A3B1IH05_BAD-01      EVSKTAEPSRSGQHITVPEKLRVE--PR--QRNFSMNEEAL---------
A0A674AVP9_BAD-01      ESDHSGTTHNSEFQLHVSTTMSNRPRPG--ERVR-LYSESQ---------
A0A1S3L0Z2_BAD-01      ESDHSGTTRNSEFQLHVSTTMSNRPRPG--ERVR-LYSESQ---------
B5XEF1_BAD-01          ESDHSGTTRNSEFQLHVSTTMSNRPRPG--ERVR-LYSESQ---------
A0A4W5MZR2_BAD-01      ESDHSGTTHNSEFQLHVSTTMSTRPRPG--ERVR-LYSESQ---------
A0A060W8W7_BAD-01      ESDHSGTTHNSEFQLHVSTTMSNRPRPG--ERVR-LYSESQ---------
E7FBJ6_BAD-01          EKERSHLKGTIKNHGQHQDRTSANISPQ--GRVR-LYSESQ---------
A0A673J5Q9_BAD-01      DKKKGR-EETIKNQGQHQDQTLPNISPQ--GRVR-LYSESQ---------
A0A671PX91_BAD-01      DKKKGR-EETIKNQGQHQDQTLPNISPQ--GRVR-LYSESQ---------
A0A672LB88_BAD-01      DKKKGR-EETIKNQGQHQDQTLPNISPQ--GRVR-LYSESQ---------
A0A673I6H5_BAD-01      DKKKGR-EETINTHGQHQDQTSPNISPQ--GRVR-LYSESQ---------
A0A671SBB4_BAD-01      DKKKGR-EETINTHGQHQDQTLPNISPQ--GRVR-FYSESQ---------
A0A672R7P6_BAD-01      DRKKGR-EETINTRGQHQDQTLPNISPQ--GRVR-LYSESQ---------
A0A3P8Y761_BAD-02      DGTGAYGLFWLRNTHIHPLILCSFFIGE--GRIR-LNSESQ---------
A0A3Q2QC80_BAD-01      -----VEPLRQRHALTLPELR-S---GH--GRIR-LNSESH---------
A0A4W6EMZ7_BAD-02      -----EQQIPQRNTVTLPELRLP---VP--GRIR-LNSESH---------
A0A3Q3FKT9_BAD-02      -----EPHVPQRHSLTLPELRLA---GT--GRIR-LNSESH---------
A0A3Q3FKT9_BAD-03      -----EPHVPQRHSLTLPELRLA---GT--GRIR-LNSESH---------
A0A3B5L9R9_BAD-01      -----EKPLSQRHTLTLPELRST---K-----------------------
A0A667ZNC6_BAD-01      -----EQNHHLGHALTTPELRMS---AS--GRVR-LNSESH---------
A0A3P9B2E4_BAD-01      -------QESKPQTLSLPVTKTT---AA--GRLR-VNSESH---------
A0A668V3Q4_BAD-01      -------QESKPQTLALPVIKTT---GA--GRLR-LNSESH---------
I3K7B6_BAD-01          -------QESKPQTLALPVIKTT---GA--GRLR-LNSESH---------
A0A3Q3C680_BAD-01      -------QESKPQTLSLPVIKTT---AA--GRLR-VNSESH---------
A0A3P8QRJ7_BAD-01      -------QESKPQTLSLPVTKTT---AA--GRLR-VNSESH---------
A0A3Q4GGN3_BAD-01      -------QESKPQTLSLPVIKTT---AA--GRLR-VNSESH---------
A0A3B4GXJ6_BAD-01      -------QESKPQTLSLPVIKTT---AA--GRLR-VNSESH---------
A0A3Q2D5S0_BAD-01      --------------------SGK---TH--RRIR-LSSESH---------
A0A3Q0QNQ2_BAD-01      ---------AIGHDQNTSPMRHP---TA--RRIR-MNSESH---------
A0A3P8WI83_BAD-02      -----EQVVPHRHNLTLPELRVA---GS--RRIR-LNSESH---------
A0A3P8WI83_BAD-01      -----EQVVPHRHNLTLPELRVA---GS--RRIR-LNSESH---------
A0A3P9HNZ2_BAD-01      GGGGEGEHLHDRHSLTLPELRLT---SN--GRTR-LNSEST---------
A0A3B3BQF7_BAD-01      GGGGGGGHLHDRHALTLPELRLT---SN--GRTR-LNSEST---------
A0A672JQ68_BAD-01      -----DQRVRRRLDLSLNEFNLT---AT--GRIR-LNSESI---------
A0A2U9BAC9_BAD-01      -----GEQVPPRHTLALPELRMA---AT--GRIR-LNSESN---------
A0A4W6EMZ7_BAD-01      -----EQQIPQRNTVTLPELRLP---VP--GRIR-LNSESH---------
A0A3B4VFC5_BAD-01      -----EQELSQRHTLTLPELRGA---AT--GRTR-LNSESH---------
A0A3B4W9T1_BAD-01      -----EQELSQRHTLTLPELRGA---AT--GRTR-LNSESH---------
A0A3Q1K1C7_BAD-01      -----EQQVFPRHTLTLPELR-----AS--GRIR-LNSESH---------
A0A672YF93_BAD-01      -----EQQISYSHSLTLPELRMA---GA--GRLR-LNSESQ---------
A0A3Q1GWH9_BAD-01      -----AMPVFARRNMALPELRTP---AS--GRIR-LNSESH---------
A0A3Q1CPU7_BAD-01      -----AMPVFARRNMALPELRTP---AS--GRLR-LNSESH---------
A0A3P8TWH6_BAD-01      -----AMPVFARRNMALPELRTP---AS--GRLR-LNSESH---------
H3D8J8_BAD-01          ------------------------------GRIR-VNSESQ---------
A0A6F9CQZ0_BAD-02      ----GMTGGPLGHTLTVPEMRLA---GE--GRLR-LNSESQ---------
A0A6F9CA11_BAD-02      ----GMTGGPLGHALT----------------------------------
A0A1S3N9Q3_BAD-01      ----GMTGGPIGHALTVPEMRLA---GE--GRLR-MNSESQ---------
A0A5F8GA49_BAD-01      APGQP--GGPGRRSSAAPGAQRHE--GA--GDRR-PRLISY---------
H3ANP3_BAD-03          S-EKT--AGLKKHSRTAPNLQNPG--PH--QSHP-PSHTGV---------
H3ANP3_BAD-01          S-EKT--AGLKKHSRTAPNLQNPG--PH--QSHP-PSH------------
H3ANP3_BAD-02          S-EKT--AGLKKHSRTAPNLQNPG--PH--QSHP-PSH------------
H3ANP3_BAD-04          S-EKT--AGLKKHSRTAPNLQNPG--PH--QSHP-PSHTVF---------
G3VRY3_BAD-03          DPS------ASTAPSLAPLRPGPR--AA-------PGAHHH---------
G3VRY3_BAD-02          DPS------ASTAPSLAPLRPGPR--AA-------PGAHHH---------
G3VRY3_BAD-01          DPS------ASTAPSLAPLRPGPR--AA-------PGAHHH---------
A0A4X2KAA5_BAD-01      SRGLG--KHSATAPSLAPVRPGPR--PA-------PGAHHH---------
A0A672V9F8_BAD-01      AMSPA--PPAGGVPPPAPPRQVRP--AP-------P--PPS---------
A0A674GQ16_BAD-01      PGTPS--PGQRLPPTQNPPPGGTP--KP-------PGGTPK---------
A0A6I8NVP2_BAD-01      APAGP--GGLGRHTHTSPDL---A--SH--LPGRRPPPAAHLSEAPPFSW
G3TP47_BAD-01          EGYWP--SGPSDRHRVAPGFLRDS--SH--QQGQ-PTSSGH---------
Q61337_BAD-05          TEDQP---GPY----LAPGLLGSN--IH--QQGR-AATNSH---------
Q61337_BAD-06          TEDQP---GPY----LAPGLLGSN--IH--QQGR-AATNSH---------
Q61337_BAD-03          TEDQP---GPY----LAPGLLGSN--IH--QQGR-AATNSH---------
Q61337_BAD-04          TEDQP---GPY----LAPGLLGSN--IH--QQGR-AATNSH---------
Q61337_BAD-02          TEDQP---GPY----LAPGLLGSN--IH--QQGR-AATNSH---------
Q61337_BAD-01          TEDQP---GPY----LAPGLLGSN--IH--QQGR-AATNSH---------
A0A287CT05_BAD-01      AGDRP---GCG----LAPGLPRDT--GH--QQWQ-ATSSSN---------
A0A287CT05_BAD-02      AGDRP---GCG----LAPGLPRDT--GH--QQWQ-ATSSSN---------
G5B6Q3_BAD-01          TGDRL---GPS----SPGGFLGDI--SH--QQRQ-LISSRH---------
G5B6Q3_BAD-02          TGDRL---GPS----SPGGFLGDI--SH--QQRQ-LISSRH---------
G1P8C5_BAD-01          TGDQP--PGLNKHWSTVPGLLGEA--GH--QQGQ-PASSSH---------
A0A452ER54_BAD-02      TGDRP--PGLSKHWLTAPGLLGEA--GH--QQGQ-PAGSSH---------
W5P8G9_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA--GH--QQGQ-PAGSSH---------
Q61337_BAD-07          TEDQP--G-----PYLAPGLLGSN--IH--QQGR-AATNSH---------
H0WVR2_BAD-01          SGDQP--LGPGKNRCTTPSLLGDA--SH--LQGQ-PASNTH---------
A0A2K6GWV0_BAD-01      SGDRP--SGPGKHPCTAPSFLGDA--SH--QQGQ-PSSSSH---------
F7DN67_BAD-01          TGDWP--SDPVRHQRTAPGLLGEA--GH--QQGQ-PASSSH---------
Q45KI9_BAD-01          TGDRP--PSPGKHQQTAPGLLGEA--GH--QQGQ-PASRKH---------
A0A3Q7SWS0_BAD-01      TGDRP------------PGLLGEA--GH--QQGQ-PASRKH---------
B4DZQ9_BAD-01          AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2J8TYJ3_BAD-02      AGDRP--SGSSKHHRQAPGLLRDA--SH--QQEQ-PTSSSH---------
A0A2I2YFH2_BAD-02      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2I2YFH2_BAD-01      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
Q92934_BAD-01          AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
Q92934_BAD-02          AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2I3TBK7_BAD-02      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2R8Z674_BAD-01      AGDGP--SGSSKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2J8TYJ3_BAD-03      AGDRP--SGSSKHHRQAPGLLRDA--SH--QQEQ-PTSSSH---------
H0V608_BAD-01          TGDEL--GSS-----PAGGFLGDT--SH--QQRQLRSSRSH---------
A0A2K5PDB1_BAD-01      AGDSP--PGSGKHRRQAPGLPGDA--SH--QQGQ-PTSSSH---------
U3F2S3_BAD-01          AGDRP--PGSGKHRRQAPGLPGDA--SH--QQGQ-STSSSH---------
A0A2K5E6A6_BAD-01      AGDRP--PGSGKHPRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K6TG62_BAD-01      AGDSP--PGSGKHRRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K5M0A7_BAD-01      AGDRP--SDCGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A1D5QBW1_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K6E7I4_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5XJR2_BAD-01      AGDRP--SDCGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K6N196_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K6PUL3_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5HKU7_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-ATSSSH---------
A0A0D9R491_BAD-01      AGNRP--SDSGKHHHQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5VCA1_BAD-01      AGNRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A4X1VE31_BAD-02      TGDRP--PGPSKPWRTAPGHLGEA--GH--QQGQ-PASSSH---------
A0A4X1VE31_BAD-01      TGDRP--PGPSKPWRTAPGHLGEA--GH--QQGQ-PASSSH---------
A0A287AEF3_BAD-01      TGTDP------QPWRTAPGHLGEA--GH--QQGQ-PASSSH---------
A0A4X1VE31_BAD-03      TGDRP--PGPSKPWRTAPGHLGEA--GH--QQGQ-PASSSH---------
A0A671ELU4_BAD-01      TGDQP--PGPGKHLCTAPGLLGEA--GH--QQGQ-PASSSH---------
A0A452ER54_BAD-01      TGDRP--PGL------TPGLLGEA--GH--QQGQ-PAGSSH---------
A0A452RJM6_BAD-01      TGDQP--PGPGKHRQTAPGLLGEA--AQ--PQGQ-PASSNH---------
A0A384DJL2_BAD-01      TGDQP--PGPGKHRQTAPGLLGEA--AH--PQGQ-PASSNH---------
M3YNE7_BAD-01          TGDQP--PGLGKHLQTAPGLLGEA--GH--QQGQ-PASSSH---------
A0A667H8Z9_BAD-01      TGDRP--RGPGKHQRTAPGLLGEA--GH--QQGQ-PASSNH---------
A0A673V6P8_BAD-01      TGDRP--SGLGKHQRTAPGLLGEA--GP--QQGQ-PASSSR---------
A0A4W2C9A8_BAD-01      TGDRP--PGLSKHWLTAPGLLGEA--GH--QQGQ-PAGSSH---------
A0A4W2C9A8_BAD-01      TGDRP--PGLSKHWLTAPGLLGEA--GH--QQGQ-PAGSSH---------
F1MUT9_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA--GH--QQGQ-PAGSSH---------
Q3SYZ0_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA--GH--QQGQ-PAGSSH---------
A0A4U1FMC3_BAD-01      TGDRP--PGPSKHRQTAPGLLGEA--GH--QQGQ-PASSSH---------
A0A2Y9EHU3_BAD-01      TGDKP--PGPSKHRQTAPGLLGEA--GH--QQGQ-PASSSH---------
A0A2I3TBK7_BAD-01      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2R8Z674_BAD-02      AGDGP--SGSSKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2I2YFH2_BAD-03      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
Q92934_BAD-03          AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5M0A7_BAD-02      AGDRP--SDCGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5XJR2_BAD-02      AGDRP--SDCGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K6E7I4_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5PDB1_BAD-02      AGDSP--PGSGKHRRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K5E6A6_BAD-02      AGDRP--PGSGKHPRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K6TG62_BAD-02      AGDSP--PGSGKHRRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K5HKU7_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-ATSSSH---------
A0A2K6N196_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K6PUL3_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2J8TYJ3_BAD-01      AGDRP--SGSSKHHRQAPGLLRDA--SH--QQEQ-PTSSSH---------
A0A2K5M0A7_BAD-03      AGDRP--SDCGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5XJR2_BAD-03      AGDRP--SDCGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K6E7I4_BAD-03      AGDRP--SDSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2I2YFH2_BAD-04      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
Q92934_BAD-04          AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2I3TBK7_BAD-03      AGDGP--SGSGKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2R8Z674_BAD-03      AGDGP--SGSSKHHRQAPGLLWDA--SH--QQEQ-PTSSSH---------
A0A2K5E6A6_BAD-03      AGDRP--PGSGKHPRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K5PDB1_BAD-03      AGDSP--PGSGKHRRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A2K6TG62_BAD-03      AGDSP--PGSGKHRRQAPGLPGDA--SH--QQGQ-PTSSSH---------
A0A6F9BAV3_BAD-01      ------------------MSTRPR--PG--GRVR-LYSESQ---------
A0A3P8YI30_BAD-02      YPEFQ------FCNTSTNTSNRTL--PG--VRVR-LYSESQ---------
A0A4W5R1T6_BAD-01      YPEFQ------LHTVSTTTSTRPR--PG--GRVR-LYSESQ---------
A0A060W8P9_BAD-01      YPEFQ------LHNVSTTTSIRPR--PG--GRAR-LYSESQ---------
B5X1T1_BAD-01          YPEFQ------RHYVSTRTGIRPR--PG--GRVR-LYSESQ---------
A0A673ZHY7_BAD-01      YPEFQ------LHYVSTRTSIRPR--PG--ERVR-LYSESQ---------
A0A671NP27_BAD-01      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A672SAE4_BAD-01      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A672SAE4_BAD-02      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A671RUV0_BAD-01      GSPQR-----KQH-LAVPD--------------R-LKGEQL---------
A0A673HRQ3_BAD-01      GSPQR-----KQH-LAVPD--------------R-LKGEQL---------
A0A672RGH0_BAD-01      GSPQR-----TQH-LAVPG--------------R-LKGEQL---------
Q4V925_BAD-02          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-03          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
A7MCM4_BAD-01          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-01          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-04          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
A0A3B3QX41_BAD-01      NNLKN-------------TKNPGE--AG--GRVR-MRSESQ---------
A0A3Q3RXS8_BAD-01      RQEQQ--V-SQRHALALPELRTT---------------------------
A0A3Q0QNQ2_BAD-02      SFLLL--VSVISFFWSLPKAFSR---------------------------
A0A3Q3WTY4_BAD-01      EQEQQ--V-FQRHTLTLPELRMA---------------------------
A0A3P8Y761_BAD-01      GQGKT-GS-RLGLSLNLP--------GE--GRIR-LNSESQ---------
A0A4W5JLL9_BAD-01      GKGMT-GG-PIGHALTVPEMRLA---GE--GRLR-MNSESQ---------
A0A3B5Q2N7_BAD-01      EKEKP--L-SQRHTLTLPELRST----T--GRVR-LNSESI---------
A0A087X8P8_BAD-01      VKERP--L-SQRHTLTLPELRST----T--GRVR-LNSESI---------
A0A3B3UA11_BAD-01      VKERP--L-SQRHTLTLPELRST----T--GRVR-LNSESI---------
A0A3B3YFR1_BAD-01      VKERP--L-SQRHTLTLPELRST----T--GRVR-LNSESI---------
A0A3P9Q7C3_BAD-01      VKERP--L-SQRHTLTLPELRST----T--GRVR-LNSESI---------
A0A3B3HDU2_BAD-01      AGGEGEHL-HDRHSLTLPELRLT---SN--GRTR-LNSEST---------
A0A3P9KSL7_BAD-02      AGGEGEHL-HDRHSLTLPELRLT---SN--GRTR-LNSEST---------
A0A3P9KSL7_BAD-01      AGGEGEHL-HDRHSLTLPELRLT---SN--GRTR-LNSEST---------
A0A3B5BAL2_BAD-01      EQPMH--V-FERRNLALPELRTP---AA--GRIR-LNSESH---------
A0A665TUH3_BAD-01      --EQE--V-FQRHNLTLPEIRTA---GA--GRTR-LNSESH---------
A0A674MXC1_BAD-04      EQERQ--V-LQRHTLTLPELRLT---GT--SRTR-VSSESQ---------
A0A674MXC1_BAD-01      EQERQ--V-LQRHTLTLPELRLT---GT--SRTR-VSSESQ---------
A0A674MXC1_BAD-02      EQERQ--V-LQRHTLTLPELRLT---GT--SRTR-VSSESQ---------
A0A674MXC1_BAD-03      EQERQ--V-LQRHTLTLPELRLT---GT--SRTR-VSSESQ---------
A0A671TL42_BAD-01      EEGQQ--V-SQRHALTLPELRMA---G----RIR-LNSESH---------
A0A3Q3AEL8_BAD-01      GPEDG-----VRQRLTLPELRHS---KN--GRLR-VNSESL---------
A0A3Q3AEL8_BAD-02      GPEDG-----VRQRLTLPELRHS---KN--GRLR-VNSESL---------
A0A1A8AQV0_BAD-01      GQEES-----VRPHPNLPELRLP---LN--GRIR-LNSESH---------
G3Q8B3_BAD-01          GQEQQ--R-LQRHTLTLPELRLSG--RK--SQRI-VEKE-----------
A0A3Q2Y0E4_BAD-01      EKEQEQCL-RQGLRLTLPELPMEA--MS--GRIR-LNSESH---------
A0A3Q3R5S3_BAD-01      SQEQQ--V-PPCHSLTLPELRMAA--TS---RNR-VSSESN---------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
A0A3B1JLM2_BAD-01      ----------------VYNINRWEDNEN---------------QDGASAE
A0A4W4DXF5_BAD-01      ----------------AYTVSHWEDTES---------------QDGVSAE
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          -------------------------------------------SASEASE
A0A452IFQ4_BAD-01      -------------------------------------------SDTPSLE
A0A674I2R9_BAD-01      -------------------------------------------SDPPSLE
A0A3P8YI30_BAD-01      ----------------VCSQVGRQDNTE---------------FQVAMTP
A0A3B4DUY7_BAD-01      ----------------VYTVSRWQDNED------------------GLLA
A0A337SAW2_BAD-01      ---------SNHHGGAGAVETRSRHSSY---------------PAGTEED
A0A673J9C6_BAD-01      ---------DEDLLETGA-------------------------------A
A0A4W5JLL9_BAD-02      ---------AQELQGRGP-------------------------------G
A0A674DKC6_BAD-01      ---------AQELQGRGP-------------------------------G
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      -------------------------------------------QESGAVR
A0A3Q3FKT9_BAD-01      ----------------AYTVSRDEE------------------LQARGEE
A0A3B1IH05_BAD-01      -------------------------------------------QESGAGR
A0A674AVP9_BAD-01      ---------------VCSQVGKREDTEF---------------QDVMTPT
A0A1S3L0Z2_BAD-01      ---------------VCSQVGKREDTEF---------------QDVMTPT
B5XEF1_BAD-01          ---------------VRSQVGKREDTEF---------------QDVMTPT
A0A4W5MZR2_BAD-01      ---------------VCSQVGKRENTEF---------------QDVMTPT
A0A060W8W7_BAD-01      ---------------VCSQVGKREDTEF---------------QDVMTPT
E7FBJ6_BAD-01          ---------------VYT-VSRWQDTET---------------QDGASVE
A0A673J5Q9_BAD-01      ---------------VYT-VSRWQEAEP---------------QDGALAE
A0A671PX91_BAD-01      ---------------VYT-VSRWQEAEP---------------QDGALAE
A0A672LB88_BAD-01      ---------------VYT-VSRWQEAEP---------------QDGALVE
A0A673I6H5_BAD-01      ---------------VYM-VSRWQEAVP---------------QDGASAE
A0A671SBB4_BAD-01      ---------------VYM-VSRWQEAEP---------------QDGASAE
A0A672R7P6_BAD-01      ---------------VYM-VSRWQEAEP---------------QDGASAE
A0A3P8Y761_BAD-02      ----------------VFATSGGERSGE---------------LQGLGQG
A0A3Q2QC80_BAD-01      ----------------ASTISRE---EE---------------LQGRAEE
A0A4W6EMZ7_BAD-02      ----------------ASTASRD---EG---------------LQVRGEE
A0A3Q3FKT9_BAD-02      ----------------AYTVSRD---EE---------------LQARGEE
A0A3Q3FKT9_BAD-03      ----------------AYTVSRD---EE---------------LQARGEE
A0A3B5L9R9_BAD-01      --------------------------VE---------------LQARGEE
A0A667ZNC6_BAD-01      ----------------VSTVSKD---EE---------------LLARGEG
A0A3P9B2E4_BAD-01      ----------------TSSIARD---EE---------------LMARGED
A0A668V3Q4_BAD-01      ----------------TSSVARD---ED---------------LMARGED
I3K7B6_BAD-01          ----------------TSSVARD---ED---------------LMARGED
A0A3Q3C680_BAD-01      ----------------TSSIARD---EE---------------LMARGED
A0A3P8QRJ7_BAD-01      ----------------TSSIARD---EE---------------LMARGED
A0A3Q4GGN3_BAD-01      ----------------TSSIARD---EE---------------LMARGED
A0A3B4GXJ6_BAD-01      ----------------TSSIARD---EE---------------LMARGED
A0A3Q2D5S0_BAD-01      ----------------A--FTRE---EE-----------------ARGEE
A0A3Q0QNQ2_BAD-01      ----------------TSSVSRD---EE---------------LVVRGED
A0A3P8WI83_BAD-02      ----------------ASTISRE---EA---------------FQSWGEE
A0A3P8WI83_BAD-01      ----------------ASTISRE---EA---------------FQSWGEE
A0A3P9HNZ2_BAD-01      ----------------ASTYSRD---ED---------------LAR--ED
A0A3B3BQF7_BAD-01      ----------------VSTYSRD---ED---------------LPR--ED
A0A672JQ68_BAD-01      ----------------ASTVSRD---EE---------------LQARAEE
A0A2U9BAC9_BAD-01      ----------------ASTLSRD---EE---------------LLTRWDE
A0A4W6EMZ7_BAD-01      ----------------ASTASRD---EG---------------LQVRGEE
A0A3B4VFC5_BAD-01      ----------------TSTVSRD---EE---------------FQARGEE
A0A3B4W9T1_BAD-01      ----------------TSTVSRD---EE---------------FQARGEE
A0A3Q1K1C7_BAD-01      ----------------ASTVYRD---EE---------------LQAKADE
A0A672YF93_BAD-01      ----------------VSNVTRD---EE---------------LQMRGED
A0A3Q1GWH9_BAD-01      ----------------ASTLSRD---EE---------------LQAKGEE
A0A3Q1CPU7_BAD-01      ----------------ASTLSRD---EE---------------LQARGEE
A0A3P8TWH6_BAD-01      ----------------ASTLSRD---EE---------------LQARGEE
H3D8J8_BAD-01          ----------------ASAVSRD---EE---------------LQGNGDD
A0A6F9CQZ0_BAD-02      ----------------AFSTSRGKRNGE---------------LQGRGPG
A0A6F9CA11_BAD-02      ----------------A---------QE---------------LQGSGPG
A0A1S3N9Q3_BAD-01      ----------------A---------QE---------------LQGRGPG
A0A5F8GA49_BAD-01      --PPLREG--------PAVEVGP--------------------EAGAQAE
H3ANP3_BAD-03          ------YG-WVKLRKRNNMEILGRP------------------SSESQIS
H3ANP3_BAD-01          ----------T-----DNMEILGRP------------------SSESQIS
H3ANP3_BAD-02          ----------T-----DNMEILGRP------------------SSESQIS
H3ANP3_BAD-04          ------WG-FT-----DNMEILGRP------------------SSESQIS
G3VRY3_BAD-03          ------EGAGA-----G----RPRLISYPPLREGSREASP---EAEAEAE
G3VRY3_BAD-02          ------EGAGA-----G----RPRLISYPPLREGSREASP---EAEAEAE
G3VRY3_BAD-01          ------EGAGA-----G----RPRLISYPPLREGSREASP---EAEAEAE
A0A4X2KAA5_BAD-01      ------EGAGA-----GAGDRRPRLISYPPLREGPGEASP---EAEAEAD
A0A672V9F8_BAD-01      ------PLWGC-----PRPP----------CFVGGGVQARARLGSEGERG
A0A674GQ16_BAD-01      ------AIFGG-----PLTPLPPQRRGPGCCRSGGGAGG----GGDPQIG
A0A6I8NVP2_BAD-01      LPPRLPPATGP-----RAKEPSGRLNSE---------------PPDSEAE
G3TP47_BAD-01          ------HG-GA-----AAVETRSRHSSY---------------PAGSDEA
Q61337_BAD-05          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
Q61337_BAD-06          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
Q61337_BAD-03          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
Q61337_BAD-04          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
Q61337_BAD-02          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
Q61337_BAD-01          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
A0A287CT05_BAD-01      ------HG-GA-----GATETRSRHSSY---------------PADTDLD
A0A287CT05_BAD-02      ------HG-GA-----GATETRSRHSSY---------------PADTDLD
G5B6Q3_BAD-01          ------HG-GT-----GATETRSRHSSY---------------PTGMEEE
G5B6Q3_BAD-02          ------HG-GT-----GATETRSRHSSY---------------PTGMEEE
G1P8C5_BAD-01          ------HD-GA-----GSVEPRSRHSSY---------------PTGTEED
A0A452ER54_BAD-02      ------HG-GT-----GAVETRSRHSSY---------------PAGPEDD
W5P8G9_BAD-01          ------HG-GT-----GAVETRSRHSSY---------------PAGPEDD
Q61337_BAD-07          ------HG-GA-----GAMETRSRHSSY---------------PAGTEED
H0WVR2_BAD-01          ------HGAGP-----GAVETRSRHSSY---------------PAGTEED
A0A2K6GWV0_BAD-01      ------HG-GA-----GSVETRSRHSSY---------------PAGTEED
F7DN67_BAD-01          ------HG-GA-----GAVETRSRHSSY---------------PEGTEDE
Q45KI9_BAD-01          ------HG-GA-----GA-ETRSRHSSF---------------PAGTDED
A0A3Q7SWS0_BAD-01      ------HG-GA-----GA-ETRSRHSSF---------------PAGTDED
B4DZQ9_BAD-01          ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
A0A2J8TYJ3_BAD-02      ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
A0A2I2YFH2_BAD-02      ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
A0A2I2YFH2_BAD-01      ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
Q92934_BAD-01          ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
Q92934_BAD-02          ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
A0A2I3TBK7_BAD-02      ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
A0A2R8Z674_BAD-01      ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
A0A2J8TYJ3_BAD-03      ------HG-GA-----GAVEIRSRHSSY---------------PAGTEDD
H0V608_BAD-01          ------HG-GT-----VAMETRSRHRSY---------------PAGTEEE
A0A2K5PDB1_BAD-01      ------HG-GA-----GAVETRSRHRSY---------------PAGTEED
U3F2S3_BAD-01          ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K5E6A6_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K6TG62_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEGD
A0A2K5M0A7_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A1D5QBW1_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K6E7I4_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K5XJR2_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K6N196_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K6PUL3_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K5HKU7_BAD-01      ------HG-GA-----GAVETRSRHSSH---------------PAGTEED
A0A0D9R491_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A2K5VCA1_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A4X1VE31_BAD-02      ------HG-GA-----GAVETRSRHSSY---------------PEGTEED
A0A4X1VE31_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PEGTEED
A0A287AEF3_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PEGTEED
A0A4X1VE31_BAD-03      ------HG-GA-----GAVETRSRHSSY---------------PEGTEED
A0A671ELU4_BAD-01      ------HG-GA-----GSVEPRSRHSSY---------------PAGTEED
A0A452ER54_BAD-01      ------HG-GT-----GAVETRSRHSSY---------------PAGPEDD
A0A452RJM6_BAD-01      ------HG-GA-----GAVEPRSRHSSY---------------PAGTEED
A0A384DJL2_BAD-01      ------HG-GA-----GAVEPRSRHSSY---------------PAGTEED
M3YNE7_BAD-01          ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A667H8Z9_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A673V6P8_BAD-01      ------HG-GA-----GAVETRSRHSSY---------------PAGTEED
A0A4W2C9A8_BAD-01      ------HG-GT-----GAVETRSRHSSY---------------RAGPEDN
A0A4W2C9A8_BAD-01      ------HG-GT-----GAVETRSRHSSY---------------RAGPEDN
F1MUT9_BAD-01          ------HG-GT-----GAVETRSRHSSY---------------RAGPEDN
Q3SYZ0_BAD-01          ------HG-GT-----GAVETRSRHSSY---------------RAGPEDN
A0A4U1FMC3_BAD-01      ------HG-GT-----GAVETRSRHSSY---------------SAGTEDE
A0A2Y9EHU3_BAD-01      ------HG-GT-----GAVDTRSRHSSY---------------SAGTEDD
A0A2I3TBK7_BAD-01      ------HG--------------EGT--S---------------SPEERGH
A0A2R8Z674_BAD-02      ------HG--------------EGT--S---------------SPEERGH
A0A2I2YFH2_BAD-03      ------HG--------------EGT--S---------------SPEERRH
Q92934_BAD-03          ------HG--------------EGT--S---------------SPEERGH
A0A2K5M0A7_BAD-02      ------HG--------------GT---S---------------SPEERGH
A0A2K5XJR2_BAD-02      ------HG--------------GT---S---------------SPEERGH
A0A2K6E7I4_BAD-02      ------HG--------------GT---S---------------SPEERGH
A0A2K5PDB1_BAD-02      ------HG--------------GT---S---------------SPEERGH
A0A2K5E6A6_BAD-02      ------HG--------------GT---S---------------SPEERGH
A0A2K6TG62_BAD-02      ------HG--------------GT---S---------------SPEERGH
A0A2K5HKU7_BAD-02      ------HG--------------GRAWYS---------------PS-ESED
A0A2K6N196_BAD-02      ------HG--------------GRAWYY---------------PA-ESED
A0A2K6PUL3_BAD-02      ------HG--------------GRAWYY---------------PA-ESED
A0A2J8TYJ3_BAD-01      ------HG--------------GRTWYS---------------PSWESED
A0A2K5M0A7_BAD-03      ------HG--------------GGAWYS---------------PSWESED
A0A2K5XJR2_BAD-03      ------HG--------------GGAWYS---------------PSWESED
A0A2K6E7I4_BAD-03      ------HG--------------GRAWYS---------------PSWESED
A0A2I2YFH2_BAD-04      ------HG--------------GRTSYS---------------PSWESED
Q92934_BAD-04          ------HG--------------GRTSYS---------------PSWESED
A0A2I3TBK7_BAD-03      ------HG--------------GRTSYS---------------PSWESED
A0A2R8Z674_BAD-03      ------HG--------------GRTSYS---------------PSWESED
A0A2K5E6A6_BAD-03      ------HG--------------GE--YS---------------TCASASS
A0A2K5PDB1_BAD-03      ------HG------------------------------------------
A0A2K6TG62_BAD-03      ------HG------------------------------------------
A0A6F9BAV3_BAD-01      ----------------VCSQVGKREDTE---------------FQDVMTP
A0A3P8YI30_BAD-02      ----------------VCSQVGRQDNTE---------------FQVAMTP
A0A4W5R1T6_BAD-01      ----------------VFSHVGRRDDTE---------------FQDAMTP
A0A060W8P9_BAD-01      ----------------VCSQVGRRDDTE---------------FQDAITP
B5X1T1_BAD-01          ----------------VCSQVGRRDNTE---------------FQDVMTP
A0A673ZHY7_BAD-01      ----------------VCSQVGRREDTE---------------FQDVMTP
A0A671NP27_BAD-01      ----------------GRHRNLSMNDEN---------------LLETGAA
A0A672SAE4_BAD-01      ----------------GRHRNLSMNDED---------------LLETGAA
A0A672SAE4_BAD-02      ----------------GRHRNLSMNDED---------------LLETGAA
A0A671RUV0_BAD-01      ----------------GRHRNLSMNDED---------------LLETGAA
A0A673HRQ3_BAD-01      ----------------GRHRNLSMNDED---------------LLETGAA
A0A672RGH0_BAD-01      ----------------GRHRNLSMNDED---------------LLETGAA
Q4V925_BAD-02          ----------------GRQRNLSMNEED---------------LLETGVA
Q4V925_BAD-03          ----------------GRQRNLSMNEED---------------LLETGVA
A7MCM4_BAD-01          ----------------GRQRNLSMNEED---------------LLETGVA
Q4V925_BAD-01          ----------------GRQRNLSMNEED---------------LLETGVA
Q4V925_BAD-04          ----------------GRQRNLSMNEED---------------LLETGVA
A0A3B3QX41_BAD-01      ------------------VSSIRSEDLD---------------FGEGGAS
A0A3Q3RXS8_BAD-01      ------------------ASNRIRLSSE---------------SQSRVDE
A0A3Q0QNQ2_BAD-02      -------------------------DEE---------------LVVRGED
A0A3Q3WTY4_BAD-01      -------------------------GRT---------------LQVKGED
A0A3P8Y761_BAD-01      ----------------VFATSGGERSGE---------------LQGLGQG
A0A4W5JLL9_BAD-01      -------------------------AQE---------------LQGRGPG
A0A3B5Q2N7_BAD-01      ------------------ASTISR-EVE---------------LQARGEE
A0A087X8P8_BAD-01      ------------------ASTISR-EEE---------------LQARGEE
A0A3B3UA11_BAD-01      ------------------ASTISR-EEE---------------LQARGEE
A0A3B3YFR1_BAD-01      ------------------ASTISR-EEE---------------LQARGEE
A0A3P9Q7C3_BAD-01      ------------------ASTISR-EEE---------------LQARGEE
A0A3B3HDU2_BAD-01      ------------------ASTYSR-DED---------------LAR--ED
A0A3P9KSL7_BAD-02      ------------------ASTYSR-DED---------------LAR--ED
A0A3P9KSL7_BAD-01      ------------------ASTYSR-DED---------------LAR--ED
A0A3B5BAL2_BAD-01      ------------------ATTVSR-DEE---------------LQARGEE
A0A665TUH3_BAD-01      ------------------TSTGSR-DED---------------FLARGDD
A0A674MXC1_BAD-04      ------------------ASTFSR-EEE---------------LQGNGED
A0A674MXC1_BAD-01      ------------------ASTFSR-EEE---------------LQGNGED
A0A674MXC1_BAD-02      ------------------ASTFSR-EEE---------------LQGNGED
A0A674MXC1_BAD-03      ------------------ASTFSR-EEE---------------LQGNGED
A0A671TL42_BAD-01      ------------------ASTVSR-DVE---------------LQARGED
A0A3Q3AEL8_BAD-01      ------------------SSTSSRGEEE---------------LPARADD
A0A3Q3AEL8_BAD-02      ------------------SSTSSRGEEE---------------LPARADD
A0A1A8AQV0_BAD-01      ------------------VSNVSRDEDL---------------LARVAEE
G3Q8B3_BAD-01          --------------------------------------------EELWLD
A0A3Q2Y0E4_BAD-01      ------------------ALAVSR-EEE---------------FQARVDE
A0A3Q3R5S3_BAD-01      ------------------ASTVQ---------------------DAKSDE
                                                                         

Q61337_BAD-09          -------------------------XAAQRYGR-ELRRMSDEFEGSFKF-
Q2PG01_BAD-01          ------MEEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2I3H4B2_BAD-01      ------MGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
Q92934_BAD-06          ------MGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
Q92934_BAD-05          ------MGEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A670JUY4_BAD-01      ------WTLALGTFRARSRSAPPILWAAQRYGR-ELRRMSDEFHGEL-Q-
A0A670YRG7_BAD-01      ------TSDEVGAFRARSRSAPPILWAAQRYGR-ELRRMSDEFHG-----
A0A3B1JLM2_BAD-01      D-G---GVGDGAPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A4W4DXF5_BAD-01      EGG---GACEGAPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
Q6P7C5_BAD-01          ------NSHHGGRFL-----------------------------------
C1C3S9_BAD-01          TDS---VGEL-QHFRSRSRSAPSSLMVAARYGR-ELRRMSDEFDQIFTS-
A0A452IFQ4_BAD-01      PEV---QDEPGGAFRARSRSAPPILWAAMRYGR-ELRRMSDEFDVALQV-
A0A674I2R9_BAD-01      PEV---QDEPGGAFRARSRSAPPILWAAMRYGR-ELRRMSDEFDVALQV-
A0A3P8YI30_BAD-01      TEE---SGGDAAPFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
A0A3B4DUY7_BAD-01      EDG---GAGDGAPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A337SAW2_BAD-01      EGT---EEEEPSPFRGRSRSAPPNLWAALRYGR-ELRRMSDEFQGSFKG-
A0A673J9C6_BAD-01      DEG---DLVGGDPFRPRSRSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A4W5JLL9_BAD-02      VEG---MPTDGASFRVRSQSAPPALWAAKKYGR-QLRRMSDEFDTWLDK-
A0A674DKC6_BAD-01      VEG---VPTDGASFRGRSQSAPPALWAAKRYGR-QLRRMSDEFDTWLDK-
A0A4W4HE29_BAD-01      ------QDSGAESFRRRSRSAPPILWAAKKYGR-QLRKMSDEFDTLLDK-
A0A3B4CPH6_BAD-01      HGD---GAADGDSFRRRCRSAPPALWAAKKYGR-QLRKMSDEFDTLLDK-
A0A3Q3FKT9_BAD-01      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A3B1IH05_BAD-01      HED---GARDGDSFRRRSRSAPPSLWAAKKYGR-QLRKMSDEFDKGLEQ-
A0A674AVP9_BAD-01      EEG---G-GDGASFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
A0A1S3L0Z2_BAD-01      EEG---G-GDGASFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
B5XEF1_BAD-01          EEG---G-GDGASFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
A0A4W5MZR2_BAD-01      EEG---G-GDGASFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
A0A060W8W7_BAD-01      EDG---G-GDGASFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
E7FBJ6_BAD-01          EN------GDGLPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A673J5Q9_BAD-01      ENG---GTGDGLPFRGRSQSAPAVLWKAKKYGR-QLRRMSDEFDTWLDK-
A0A671PX91_BAD-01      ENG---GTGDGLPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A672LB88_BAD-01      ENG---GTGDGLPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A673I6H5_BAD-01      ENG---GTGDGLPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A671SBB4_BAD-01      ENG---GTGDGLPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A672R7P6_BAD-01      ENG---GTGDGLPFRGRSQSAPAALWKAKKYGR-QLRRMSDEFDTWLDK-
A0A3P8Y761_BAD-02      LNC---VATEGLPFRVRSQSAPPALWAAKRYGR-QLRRMSDEFDTWLDK-
A0A3Q2QC80_BAD-01      EAG---TPTEGLPFRNRSNSAPPALWAAKKYGR-QLRRMSDEFGSLLDK-
A0A4W6EMZ7_BAD-02      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A3Q3FKT9_BAD-02      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A3Q3FKT9_BAD-03      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A3B5L9R9_BAD-01      EVG---TPTEGFPFRGRSLSAPPSLWAAKKYGR-QLRRMSDEFVNLLDK-
A0A667ZNC6_BAD-01      EDG------DGAPFRGRSQSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3P9B2E4_BAD-01      EVC---TPTEGDPFRRRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A668V3Q4_BAD-01      EVC---TPTEGDPFRRRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
I3K7B6_BAD-01          EVC---TPTEGDPFRRRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A3Q3C680_BAD-01      EVC---TPTEGDPFRRRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3P8QRJ7_BAD-01      EVC---TPTEGDPFRRRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3Q4GGN3_BAD-01      EVC---TPTEGDPFRRRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3B4GXJ6_BAD-01      EVC---TPTEGDPFRRRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3Q2D5S0_BAD-01      EVG---TPTEGYPFRGRSNSAPPALWAAKKYGR-QLRRMSDEFVTLLDK-
A0A3Q0QNQ2_BAD-01      EIC---TPTEGDPFRRRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3P8WI83_BAD-02      EAG---TPTEGAPFRGRSRSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3P8WI83_BAD-01      EAG---TPTEGAPFRGRSRSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3P9HNZ2_BAD-01      EAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3B3BQF7_BAD-01      EAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A672JQ68_BAD-01      EVG---TPTEGAPFRGRSKSAPPALWAAKKYGQ-RLRRMSDEFDSLLDK-
A0A2U9BAC9_BAD-01      EAG---TPTDGAPFRGRSKSAPPALWAAMKYGQ-KLRRMSDEFDSLLDK-
A0A4W6EMZ7_BAD-01      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A3B4VFC5_BAD-01      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A3B4W9T1_BAD-01      EAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A3Q1K1C7_BAD-01      EAG---TPTDGAPFRARSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A672YF93_BAD-01      EAS---TPTEGAPFRARSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3Q1GWH9_BAD-01      EAG---TPTEGAPFRARSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3Q1CPU7_BAD-01      EAG---TPTDGAPFRARSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3P8TWH6_BAD-01      EAG---TPTDGAPFRARSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
H3D8J8_BAD-01          EAG---TPTDGAPFRGRSRSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A6F9CQZ0_BAD-02      VDG---IPTDGAPFRVRSQSAPPALWAAKRYGR-QLRRMSDEFDTWLDK-
A0A6F9CA11_BAD-02      VDG---VPTDGASFRVRSQSAPPALWAAKKYGR-QLRRMSDEFDTWLDK-
A0A1S3N9Q3_BAD-01      VEG---MPTDGASFRGRSQSAPPALWAAKRYGR-QLRRMSDEFDTWLDK-
A0A5F8GA49_BAD-01      RAE---AEEDRGLFRSRSSSAPPILWAARRYGS-ELRRMSDEFDCSF-K-
H3ANP3_BAD-03          DSE---SLDELGPFRTRSRSAPPNFWAARKYGQ-ELRRMSDEFDMSF-L-
H3ANP3_BAD-01          DSE---SLDELGPFRTRSRSAPPNFWAARKYGQ-ELRRMSDEFDMSF-L-
H3ANP3_BAD-02          DSE---SLDELGPFRTRSRSAPPNFWAARKYGQ-ELRRMSDEFDMSF-L-
H3ANP3_BAD-04          DSE---SLDELGPFRTRSRSAPPNFWAARKYGQ-ELRRMSDEFDMSF-L-
G3VRY3_BAD-03          QSE---GEEERGLFRGRSSSAPPILWAARHYGS-ELRRMSDEFHCTF-K-
G3VRY3_BAD-02          QSE---GEEERGLFRGRSSSAPPILWAARHYGS-ELRRMSDEFHCTF-K-
G3VRY3_BAD-01          QSE---GEEERGLFRGRSSSAPPILWAARHYGS-ELRRMSDEFHCTF-K-
A0A4X2KAA5_BAD-01      FFE---GEEERSLFRSRSSSAPPILWAARRYGS-ELRRMSDEFDCTF-K-
A0A672V9F8_BAD-01      --P---GEPPPGV-RGRSRSAPPALWAARRFGR-QLRRMSDEFQQQV-G-
A0A674GQ16_BAD-01      APP---GDPPPA--RGRSRSAPPVLWAAQRYGR-RLRRMSDEFQLQ----
A0A6I8NVP2_BAD-01      EH---------SPFRGRSHSAPPILWVAQRYGR-ELRRMSDEFDCTF-Q-
G3TP47_BAD-01          EGL---EEDP-SPFRGRSLSAPPNLWAAQRYGR-ELRRMSDEFQGYF-K-
Q61337_BAD-05          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
Q61337_BAD-06          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
Q61337_BAD-03          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
Q61337_BAD-04          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
Q61337_BAD-02          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
Q61337_BAD-01          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
A0A287CT05_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
A0A287CT05_BAD-02      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
G5B6Q3_BAD-01          AGM---KEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
G5B6Q3_BAD-02          AGM---KEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
G1P8C5_BAD-01          DDT---EEGEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFQGSFKK-
A0A452ER54_BAD-02      EGT---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
W5P8G9_BAD-01          EGT---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
Q61337_BAD-07          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF---
H0WVR2_BAD-01          EGI----EEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEDSFKK-
A0A2K6GWV0_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEDSFKK-
F7DN67_BAD-01          GME---GEEP-GPFRGRSRSAPPNLWAARRYGR-ELRRMSDEFQVSF-Q-
Q45KI9_BAD-01          EGM---EEEELSPFRGRSSSAPPNLCAARRYGR-ELRRMSDEFQGSF-K-
A0A3Q7SWS0_BAD-01      EGM---EEEELSPFRGRSSSAPPNLCAALRYGR-ELRRMSDEFQGSF-K-
B4DZQ9_BAD-01          EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A2J8TYJ3_BAD-02      EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A2I2YFH2_BAD-02      EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A2I2YFH2_BAD-01      EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
Q92934_BAD-01          EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
Q92934_BAD-02          EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A2I3TBK7_BAD-02      EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A2R8Z674_BAD-01      EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
A0A2J8TYJ3_BAD-03      EGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSFKK-
H0V608_BAD-01          EGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K5PDB1_BAD-01      EGM---EEEP-STFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
U3F2S3_BAD-01          EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K5E6A6_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K6TG62_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K5M0A7_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A1D5QBW1_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K6E7I4_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K5XJR2_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K6N196_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K6PUL3_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K5HKU7_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A0D9R491_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A2K5VCA1_BAD-01      EGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFVDSF-K-
A0A4X1VE31_BAD-02      EGT---EDEELSPFRGRSLSAPPILWAAQRYGR-ELRRMSDEFQGSFKK-
A0A4X1VE31_BAD-01      EGT---EDEELSPFRGRSLSAPPILWAAQRYGR-ELRRMSDEFQGSF-KV
A0A287AEF3_BAD-01      EGT---EDEELSPFRGRSLSAPPILWAAQRYGR-ELRRMSDEFQGSFKK-
A0A4X1VE31_BAD-03      EGT---EDEELSPFRGRSLSAPPILWAAQRYGR-ELRRMSDEFQGSF-K-
A0A671ELU4_BAD-01      EEM---EEEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFEGSF-K-
A0A452ER54_BAD-01      EGT---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
A0A452RJM6_BAD-01      EGL---EEEELSPFRGRSSSAPPNLCAALRYGR-ELRRMSDEFQGSF-K-
A0A384DJL2_BAD-01      EGL---EEEELSPFRGRSSSAPPNLCAALRYGR-ELRRMSDEFQGSF-K-
M3YNE7_BAD-01          EGM---EEEELSPFRGRSRSAPPNLCAALRYGR-ELRRMSDEFQGSF-K-
A0A667H8Z9_BAD-01      EGT---EEEEPSPFRGRSRSAPPNLWAALRYGR-ELRRMSDEFQGSF-K-
A0A673V6P8_BAD-01      EGT---EEEEPSPFRGRSRSAPPNLCAALRYGR-ELRRMSDEFQGSF-K-
A0A4W2C9A8_BAD-01      EET---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
A0A4W2C9A8_BAD-01      EET---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
F1MUT9_BAD-01          EET---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
Q3SYZ0_BAD-01          EET---EEEDLGPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHVSF-K-
A0A4U1FMC3_BAD-01      EGT---EEEEPSPFRGRSRSAPPNLWAARRYGR-ELRRMSDEFHGSF-K-
A0A2Y9EHU3_BAD-01      EGT---EEEEPSPFRGRSRSAPPNLWAAQRYGR-ELRRMSDEFHGSF-K-
A0A2I3TBK7_BAD-01      SNP---DAAKLQLDASLPVLVGSELGQG------KLRPLPVTFAPHP-E-
A0A2R8Z674_BAD-02      SNA---DAAKLQLDASLPVLVGSELGQG------KLRPLPVTFAPHP-E-
A0A2I2YFH2_BAD-03      SNA---DAAKLQLDASLPVLVGSELGQG------KLRPLPVTFAAHP-E-
Q92934_BAD-03          SNA---DAAKLQLDASLPVLVGSELGQG------KLRPLPVTFAPHP-E-
A0A2K5M0A7_BAD-02      SDA---DAAKLQLDASLPVLVGSELGQG------KLRPLPVTFAPRP-E-
A0A2K5XJR2_BAD-02      SDA---DAAKLQLDASLPVLVGSELGQG------KLRPLPVTFAPRP-E-
A0A2K6E7I4_BAD-02      SDA---DAAKLQLDASLPVLVGSELGQG------KLRTLPVTFAPRP-E-
A0A2K5PDB1_BAD-02      SNA---DAAKRQLDASHPVLVGSELGQG------RIRSLPVTFAPHP-K-
A0A2K5E6A6_BAD-02      SNA---DAAKLQLDASHPVLVGSELGQG------RLRSLPVTFAPHP-E-
A0A2K6TG62_BAD-02      SNA---DAAKLQLDASHPVLVGSELGQG------RLRSLPVTFAPHP-E-
A0A2K5HKU7_BAD-02      SEN---PSARMLTEASAGMSAPATDSEAQHAENVKLEALGL-WRPGV-A-
A0A2K6N196_BAD-02      SEN---PSARMLAEASAGMSAPATDSEAQLAENVKLEALGL-WRPGV-A-
A0A2K6PUL3_BAD-02      SEN---PSARMLAEASAGMSAPATDSEAQLAENVKLEALGL-WRPGV-A-
A0A2J8TYJ3_BAD-01      SEN---PSAGMLAEASAGMSAPAADSEAQHAENVKLEALGL-WRSGV-A-
A0A2K5M0A7_BAD-03      SEN---PSARMLAEASARMSAPATDSEAQHAENVKLKALGL-WRPGV-A-
A0A2K5XJR2_BAD-03      SEN---PSARMLAEASARMSAPATDSEAQLAENVKLKALGL-WRPGV-A-
A0A2K6E7I4_BAD-03      SEN---PSARMLAEASARMSAPATDSEAQHAENVKLKALGL-WRPAV-A-
A0A2I2YFH2_BAD-04      SEN---PSAGMLAEASAGMSAPAADSEAQHAENVKLEALGL-WRSGV-A-
Q92934_BAD-04          SEN---PSAGMLAEASAGMSAPAADSEAQHAENVKLEALGL-WRSGV-A-
A0A2I3TBK7_BAD-03      SEN---PSAGMLAEASAGMSAPAADSEAQHAENVKLEALGL-WRSGV-A-
A0A2R8Z674_BAD-03      SEN---PSAGMLAEASAGMSAPAADSEAQHAENVKLEALGL-WRSGV-A-
A0A2K5E6A6_BAD-03      SEN---PSARMLSKASAGMSAPATDS-----ENVKLE-VPC-W---V-A-
A0A2K5PDB1_BAD-03      -EN---PSARMLSKTSAGMSSPATDSEAQHTENVKLEALGL-WRPGV-A-
A0A2K6TG62_BAD-03      -EN---PSAKMLSKASAGMSAPATDSEAQHTENVKLEALEP-WRHGV-A-
A0A6F9BAV3_BAD-01      TEE---GGGDGASFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
A0A3P8YI30_BAD-02      TEE---SGGDAAPFRGRSQSAPPALWAAKKYGC-QLRRMSDEFDTWLDK-
A0A4W5R1T6_BAD-01      TEE---GGGDGAPFRSRSQSAPPALWAAKKYGR-QLRRMSDEFDTWLDK-
A0A060W8P9_BAD-01      TEE---GGGDGAPFRSRSQSAPPTLWAAKKYGR-QLRRMSDEFDTWLDK-
B5X1T1_BAD-01          TEE---GGGDGAPFRSRSQSAPPTLWAAKKYGR-QLRRMSDEFDTWLDK-
A0A673ZHY7_BAD-01      TEE---GGGDGAPFRSRSQSAPPTLWAAKKYGR-QLRRMSDEFDTWLDK-
A0A671NP27_BAD-01      DEG---DLVGSDPFRPRSRSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A672SAE4_BAD-01      DEG---DLVGGDPFRPRSRSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A672SAE4_BAD-02      DEG---DLVGGDPFRPRSRSAPPALWAAKKYGR-QLRRMSDEFDILLDK-
A0A671RUV0_BAD-01      DEG---DLVGGDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEFDILLDK-
A0A673HRQ3_BAD-01      DEG---DLVGGDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEFDILLDK-
A0A672RGH0_BAD-01      DEG---DLVGGDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEFDILLDK-
Q4V925_BAD-02          EDP---HML-GDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEF----DK-
Q4V925_BAD-03          EDP---HML-GDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEF----DK-
A7MCM4_BAD-01          EDP---HML-GDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEF----DK-
Q4V925_BAD-01          EDP---HML-GDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEF----DK-
Q4V925_BAD-04          EDP---HML-GDPFRPRSRSAPPALWAAKKYGQ-QLRRMSDEF----DK-
A0A3B3QX41_BAD-01      EEGGGVCPGDGTPFRGRSRSAPPALWAAQRYGR-QLRRMSDEFDTLLDK-
A0A3Q3RXS8_BAD-01      EAG---TPTDGAPFRGRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3Q0QNQ2_BAD-02      EIC---TPTEGDPFRRRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3Q3WTY4_BAD-01      EAG---TPTDGAPFRGRSKSAPPSLWAAKKYGQ-RLRRMSDEF----DR-
A0A3P8Y761_BAD-01      LNC---VATEGLPFRVRSQSAPPALWAAKRYGR-QLRRMSDEFDTWLDK-
A0A4W5JLL9_BAD-01      VEG---MPTDGASFRVRSQSAPPALWAAKKYGR-QLRRMSDEFDTWLDK-
A0A3B5Q2N7_BAD-01      EVG---TPTEGFPFRGRSLSAPPSLWAAKKYGR-QLRRMSDEFVNLLDK-
A0A087X8P8_BAD-01      EVG---TPTEGFPFRGRSNSAPPSLWAAKKYGR-QLRRMSDEFVNLLDK-
A0A3B3UA11_BAD-01      EVG---TPTEGFPFRGRSNSAPPSLWAAKKYGR-QLRRMSDEFVNLLDK-
A0A3B3YFR1_BAD-01      EVG---TPTEGFPFRGRSNSAPPSLWAAKKYGR-QLRRMSDEFVNLLDK-
A0A3P9Q7C3_BAD-01      EVG---TPTEGFPFRVRSNSAPPSLWAAKKYGR-QLRRMSDEFVNLLDK-
A0A3B3HDU2_BAD-01      EAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3P9KSL7_BAD-02      EAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3P9KSL7_BAD-01      EAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ-QLRRMSDEFDSLLDK-
A0A3B5BAL2_BAD-01      EAG---TPTDGAPFRGRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A665TUH3_BAD-01      EAG---TPTDGAPFRGRSKSAPPALWAAKKYGQ-KLRRMSDEFDSLLDK-
A0A674MXC1_BAD-04      EAG---TPTEGAPFRGRSRSAPPALWAAQRYGR-QLRRMSDEFDSLLDK-
A0A674MXC1_BAD-01      EAG---TPTEGAPFRGRSRSAPPALWAAQRYGR-QLRRMSDEFDSLLDK-
A0A674MXC1_BAD-02      EAG---TPTEGAPFRGRSRSAPPALWAAQRYGR-QLRRMSDEFDSLLDK-
A0A674MXC1_BAD-03      EAG---TPTEGAPFRGRSRSAPPALWAAQRYGR-QLRRMSDEFDSLLDK-
A0A671TL42_BAD-01      EAG---TPTDGAPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3Q3AEL8_BAD-01      EPG---TPTEGYPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3Q3AEL8_BAD-02      EPG---TPTEGYPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A1A8AQV0_BAD-01      EPG---TPTEGFPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
G3Q8B3_BAD-01          ETG---TPTEGAPFRVRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
A0A3Q2Y0E4_BAD-01      EVG---TPTDGAPFRGRSKSAPPVLWAAKKYGR-QLRRMSDEFDSLMDK-
A0A3Q3R5S3_BAD-01      EAG---TPTDGAPFRGRSKSAPPALWAAKKYGR-QLRRMSDEFDSLLDK-
                                                                         

Q61337_BAD-09          ------------------------------HLGSRHTHH-----------
Q2PG01_BAD-01          ------------------------------GLPRPKSAG-----------
A0A2I3H4B2_BAD-01      ------------------------------GLPRPKSAG-----------
Q92934_BAD-06          ------------------------------GLPRPKSAG-----------
Q92934_BAD-05          ------------------------------GLPRPKSAG-----------
A0A670JUY4_BAD-01      ------------------------------KLPRPKSAG-----------
A0A670YRG7_BAD-01      -------------------------------LPRPKSAG-----------
A0A3B1JLM2_BAD-01      -----------------------------GDLRRTTGPG-----------
A0A4W4DXF5_BAD-01      -----------------------------GEIRRVSSPG-----------
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          -------------------------------IPRPKSAS-----------
A0A452IFQ4_BAD-01      -------------------------------LPRPKSAG-----------
A0A674I2R9_BAD-01      -------------------------------LPRPKSAG-----------
A0A3P8YI30_BAD-01      -----------------------------GEPKRGIIPG-----------
A0A3B4DUY7_BAD-01      -----------------------------GDTRRASSPG-----------
A0A337SAW2_BAD-01      -------------------------------LPRPKSAG-----------
A0A673J9C6_BAD-01      -----------------------------G-MKRVKSAG-----------
A0A4W5JLL9_BAD-02      -----------------------------GEMRRVKSAG-----------
A0A674DKC6_BAD-01      -----------------------------GEMRRVKSAG-----------
A0A4W4HE29_BAD-01      ------------------------------GMKRARSAG-----------
A0A3B4CPH6_BAD-01      ------------------------------GMKRVRSAG-----------
A0A3Q3FKT9_BAD-01      -----------------------------GVRIKGGGGGSRGGCGLVVES
A0A3B1IH05_BAD-01      ------------------------------GMKRVRSAG-----------
A0A674AVP9_BAD-01      ------------------------------GVPKRGIIP-----------
A0A1S3L0Z2_BAD-01      ------------------------------GVPKRGIIP-----------
B5XEF1_BAD-01          ------------------------------GVPKRGIIP-----------
A0A4W5MZR2_BAD-01      ------------------------------GEPKRGISP-----------
A0A060W8W7_BAD-01      ------------------------------GEPKRGISP-----------
E7FBJ6_BAD-01          ------------------------------GVSKTP--------------
A0A673J5Q9_BAD-01      ------------------------------GEVKRA--------------
A0A671PX91_BAD-01      ------------------------------GEVKRA--------------
A0A672LB88_BAD-01      ------------------------------GEVKRA--------------
A0A673I6H5_BAD-01      ------------------------------GEVKRA--------------
A0A671SBB4_BAD-01      ------------------------------GEVKRA--------------
A0A672R7P6_BAD-01      ------------------------------GEVKRA--------------
A0A3P8Y761_BAD-02      -----------------------------GQMKRVKSAG-----------
A0A3Q2QC80_BAD-01      -----------------------------GELRKVSSAG-----------
A0A4W6EMZ7_BAD-02      -----------------------------GEMRRVKSAT-----------
A0A3Q3FKT9_BAD-02      -----------------------------GVRIKGGGGGSRGGCGLVVES
A0A3Q3FKT9_BAD-03      -----------------------------GEMKKVRSPG-----------
A0A3B5L9R9_BAD-01      -----------------------------GEMRNVSSDG-----------
A0A667ZNC6_BAD-01      -----------------------------GEMKRVRSAG-----------
A0A3P9B2E4_BAD-01      -----------------------------G--------------------
A0A668V3Q4_BAD-01      -----------------------------GEMK-----------------
I3K7B6_BAD-01          -----------------------------GEMK-----------------
A0A3Q3C680_BAD-01      -----------------------------GEMK-----------------
A0A3P8QRJ7_BAD-01      -----------------------------GEMK-----------------
A0A3Q4GGN3_BAD-01      -----------------------------GEMK-----------------
A0A3B4GXJ6_BAD-01      -----------------------------GEMK-----------------
A0A3Q2D5S0_BAD-01      -----------------------------GELRKVSSTG-----------
A0A3Q0QNQ2_BAD-01      -----------------------------G-MKKAKNAG-----------
A0A3P8WI83_BAD-02      -----------------------------G-MRKVKSAG-----------
A0A3P8WI83_BAD-01      -----------------------------G-MRKVKSAG-----------
A0A3P9HNZ2_BAD-01      -----------------------------GEMRKVRSTG-----------
A0A3B3BQF7_BAD-01      -----------------------------GEMRKVRSAG-----------
A0A672JQ68_BAD-01      -----------------------------GEMKKLRNPG-----------
A0A2U9BAC9_BAD-01      -----------------------------GEMRKVKSAG-----------
A0A4W6EMZ7_BAD-01      -----------------------------GEMRRVKSAT-----------
A0A3B4VFC5_BAD-01      -----------------------------GEMRKVKSAG-----------
A0A3B4W9T1_BAD-01      -----------------------------GEMRKVKSAG-----------
A0A3Q1K1C7_BAD-01      -----------------------------GEMRKVRSAG-----------
A0A672YF93_BAD-01      -----------------------------GEMKRVRSAG-----------
A0A3Q1GWH9_BAD-01      -----------------------------GEMKRVRSAG-----------
A0A3Q1CPU7_BAD-01      -----------------------------GEMKRVRSAG-----------
A0A3P8TWH6_BAD-01      -----------------------------GEMKRVRSAG-----------
H3D8J8_BAD-01          -----------------------------GGMRKTSSAG-----------
A0A6F9CQZ0_BAD-02      -----------------------------GEMKQLKSVG-----------
A0A6F9CA11_BAD-02      -----------------------------GEMRRVKSAG-----------
A0A1S3N9Q3_BAD-01      -----------------------------GEMRRVKSAG-----------
A0A5F8GA49_BAD-01      ------------------------------GLPRPKSAG-----------
H3ANP3_BAD-03          ------------------------------GLPRPKSAG-----------
H3ANP3_BAD-01          ------------------------------GLPRPKSAG-----------
H3ANP3_BAD-02          ------------------------------GLPRPKSAG-----------
H3ANP3_BAD-04          ------------------------------GLPRPKSAG-----------
G3VRY3_BAD-03          ------------------------------GLPRPKSAG-----------
G3VRY3_BAD-02          ------------------------------GLPRPKSAG-----------
G3VRY3_BAD-01          ------------------------------GLPRPKSAG-----------
A0A4X2KAA5_BAD-01      ------------------------------GLPRPKSAG-----------
A0A672V9F8_BAD-01      ------------------------------VLPRASSAG-----------
A0A674GQ16_BAD-01      ------------------------------VLPRPRSVG-----------
A0A6I8NVP2_BAD-01      ------------------------------GLPRPKSAG-----------
G3TP47_BAD-01          ------------------------------GLPRPKSAG-----------
Q61337_BAD-05          ------------------------------VSASVRCDG-----------
Q61337_BAD-06          ------------------------------GLPRPKSAG-----------
Q61337_BAD-03          ------------------------------GLPRPKSAG-----------
Q61337_BAD-04          ------------------------------GLPRPKSAG-----------
Q61337_BAD-02          ------------------------------G-------------------
Q61337_BAD-01          ------------------------------GLPRPKSAG-----------
A0A287CT05_BAD-01      ------------------------------GLPRPRSAG-----------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          ------------------------------GLPRPKSAG-----------
G5B6Q3_BAD-02          ------------------------------GLPRPKSAG-----------
G1P8C5_BAD-01          ------------------------------GLPRPKSAG-----------
A0A452ER54_BAD-02      ------------------------------GLPRPKSAG-----------
W5P8G9_BAD-01          ------------------------------GLPRPKSAG-----------
Q61337_BAD-07          -----------------------------------KSML-----------
H0WVR2_BAD-01          ------------------------------GLPRPKSAG-----------
A0A2K6GWV0_BAD-01      ------------------------------GLPRPKSAG-----------
F7DN67_BAD-01          ------------------------------ALPRPKSAG-----------
Q45KI9_BAD-01          ------------------------------GLPRPKSAG-----------
A0A3Q7SWS0_BAD-01      ------------------------------GLPRPKSAG-----------
B4DZQ9_BAD-01          ------------------------------GLPRPKSAG-----------
A0A2J8TYJ3_BAD-02      ------------------------------GLPRPKSAG-----------
A0A2I2YFH2_BAD-02      ------------------------------GLPRPKSAG-----------
A0A2I2YFH2_BAD-01      ------------------------------GLPRPKSAG-----------
Q92934_BAD-01          ------------------------------GLPRPKSAG-----------
Q92934_BAD-02          ------------------------------GLPRPKSAG-----------
A0A2I3TBK7_BAD-02      ------------------------------GLPRPKSAG-----------
A0A2R8Z674_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2J8TYJ3_BAD-03      ------------------------------GLPRPKSAG-----------
H0V608_BAD-01          ------------------------------GLPRPKSAG-----------
A0A2K5PDB1_BAD-01      ------------------------------GLPRPKSAG-----------
U3F2S3_BAD-01          ------------------------------GLPRPKSAG-----------
A0A2K5E6A6_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K6TG62_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K5M0A7_BAD-01      ------------------------------GLPRPKSAG-----------
A0A1D5QBW1_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K6E7I4_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K5XJR2_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K6N196_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K6PUL3_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K5HKU7_BAD-01      ------------------------------GLPRPKSAG-----------
A0A0D9R491_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2K5VCA1_BAD-01      ------------------------------GLPRPKSAG-----------
A0A4X1VE31_BAD-02      ------------------------------GLPRPKSAG-----------
A0A4X1VE31_BAD-01      SARVGLYPRVSSQWAVPFESQGLSGSEVQAPLQKAKTPG-----------
A0A287AEF3_BAD-01      ------------------------------GLPRPKSAG-----------
A0A4X1VE31_BAD-03      ------------------------------GLPRPKSAG-----------
A0A671ELU4_BAD-01      ------------------------------GLPRPKSAG-----------
A0A452ER54_BAD-01      ------------------------------GLPRPKSAG-----------
A0A452RJM6_BAD-01      ------------------------------GLPRPKSAG-----------
A0A384DJL2_BAD-01      ------------------------------GLPRPKSAG-----------
M3YNE7_BAD-01          ------------------------------GLPRPKSAG-----------
A0A667H8Z9_BAD-01      ------------------------------GLPRPKSAG-----------
A0A673V6P8_BAD-01      ------------------------------GLPRPKSAG-----------
A0A4W2C9A8_BAD-01      ------------------------------GLPRPKSAG-----------
A0A4W2C9A8_BAD-01      ------------------------------GLPRPKSAG-----------
F1MUT9_BAD-01          ------------------------------GLPRPKSAG-----------
Q3SYZ0_BAD-01          ------------------------------GLPRPKSAG-----------
A0A4U1FMC3_BAD-01      ------------------------------GLPRPNSAG-----------
A0A2Y9EHU3_BAD-01      ------------------------------GLPRPKSAG-----------
A0A2I3TBK7_BAD-01      ------------------------------TPPVPTALG-----------
A0A2R8Z674_BAD-02      ------------------------------TPPVPTALG-----------
A0A2I2YFH2_BAD-03      ------------------------------TPPVPTALG-----------
Q92934_BAD-03          ------------------------------TPPVPTALG-----------
A0A2K5M0A7_BAD-02      ------------------------------TPPALTVLV-----------
A0A2K5XJR2_BAD-02      ------------------------------TPPALTVLV-----------
A0A2K6E7I4_BAD-02      ------------------------------TPPALTVLV-----------
A0A2K5PDB1_BAD-02      ------------------------------TPPALIALS-----------
A0A2K5E6A6_BAD-02      ------------------------------TPPVPIALG-----------
A0A2K6TG62_BAD-02      ------------------------------TLPAPIALG-----------
A0A2K5HKU7_BAD-02      ------------------------------TAPTPRGRR-----------
A0A2K6N196_BAD-02      ------------------------------TAPTPRGRR-----------
A0A2K6PUL3_BAD-02      ------------------------------TAPTPRGRR-----------
A0A2J8TYJ3_BAD-01      ------------------------------TAPTPRGRR-----------
A0A2K5M0A7_BAD-03      ------------------------------TAPTPRGRR-----------
A0A2K5XJR2_BAD-03      ------------------------------TAPTPRGRR-----------
A0A2K6E7I4_BAD-03      ------------------------------TAPTPRGRR-----------
A0A2I2YFH2_BAD-04      ------------------------------TAPTPRGRR-----------
Q92934_BAD-04          ------------------------------TAPTPRGRR-----------
A0A2I3TBK7_BAD-03      ------------------------------TAPTPRGRR-----------
A0A2R8Z674_BAD-03      ------------------------------TAPTPRGRR-----------
A0A2K5E6A6_BAD-03      ------------------------------TAPTPQGRR-----------
A0A2K5PDB1_BAD-03      ------------------------------TDRTPQGRR-----------
A0A2K6TG62_BAD-03      ------------------------------TARTPQGRR-----------
A0A6F9BAV3_BAD-01      -----------------------------GEPKRGISPG-----------
A0A3P8YI30_BAD-02      -----------------------------GEPKRGIIPG-----------
A0A4W5R1T6_BAD-01      -----------------------------GEPKRGISPG-----------
A0A060W8P9_BAD-01      -----------------------------GEPKRGISPG-----------
B5X1T1_BAD-01          -----------------------------GEPKRGISPG-----------
A0A673ZHY7_BAD-01      -----------------------------GEPKRGISPG-----------
A0A671NP27_BAD-01      -----------------------------G-MKRVKSAG-----------
A0A672SAE4_BAD-01      -----------------------------G-MKRVKSAG-----------
A0A672SAE4_BAD-02      -----------------------------G-MKRVKSAG-----------
A0A671RUV0_BAD-01      -----------------------------G-MKRVKSAG-----------
A0A673HRQ3_BAD-01      -----------------------------G-MKRVKSAG-----------
A0A672RGH0_BAD-01      -----------------------------G-MKRVKSAG-----------
Q4V925_BAD-02          -----------------------------G-MKRVKSAG-----------
Q4V925_BAD-03          -----------------------------G-MKRVKSAG-----------
A7MCM4_BAD-01          -----------------------------GQMKRVKSAG-----------
Q4V925_BAD-01          -----------------------------GQMKRVKSAG-----------
Q4V925_BAD-04          -----------------------------GQMKRVKSAG-----------
A0A3B3QX41_BAD-01      -----------------------------G-MKRVRSAG-----------
A0A3Q3RXS8_BAD-01      -----------------------------GEMR-VRNAG-----------
A0A3Q0QNQ2_BAD-02      -----------------------------GMKK-AKNAG-----------
A0A3Q3WTY4_BAD-01      -----------------------------QEWK-TRSAG-----------
A0A3P8Y761_BAD-01      -----------------------------GQMKRVKSAG-----------
A0A4W5JLL9_BAD-01      -----------------------------GEMRRVKSAG-----------
A0A3B5Q2N7_BAD-01      -----------------------------GEMRNVSSDG-----------
A0A087X8P8_BAD-01      -----------------------------GEMRKVSSTG-----------
A0A3B3UA11_BAD-01      -----------------------------GEMRKVSSTG-----------
A0A3B3YFR1_BAD-01      -----------------------------GEMRKVSSTG-----------
A0A3P9Q7C3_BAD-01      -----------------------------GEMRKVSSAG-----------
A0A3B3HDU2_BAD-01      -----------------------------GEMRKVRSTG-----------
A0A3P9KSL7_BAD-02      -----------------------------GEMRKVRSTG-----------
A0A3P9KSL7_BAD-01      -----------------------------GEMRKVRSTG-----------
A0A3B5BAL2_BAD-01      -----------------------------GEMKRVRSAG-----------
A0A665TUH3_BAD-01      -----------------------------GEMRKVKSVG-----------
A0A674MXC1_BAD-04      -----------------------------GGMRKTNSTG-----------
A0A674MXC1_BAD-01      -----------------------------GGMRKTNSTG-----------
A0A674MXC1_BAD-02      -----------------------------GGMRKTNSTG-----------
A0A674MXC1_BAD-03      -----------------------------GGMRKTNSTG-----------
A0A671TL42_BAD-01      -----------------------------GEMRKVKSAG-----------
A0A3Q3AEL8_BAD-01      -----------------------------GEMRKVKSAG-----------
A0A3Q3AEL8_BAD-02      -----------------------------GEMRKVKSAG-----------
A0A1A8AQV0_BAD-01      -----------------------------GEMRKVRSAG-----------
G3Q8B3_BAD-01          -----------------------------GEMRRVKSAG-----------
A0A3Q2Y0E4_BAD-01      -----------------------------GELKFKSAGG-----------
A0A3Q3R5S3_BAD-01      -----------------------------GEMKRVRSAG-----------
                                                                         

Q61337_BAD-09          ----PVSLTAQCRASW---------------------WWGP---------
Q2PG01_BAD-01          ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2I3H4B2_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          ----TATQM-RQSSSW---------------TR-----------------
A0A670JUY4_BAD-01      ----TATQM-RRTLGW---------------KEVLQSWWRR---------
A0A670YRG7_BAD-01      ----TCSHMDRPPPSW---------------KDTLRSWWLY---------
A0A3B1JLM2_BAD-01      --------R-HTNRGW---------------FSFLWGTKEE---------
A0A4W4DXF5_BAD-01      ----KLSQK-QTNQGW---------------FSFLWCSKEE---------
Q6P7C5_BAD-01          -------------------------------TSIIFLSHVP---------
C1C3S9_BAD-01          ----AATEM-TVSKSF---------------GETFFNFFRR---------
A0A452IFQ4_BAD-01      ----TTSQL-HRGNSW---------------KETLQAWLGH---------
A0A674I2R9_BAD-01      ----TTSQL-HRGNSW---------------KETLQAWLGH---------
A0A3P8YI30_BAD-01      ------RAK-QVYRGW---------------FSFLWSPKEA---------
A0A3B4DUY7_BAD-01      --------K-QTNRGW---------------FSFLWGSKEE---------
A0A337SAW2_BAD-01      ----TATQM-RQSPSW---------------TRFIQSWWDR---------
A0A673J9C6_BAD-01      ----TTRQM-QQSPSW---------------FAFLWSHKES---------
A0A4W5JLL9_BAD-02      ----AAKQM-TKSPSW---------------WAYLFSHKET---------
A0A674DKC6_BAD-01      ----AAKQM-TKSPSW---------------WAYLFSHKET---------
A0A4W4HE29_BAD-01      ----AARQM-HTSPSW---------------FAFLWSHKES---------
A0A3B4CPH6_BAD-01      ----AARQM-HASPSW---------------FTFLWSHKES---------
A0A3Q3FKT9_BAD-01      VVSQPKSQE-FNTQLLQPHVRCVLGSLNVYKWDYLILIITL---------
A0A3B1IH05_BAD-01      ----AARQM-QNSPSW---------------FAFLWSHKES---------
A0A674AVP9_BAD-01      ----RGGKQ-KVSRGW---------------FSFLWSPKEA---------
A0A1S3L0Z2_BAD-01      ----RGGKQ-KVSRGW---------------FSFLWSPKEA---------
B5XEF1_BAD-01          ----RGGKQ-KVSRGW---------------FSFLWSPKEA---------
A0A4W5MZR2_BAD-01      ----GGGKQ-KVSRGW---------------FSFLWSPKEA---------
A0A060W8W7_BAD-01      ----GGGKQ-KVSRGW---------------FSFLWSPKEA---------
E7FBJ6_BAD-01          -----NSQK-QTYRGW---------------FSFLWSPKEE---------
A0A673J5Q9_BAD-01      -----NSQK-QTYRGW---------------FSFLWSPKEE---------
A0A671PX91_BAD-01      -----NSQK-QTYRGW---------------FSFLWSPKEE---------
A0A672LB88_BAD-01      -----NSQK-QTYRGW---------------FSFLWSSKEE---------
A0A673I6H5_BAD-01      -----NSQK-QTYRGW---------------FSFLWSSKEE---------
A0A671SBB4_BAD-01      -----NSQK-QTYRGW---------------FSFLLSSKEE---------
A0A672R7P6_BAD-01      -----NSQK-QTYRGW---------------FSFLWSSKDE---------
A0A3P8Y761_BAD-02      ----AAKQM-TTSPSW---------------WAFLFSHKET---------
A0A3Q2QC80_BAD-01      ----TNRPI-HHSRSW---------------WNYLFSHQET---------
A0A4W6EMZ7_BAD-02      ----TTRQM-HHSKSW---------------WSYLFSHQET---------
A0A3Q3FKT9_BAD-02      VVSQPKSQE-FNTQLLQPHVRCVLGSLNVYKWDYLILIITL---------
A0A3Q3FKT9_BAD-03      ----PAKQM-HHSKSW---------------WSYLFSHQET---------
A0A3B5L9R9_BAD-01      ----SNRPI-HHSRSW---------------WSYLFSHQET---------
A0A667ZNC6_BAD-01      ----TAKQM-QHSKSW---------------WNYLFSHQET---------
A0A3P9B2E4_BAD-01      -----------------------------------VRMGVS---------
A0A668V3Q4_BAD-01      -----LKKL-HHSKTW---------------WSYLFSHQET---------
I3K7B6_BAD-01          -----LKKL-HHSKTW---------------WSYLFSHQET---------
A0A3Q3C680_BAD-01      -----VKKL-HHSKTW---------------WSYLFSHQET---------
A0A3P8QRJ7_BAD-01      -----VKKL-HHSKTW---------------WSYLFSHQET---------
A0A3Q4GGN3_BAD-01      -----LKKL-HHSKTW---------------WSYLFSHQET---------
A0A3B4GXJ6_BAD-01      -----VKKL-HHSKTW---------------WSYLFSHQET---------
A0A3Q2D5S0_BAD-01      ----TNRPI-RHSKSW---------------WSYLFSHQEM---------
A0A3Q0QNQ2_BAD-01      ----TTRKM-HHSKTW---------------WSYLFSHQES---------
A0A3P8WI83_BAD-02      ----TARQM-HHSKSW---------------WSYLFSHQEL---------
A0A3P8WI83_BAD-01      ----TARQM-HHSKSW---------------WSYLFSHQEL---------
A0A3P9HNZ2_BAD-01      ----AAKQM-LHSTSW---------------WNYLFSHPEA---------
A0A3B3BQF7_BAD-01      ----ATKQM-HHSTSW---------------WNYLFSHPEA---------
A0A672JQ68_BAD-01      ----QARQI-HHSRSW---------------WSYLFSHQET---------
A0A2U9BAC9_BAD-01      ----TARQM-HHSQSW---------------WSYLFSHQEM---------
A0A4W6EMZ7_BAD-01      ----TTRQM-HHSKSW---------------WSYLFSHQET---------
A0A3B4VFC5_BAD-01      ----TAKQM-HHSKSW---------------WSYLFSHQET---------
A0A3B4W9T1_BAD-01      ----TAKQM-HHSKSW---------------WSYLFSHQET---------
A0A3Q1K1C7_BAD-01      ----TARQM-HHSKSW---------------WSYLFSHQET---------
A0A672YF93_BAD-01      ----TARQM-HHSKTW---------------WSYLFSHQEM---------
A0A3Q1GWH9_BAD-01      ----TARQM-HHSKSW---------------WSYLFSHQEM---------
A0A3Q1CPU7_BAD-01      ----TARQM-HHSKSW---------------WSYLFSHQEM---------
A0A3P8TWH6_BAD-01      ----TARQM-HHSKSW---------------WSYLFSHQEM---------
H3D8J8_BAD-01          ----SARQM-HHSRSW---------------WSYLFSHQET---------
A0A6F9CQZ0_BAD-02      ----AAKQM-TQSPSW---------------WAYLFSHQET---------
A0A6F9CA11_BAD-02      ----AAKQM-TKSPSW---------------WAYLFSHQET---------
A0A1S3N9Q3_BAD-01      ----AAKQM-TKSPSW---------------WAYLFSHKET---------
A0A5F8GA49_BAD-01      ----TASQM-RRSHGW---------------TRTVQSWFGR---------
H3ANP3_BAD-03          ----AAGEM-VDESWW---------------KKLIRSLKGR---------
H3ANP3_BAD-01          ----AAGEM-VDESWW---------------KKLIRSLKGR---------
H3ANP3_BAD-02          ----AAGEM-VDESWW---------------KKLIRSLKGR---------
H3ANP3_BAD-04          ----AAGEM-VDESWW---------------KKLIRSLKGR---------
G3VRY3_BAD-03          ----TASQM-RRSHGW---------------TRTFQSWFGR---------
G3VRY3_BAD-02          ----TASQM-RRSHGW---------------TRTFQSWFGR---------
G3VRY3_BAD-01          ----TASQM-RRSHGW---------------TRTFQSWFGR---------
A0A4X2KAA5_BAD-01      ----TASQM-RRSHGW---------------ARTFQSWLSR---------
A0A672V9F8_BAD-01      ----GA-------GGW---------------REVLRSWWGAPPPPRPRPA
A0A674GQ16_BAD-01      ----GAPP---GGGGW---------------RETLRAWWGS-RRPRPAPP
A0A6I8NVP2_BAD-01      ----TAAQL-QRPSGW---------------TRVLRSWWNR---------
G3TP47_BAD-01          ----TATQM-RQSPSW---------------TRIIQAWWDR---------
Q61337_BAD-05          ----T---------------------------------------------
Q61337_BAD-06          ----TATQM-RQSAGW---------------TRIIQSWWDR---------
Q61337_BAD-03          ----TATQM-RQSAGW---------------TRIIQSWWDR---------
Q61337_BAD-04          ----TATQM-RQSAGW---------------TRIIQSWWDR---------
Q61337_BAD-02          ------EEL-TYSLSP---------------FRCVQ--------------
Q61337_BAD-01          ----TATQM-RQSAGW---------------TRIIQSWWDR---------
A0A287CT05_BAD-01      ----TASQM-RQSSSW---------------TRFIQSWWDR---------
A0A287CT05_BAD-02      -------------------------------VTFSQSPFLR---------
G5B6Q3_BAD-01          ----TATKL-WQSSSW---------------TRAIQSWWDR---------
G5B6Q3_BAD-02          ----TATKL-WQSSSW---------------TRAIQSWWDR---------
G1P8C5_BAD-01          ----TATQM-WQKSSW---------------TRFFQSWWDR---------
A0A452ER54_BAD-02      ----TATQM-RQSPSW---------------TRFLQSWLSR---------
W5P8G9_BAD-01          ----TATQM-RQSPSW---------------TRFLQSWLSR---------
Q61337_BAD-07          ----GLAVL-IRPLSV---------------SSDLLGFPPS---------
H0WVR2_BAD-01          ----TATQM-RQSSSW---------------TRVIQSWWDR---------
A0A2K6GWV0_BAD-01      ----TATQI-RQSSSW---------------TRVIQSWWDR---------
F7DN67_BAD-01          ----TATQM-RQSPSW---------------TRAIQSWWDR---------
Q45KI9_BAD-01          ----TATQM-RQSPSW---------------TRVIQSWWDR---------
A0A3Q7SWS0_BAD-01      ----TATQM-RQSPSW---------------TRVIQSWWDR---------
B4DZQ9_BAD-01          ----TATQM-RQSPRR---------------LR-----------------
A0A2J8TYJ3_BAD-02      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2I2YFH2_BAD-02      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2I2YFH2_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
Q92934_BAD-01          ----TATQM-RQSSSW---------------TRVFQSWWDR---------
Q92934_BAD-02          ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2I3TBK7_BAD-02      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2R8Z674_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2J8TYJ3_BAD-03      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
H0V608_BAD-01          ----TATKL-WQNSNW---------------TRAIQSWWDR---------
A0A2K5PDB1_BAD-01      ----TATQM-RQSASW---------------TRVIQSWWDR---------
U3F2S3_BAD-01          ----TATQM-RQSSSW---------------TRVIQSWWDR---------
A0A2K5E6A6_BAD-01      ----TATQM-RQSSSW---------------TQVIQSWWDR---------
A0A2K6TG62_BAD-01      ----TATQM-RQSSSW---------------TRVIQSWWDR---------
A0A2K5M0A7_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A1D5QBW1_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2K6E7I4_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2K5XJR2_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2K6N196_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2K6PUL3_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2K5HKU7_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A0D9R491_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A2K5VCA1_BAD-01      ----TATQM-RQSSSW---------------TRVFQSWWDR---------
A0A4X1VE31_BAD-02      ----TATQM-RQSPSW---------------KRFLQSWWYR---------
A0A4X1VE31_BAD-01      ----FPKSL-KREAGW----------------------------------
A0A287AEF3_BAD-01      ----TATQM-RQSPSW---------------KRFLQSWWYR---------
A0A4X1VE31_BAD-03      ----TATQM-RQSPSW---------------KRFLQSWWYR---------
A0A671ELU4_BAD-01      ----TATQM-RQNSSW---------------TRIFQSLW-----------
A0A452ER54_BAD-01      ----TATQM-RQSPSW---------------TRFLQSWLSR---------
A0A452RJM6_BAD-01      ----TATQM-RQSPSW---------------TRVIQSWWDR---------
A0A384DJL2_BAD-01      ----TATQM-RQSPSW---------------TRVIQSWWDR---------
M3YNE7_BAD-01          ----TATQM-RQSPSW---------------TRVIQSWWDR---------
A0A667H8Z9_BAD-01      ----TATQM-RQSPSW---------------TRFIQSWWDR---------
A0A673V6P8_BAD-01      ----TATQM-RQSPSW---------------TRFIQSWWDR---------
A0A4W2C9A8_BAD-01      ----TATQM-RQSPSW---------------TRFLQSWLSR---------
A0A4W2C9A8_BAD-01      ----TATQM-RQSPSW---------------TRFLQSWLSR---------
F1MUT9_BAD-01          ----TATQM-RQSPSW---------------TRFLQSWLSR---------
Q3SYZ0_BAD-01          ----TATEM-RQSPSW---------------TRFLQSWLSR---------
A0A4U1FMC3_BAD-01      ----TATQM-RQSPSW---------------TRFLQSWWNR---------
A0A2Y9EHU3_BAD-01      ----TATQM-RQSPSW---------------TRFLQSWWNR---------
A0A2I3TBK7_BAD-01      ----SHLEY-GR-----------------------KYFPQA---------
A0A2R8Z674_BAD-02      ----SHLEY-GR-----------------------KYFPQA---------
A0A2I2YFH2_BAD-03      ----SHLEY-GR-----------------------KYFPQA---------
Q92934_BAD-03          ----SHLEY-GR-----------------------KYFPQA---------
A0A2K5M0A7_BAD-02      ----GHLGY-GR-----------------------KCFPQA---------
A0A2K5XJR2_BAD-02      ----GHLGY-GR-----------------------KCFPQA---------
A0A2K6E7I4_BAD-02      ----GHLGY-GR-----------------------KCFPQA---------
A0A2K5PDB1_BAD-02      ----GHLGY-GR-----------------------KCFLQ----------
A0A2K5E6A6_BAD-02      ----GHLGY-GR-----------------------KCFLQ----------
A0A2K6TG62_BAD-02      ----GHLGH-GR-----------------------KCFLQ----------
A0A2K5HKU7_BAD-02      ----RTKGW-RRSPAP---------------FGAARAPRPL---------
A0A2K6N196_BAD-02      ----RTKGW-RRSPAP---------------FGAARAPRPL---------
A0A2K6PUL3_BAD-02      ----RTKGW-RRSPAP---------------FGAARAPRPL---------
A0A2J8TYJ3_BAD-01      ----TTKGW-GRSPAP---------------FGAVRARRPP---------
A0A2K5M0A7_BAD-03      ----RTKGW-RRSPAP---------------FGAARAPRPP---------
A0A2K5XJR2_BAD-03      ----RTKGW-RRSPAP---------------FGAARAPRPP---------
A0A2K6E7I4_BAD-03      ----RTKGW-RRSPAP---------------FGAARAPRPP---------
A0A2I2YFH2_BAD-04      ----TTKGW-GRSPAP---------------FGAARARRPP---------
Q92934_BAD-04          ----TTKGW-GRSPAP---------------FGAARARRPP---------
A0A2I3TBK7_BAD-03      ----TTKGW-GRSPAP---------------FGAARARRPP---------
A0A2R8Z674_BAD-03      ----TTKGW-GRSPAP---------------FGAARARRPP---------
A0A2K5E6A6_BAD-03      ----RTKGW-RRSPAP---------------FGAVRAQHPP---------
A0A2K5PDB1_BAD-03      ----RTKGW-RRSPAP---------------FGAVRARHPP---------
A0A2K6TG62_BAD-03      ----GTKGW-RRSPAL---------------FGAVRARHPP---------
A0A6F9BAV3_BAD-01      ----GCKQ--KVSRGW---------------FSFLWSPKEA---------
A0A3P8YI30_BAD-02      ----RAKQ---VYRGW---------------FSFLWSPKEA---------
A0A4W5R1T6_BAD-01      ----GIKQ--EVSRGW---------------FSFLWSPKES---------
A0A060W8P9_BAD-01      ----GVKQ--EVSRGW---------------FSFLWSPNEA---------
B5X1T1_BAD-01          ----GVKQ--EVSRGW---------------FSFLWSPKKA---------
A0A673ZHY7_BAD-01      ----GVKQ--EVSRGW---------------FSFLWSPKKA---------
A0A671NP27_BAD-01      ----TTRQM-QQSPSW---------------FAFLWSHKES---------
A0A672SAE4_BAD-01      ----TTRQM-QQSPSW---------------FAFLWSHKES---------
A0A672SAE4_BAD-02      ----TTRQM-QQSPSW---------------FAFLWSHKES---------
A0A671RUV0_BAD-01      ----TTRQM-RQSPSW---------------LAFLWSHKES---------
A0A673HRQ3_BAD-01      ----TTRQM-RQSPSW---------------LAFLWSHKES---------
A0A672RGH0_BAD-01      ----TTRQM-RQSPSW---------------LAFLWSHKES---------
Q4V925_BAD-02          ----TARQM-SQSPSW---------------LAFLWSHKES---------
Q4V925_BAD-03          ----TARQM-SQSPSW---------------LAFLWSHKES---------
A7MCM4_BAD-01          ----TARQM-SQSPSW---------------LAFLWSHKES---------
Q4V925_BAD-01          ----TARQM-SQSPSW---------------LAFLWSHKES---------
Q4V925_BAD-04          ----TARQM-SQSPSW---------------LAFLWSHKES---------
A0A3B3QX41_BAD-01      ----AARQM-QASPSW---------------FAFLWSHKES---------
A0A3Q3RXS8_BAD-01      ----KAQKM-HHSKTW---------------WSYLFSYQET---------
A0A3Q0QNQ2_BAD-02      ----TTRKM-HHSKTW---------------WSYLFSHQES---------
A0A3Q3WTY4_BAD-01      ----TATQM-HQSRSW---------------WSYLFSHQET---------
A0A3P8Y761_BAD-01      ----AAKQM-TTSPSW---------------WAFLFSHKET---------
A0A4W5JLL9_BAD-01      ----AAKQM-TKSPSW---------------WAYLFSHKET---------
A0A3B5Q2N7_BAD-01      ----SNRPI-HHSRSW---------------WSYLFSHQET---------
A0A087X8P8_BAD-01      ----SNRPI-HHSRSW---------------WSYLFSHQET---------
A0A3B3UA11_BAD-01      ----SNRPI-HHSRSW---------------WSYLFSHQET---------
A0A3B3YFR1_BAD-01      ----SNRPI-HHSRSW---------------WSYLFSHQET---------
A0A3P9Q7C3_BAD-01      ----SNGPI-HHSRSW---------------WSYLFSHQET---------
A0A3B3HDU2_BAD-01      ----AAKQM-LHSTSW---------------WNYLFSHPEA---------
A0A3P9KSL7_BAD-02      ----AAKQM-LHSTSW---------------WNYLFSHPEA---------
A0A3P9KSL7_BAD-01      ----AAKQM-LHSTSW---------------WNYLFSHPEA---------
A0A3B5BAL2_BAD-01      ----TAKQM-HHSKSW---------------WSYLFSHQEL---------
A0A665TUH3_BAD-01      ----SAKQM-HHSKSW---------------WNYLFSHQET---------
A0A674MXC1_BAD-04      ----STKPM-HHSRSW---------------WSYLFSHQET---------
A0A674MXC1_BAD-01      ----STKPM-HHSRSW---------------WSYLFSHQET---------
A0A674MXC1_BAD-02      ----STKPM-HHSRSW---------------WSYLFSHQET---------
A0A674MXC1_BAD-03      ----STKPM-HHSRSW---------------WSYLFSHQET---------
A0A671TL42_BAD-01      ----TPKQM-HHSRSW---------------WSYLFSHQEM---------
A0A3Q3AEL8_BAD-01      ----TTKQI-HHSRSW---------------WNYLFSHQET---------
A0A3Q3AEL8_BAD-02      ----TTKQI-HHSRSW---------------WNYLFSHQET---------
A0A1A8AQV0_BAD-01      ----STKPM-HHSRSW---------------WNYLFSHQES---------
G3Q8B3_BAD-01          ----TTKQM-QHSKSW---------------WSSLFSHQEM---------
A0A3Q2Y0E4_BAD-01      ----TSRAI-HHSKTW---------------WSYLFSHQET---------
A0A3Q3R5S3_BAD-01      ----AASQM-HHSKSW---------------WSYLFSHQET---------
                                                                         

Q61337_BAD-09          --------------DSGCQNEAHSFLLLP---------------------
Q2PG01_BAD-01          --------------NLGR---------GSSAPSQ----------------
A0A2I3H4B2_BAD-01      --------------NLGR---------GSSAPSQ----------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------NSPG---------NGPRSPP----------------
A0A670YRG7_BAD-01      --------------SGSDIMALSRFSPSAPSTLN----------------
A0A3B1JLM2_BAD-01      --------------EGRE--------------------------------
A0A4W4DXF5_BAD-01      --------------EGRK--------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
C1C3S9_BAD-01          --------------KNKDRSQSENDKH-----------------------
A0A452IFQ4_BAD-01      --------------RPARDALPRSSK------------------------
A0A674I2R9_BAD-01      --------------RPARDAPPRSSK------------------------
A0A3P8YI30_BAD-01      --------------EGRD--------------------------------
A0A3B4DUY7_BAD-01      --------------EGRE--------------------------------
A0A337SAW2_BAD-01      --------------NLGRGGSAPSQ-------------------------
A0A673J9C6_BAD-01      --------------DAESRP------AE----------------------
A0A4W5JLL9_BAD-02      --------------ETEHTPTIPPRSSE----------------------
A0A674DKC6_BAD-01      --------------ETEHTPTIPPRSSE----------------------
A0A4W4HE29_BAD-01      --------------DTETSSSVTAPDTRPAE-------------------
A0A3B4CPH6_BAD-01      --------------DSEASSSLTAPDTRPAE-------------------
A0A3Q3FKT9_BAD-01      ---------------------------HSSL-------------------
A0A3B1IH05_BAD-01      --------------DSEASSS------RPAE-------------------
A0A674AVP9_BAD-01      --------------EGRE--------------------------------
A0A1S3L0Z2_BAD-01      --------------EGRE--------------------------------
B5XEF1_BAD-01          --------------EGRE--------------------------------
A0A4W5MZR2_BAD-01      --------------EGRE--------------------------------
A0A060W8W7_BAD-01      --------------EGRE--------------------------------
E7FBJ6_BAD-01          --------------EGRE--------------------------------
A0A673J5Q9_BAD-01      --------------EGRE--------------------------------
A0A671PX91_BAD-01      --------------EGRE--------------------------------
A0A672LB88_BAD-01      --------------EGRE--------------------------------
A0A673I6H5_BAD-01      --------------EGRE--------------------------------
A0A671SBB4_BAD-01      --------------EGRE--------------------------------
A0A672R7P6_BAD-01      --------------EGRE--------------------------------
A0A3P8Y761_BAD-02      --------------ETEKTPNLIITEPRSSE-------------------
A0A3Q2QC80_BAD-01      --------------EGENSHHENHAP-RTE--------------------
A0A4W6EMZ7_BAD-02      --------------EGENNHHENHTH-RTE--------------------
A0A3Q3FKT9_BAD-02      --------------HSSL--------------------------------
A0A3Q3FKT9_BAD-03      --------------EGENNHHENHTH-RNE--------------------
A0A3B5L9R9_BAD-01      --------------EGENNHHENHAS-RTE--------------------
A0A667ZNC6_BAD-01      --------------EGETSHHENHSN-RTE--------------------
A0A3P9B2E4_BAD-01      --------------QGLN--------------------------------
A0A668V3Q4_BAD-01      --------------EGENNHLENHNQ-RTE--------------------
I3K7B6_BAD-01          --------------EGENNHLENHNQ-RTE--------------------
A0A3Q3C680_BAD-01      --------------EGENNHLENHNQ-RTE--------------------
A0A3P8QRJ7_BAD-01      --------------EGENNHLENHNQ-RTE--------------------
A0A3Q4GGN3_BAD-01      --------------EGENNHLENHNQ-RTE--------------------
A0A3B4GXJ6_BAD-01      --------------EGENNHLENHNQ-RTE--------------------
A0A3Q2D5S0_BAD-01      --------------EGENSHHENHTQ-CTEQRGE----------------
A0A3Q0QNQ2_BAD-01      --------------DGENSHHENHTQ-RTE--------------------
A0A3P8WI83_BAD-02      --------------EGENNHHENHTH-RTE--------------------
A0A3P8WI83_BAD-01      --------------EGENNHHENHTH-RTE--------------------
A0A3P9HNZ2_BAD-01      --------------EGEYSHHESQ---RTE--------------------
A0A3B3BQF7_BAD-01      --------------EGEYSHHESH---RTE--------------------
A0A672JQ68_BAD-01      --------------EGENNHHENHSHDRTE--------------------
A0A2U9BAC9_BAD-01      --------------EGENNHHENHTQ-RNE--------------------
A0A4W6EMZ7_BAD-01      --------------EGENNHHENHTH-RTE--------------------
A0A3B4VFC5_BAD-01      --------------EGENNHHENHTH-RTE--------------------
A0A3B4W9T1_BAD-01      --------------EGENNHHENHTH-RTE--------------------
A0A3Q1K1C7_BAD-01      --------------EGENNHHESHTH-RTE--------------------
A0A672YF93_BAD-01      --------------EGENSHHENHKN-RTE--------------------
A0A3Q1GWH9_BAD-01      --------------EGENNHHESHTH-RNE--------------------
A0A3Q1CPU7_BAD-01      --------------EGENNHHESHTH-RNE--------------------
A0A3P8TWH6_BAD-01      --------------EGENNHHESHTH-RNE--------------------
H3D8J8_BAD-01          --------------ESENNHHD----------------------------
A0A6F9CQZ0_BAD-02      --------------ETEHSPNLTAP--EPR--------------------
A0A6F9CA11_BAD-02      --------------ETEHTSTIPPR--SSE--------------------
A0A1S3N9Q3_BAD-01      --------------ETEHTPTIPPR--SSE--------------------
A0A5F8GA49_BAD-01      --------------NLGKGGA------GPSH-------------------
H3ANP3_BAD-03          ----------------GQPRD------PPGQ-------------------
H3ANP3_BAD-01          ----------------GQPRD------PPGQQGVSIRGPD----------
H3ANP3_BAD-02          ----------------GQPRD------PPGQQGVSIRGPD----------
H3ANP3_BAD-04          ----------------GQPRD------PPGQ-------------------
G3VRY3_BAD-03          --------------NLGKGS-V-----GPSH-------------------
G3VRY3_BAD-02          --------------NLGKGS-V-----GPSH-------------------
G3VRY3_BAD-01          --------------NLGKGS-V-----GPSH-------------------
A0A4X2KAA5_BAD-01      --------------SLGKGSAA-----GPSH-------------------
A0A672V9F8_BAD-01      ATPPLTAPPRVPPPRFGGGGPRFR---GGGQ-------------------
A0A674GQ16_BAD-01      APPPDRPPPQ--KPHLGRGAPKCCREWGGGQ-------------------
A0A6I8NVP2_BAD-01      --------------SSSSAQ------------------------------
G3TP47_BAD-01          --------------NLGRGSS------APSQ-------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------NLGKGGS------TPSQ-------------------
Q61337_BAD-03          --------------NLGKGGS------TPSQ-------------------
Q61337_BAD-04          --------------NLGKGGS------TPSQ-------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------NLGKGGS------TPSQ-------------------
A0A287CT05_BAD-01      --------------NLGRRGS------APSQ-------------------
A0A287CT05_BAD-02      --------------A-----------------------------------
G5B6Q3_BAD-01          --------------NLGRGGS------APSQ-------------------
G5B6Q3_BAD-02          --------------NLGRGGS------APSQ-------------------
G1P8C5_BAD-01          --------------NSGRGGS------APSQ-------------------
A0A452ER54_BAD-02      --------------NLGRGGS------APSQ-------------------
W5P8G9_BAD-01          --------------NLGRGGS------APSQ-------------------
Q61337_BAD-07          --------------SSFVQDP------VPSPGLCLHL-------------
H0WVR2_BAD-01          --------------NVGRGGS------APCQ-------------------
A0A2K6GWV0_BAD-01      --------------NVGRGGS------APSQ-------------------
F7DN67_BAD-01          --------------NLGRGGS------APSQ-------------------
Q45KI9_BAD-01          --------------NLGRGGS------APSQ-------------------
A0A3Q7SWS0_BAD-01      --------------NLGRGGS------APSQ-------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2J8TYJ3_BAD-02      --------------NLGRGSS------APSQ-------------------
A0A2I2YFH2_BAD-02      --------------NLGRGSS------APSQ-------------------
A0A2I2YFH2_BAD-01      --------------NLGRGSS------APSQ-------------------
Q92934_BAD-01          --------------NLGRGSS------APSQ-------------------
Q92934_BAD-02          --------------NLGRGSS------APSQ-------------------
A0A2I3TBK7_BAD-02      --------------NLGRGSS------APSQ-------------------
A0A2R8Z674_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2J8TYJ3_BAD-03      --------------NLGRGSS------APSQ-------------------
H0V608_BAD-01          --------------NLGRGGS------APSQESV----------------
A0A2K5PDB1_BAD-01      --------------NLGRGGS------APSQ-------------------
U3F2S3_BAD-01          --------------NLGRGGS------APSQ-------------------
A0A2K5E6A6_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A2K6TG62_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A2K5M0A7_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A1D5QBW1_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2K6E7I4_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2K5XJR2_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2K6N196_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2K6PUL3_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2K5HKU7_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A0D9R491_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A2K5VCA1_BAD-01      --------------NLGRGSS------APSQ-------------------
A0A4X1VE31_BAD-02      --------------NSGRGGP------APSQ-------------------
A0A4X1VE31_BAD-01      --------------HLGS--------------------------------
A0A287AEF3_BAD-01      --------------NSGRGGP------APSQ-------------------
A0A4X1VE31_BAD-03      --------------NSGRGGP------APSQ-------------------
A0A671ELU4_BAD-01      -----------------RGGS------ASSQ-------------------
A0A452ER54_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A452RJM6_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A384DJL2_BAD-01      --------------NLGRGGS------APSQ-------------------
M3YNE7_BAD-01          --------------NLGRGGS------APSQ-------------------
A0A667H8Z9_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A673V6P8_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A4W2C9A8_BAD-01      --------------NLGRGGS------APSQ-------------------
A0A4W2C9A8_BAD-01      --------------NLGRGGS------APSQ-------------------
F1MUT9_BAD-01          --------------NLGRGGS------APSQ-------------------
Q3SYZ0_BAD-01          --------------NLGRGGS------APSQ-------------------
A0A4U1FMC3_BAD-01      --------------NLGRGGP------APSQ-------------------
A0A2Y9EHU3_BAD-01      --------------NLGRGGP------APSQ-------------------
A0A2I3TBK7_BAD-01      --------------YAKRGSV------LSPLEGGLTPIPFRCV-------
A0A2R8Z674_BAD-02      --------------YAKRGSV------LSPLEGGLTQIPFRCV-------
A0A2I2YFH2_BAD-03      --------------YAKRGSV------LSPLEGRLTQIPFRCV-------
Q92934_BAD-03          --------------YAKRGSV------LSPLEGGLTQIPFRCV-------
A0A2K5M0A7_BAD-02      --------------LCKRGSV------LPLSVGGLTQIPFRCM-------
A0A2K5XJR2_BAD-02      --------------SCKRGSV------LPLSVGGLTQIPFRCM-------
A0A2K6E7I4_BAD-02      --------------LCKRGSV------LPLSVGGLTQIPFRCM-------
A0A2K5PDB1_BAD-02      --------------------------------GGLTQIPFRCV-------
A0A2K5E6A6_BAD-02      --------------------------------GELTQIPFRCV-------
A0A2K6TG62_BAD-02      --------------------------------GGLTQIPFRCV-------
A0A2K5HKU7_BAD-02      --------------TSGQHSD------MAASSGG----------------
A0A2K6N196_BAD-02      --------------TSGQHSD------MAASSGG----------------
A0A2K6PUL3_BAD-02      --------------TSGQHSD------MAASSGG----------------
A0A2J8TYJ3_BAD-01      --------------ISGQHSA------MAASSGG----------------
A0A2K5M0A7_BAD-03      --------------TSGQHSV------MAASSGG----------------
A0A2K5XJR2_BAD-03      --------------TSGQHSV------MAASSGG----------------
A0A2K6E7I4_BAD-03      --------------TSGQHSV------MAASSGG----------------
A0A2I2YFH2_BAD-04      --------------TSGQHSA------MAASSGG----------------
Q92934_BAD-04          --------------TSGQHSA------MAASSGG----------------
A0A2I3TBK7_BAD-03      --------------TSGQHSA------MAASSGG----------------
A0A2R8Z674_BAD-03      --------------TSGQHSA------MAASSGG----------------
A0A2K5E6A6_BAD-03      --------------TSGQHSA------MAASSGG----------------
A0A2K5PDB1_BAD-03      --------------TSGQHSA------MAASSGG----------------
A0A2K6TG62_BAD-03      --------------TSGQHSD------MAASSGG----------------
A0A6F9BAV3_BAD-01      --------------EGR--------------E------------------
A0A3P8YI30_BAD-02      --------------EGR--------------D------------------
A0A4W5R1T6_BAD-01      --------------EGR--------------E------------------
A0A060W8P9_BAD-01      --------------EGR--------------E------------------
B5X1T1_BAD-01          --------------EGR--------------E------------------
A0A673ZHY7_BAD-01      --------------EGR--------------E------------------
A0A671NP27_BAD-01      --------------DAE----------SRPAE------------------
A0A672SAE4_BAD-01      --------------DAE----------SRPAE------------------
A0A672SAE4_BAD-02      --------------DAE----------SRPAE------------------
A0A671RUV0_BAD-01      --------------DAE----------SRPAE------------------
A0A673HRQ3_BAD-01      --------------DAE----------SRPAE------------------
A0A672RGH0_BAD-01      --------------DAE----------SRPAE------------------
Q4V925_BAD-02          --------------DAE----------SRPAE------------------
Q4V925_BAD-03          --------------DAE----------SRPAE------------------
A7MCM4_BAD-01          --------------DAE----------SRPAE------------------
Q4V925_BAD-01          --------------DAE----------SRPAE------------------
Q4V925_BAD-04          --------------DAE----------SRPAE------------------
A0A3B3QX41_BAD-01      --------------DAE-ISGSLSTADSRAAQ------------------
A0A3Q3RXS8_BAD-01      --------------DGE---NNLHENHTPRTE------------------
A0A3Q0QNQ2_BAD-02      --------------DGE---NSHHENHTQRTE------------------
A0A3Q3WTY4_BAD-01      --------------DGE---NNHHDSHTHRNE------------------
A0A3P8Y761_BAD-01      --------------ETE-KTPNLIITEPRSSE------------------
A0A4W5JLL9_BAD-01      --------------ETE-HTPTI---PPRSSE------------------
A0A3B5Q2N7_BAD-01      --------------EGE---NNHHENHASRTE------------------
A0A087X8P8_BAD-01      --------------EGE---NNHHENHASRTE------------------
A0A3B3UA11_BAD-01      --------------EGE---NNHHENHASRTE------------------
A0A3B3YFR1_BAD-01      --------------EGE---NNHHENHASRTE------------------
A0A3P9Q7C3_BAD-01      --------------EGE---NNHHENHASRTE------------------
A0A3B3HDU2_BAD-01      --------------EGE---YSHHE--SHRTE------------------
A0A3P9KSL7_BAD-02      --------------EGE---YSHHE--SHRTENRDLLGWLRCSSDITVSH
A0A3P9KSL7_BAD-01      --------------EGE---YSHHE--SHRTENRDLLGWLRCSSDITVSH
A0A3B5BAL2_BAD-01      --------------EGE---NNHHENHTHRNE------------------
A0A665TUH3_BAD-01      --------------EGE---NNHLE--SHRNE------------------
A0A674MXC1_BAD-04      --------------EGE---NGHHDGHTHRTE------------------
A0A674MXC1_BAD-01      --------------EGE---NGHHDGHTHRTE------------------
A0A674MXC1_BAD-02      --------------EGE---NGHHDGHTHRTE------------------
A0A674MXC1_BAD-03      --------------EGE---NGHHDGHTHRTE------------------
A0A671TL42_BAD-01      --------------EGE---NNHHDNHTHRTE------------------
A0A3Q3AEL8_BAD-01      --------------DGE---SSHHEKPTHRTE------------------
A0A3Q3AEL8_BAD-02      --------------DGE---SSHHEKPTHRTE------------------
A0A1A8AQV0_BAD-01      --------------DGE---NSHHDNPTQRTE------------------
G3Q8B3_BAD-01          --------------EGE---NNHHE-------------------------
A0A3Q2Y0E4_BAD-01      --------------EGENNNNNHHDNHANRTE------------------
A0A3Q3R5S3_BAD-01      --------------EGE---NTHHENAALAQEVERVVS------------
                                                                         

Q61337_BAD-09          ---------------------------------------------
Q2PG01_BAD-01          ---------------------------------------------
A0A2I3H4B2_BAD-01      ---------------------------------------------
Q92934_BAD-06          ---------------------------------------------
Q92934_BAD-05          ---------------------------------------------
A0A670JUY4_BAD-01      ---------------------------------------------
A0A670YRG7_BAD-01      ---------------------------------------------
A0A3B1JLM2_BAD-01      ---------------------------------------------
A0A4W4DXF5_BAD-01      ---------------------------------------------
Q6P7C5_BAD-01          ---------------------------------------------
C1C3S9_BAD-01          ---------------------------------------------
A0A452IFQ4_BAD-01      ---------------------------------------------
A0A674I2R9_BAD-01      ---------------------------------------------
A0A3P8YI30_BAD-01      ---------------------------------------------
A0A3B4DUY7_BAD-01      ---------------------------------------------
A0A337SAW2_BAD-01      ---------------------------------------------
A0A673J9C6_BAD-01      ---------------------------------------------
A0A4W5JLL9_BAD-02      ---------------------------------------------
A0A674DKC6_BAD-01      ---------------------------------------------
A0A4W4HE29_BAD-01      ---------------------------------------------
A0A3B4CPH6_BAD-01      ---------------------------------------------
A0A3Q3FKT9_BAD-01      ---------------------------------------------
A0A3B1IH05_BAD-01      ---------------------------------------------
A0A674AVP9_BAD-01      ---------------------------------------------
A0A1S3L0Z2_BAD-01      ---------------------------------------------
B5XEF1_BAD-01          ---------------------------------------------
A0A4W5MZR2_BAD-01      ---------------------------------------------
A0A060W8W7_BAD-01      ---------------------------------------------
E7FBJ6_BAD-01          ---------------------------------------------
A0A673J5Q9_BAD-01      ---------------------------------------------
A0A671PX91_BAD-01      ---------------------------------------------
A0A672LB88_BAD-01      ---------------------------------------------
A0A673I6H5_BAD-01      ---------------------------------------------
A0A671SBB4_BAD-01      ---------------------------------------------
A0A672R7P6_BAD-01      ---------------------------------------------
A0A3P8Y761_BAD-02      ---------------------------------------------
A0A3Q2QC80_BAD-01      ---------------------------------------------
A0A4W6EMZ7_BAD-02      ---------------------------------------------
A0A3Q3FKT9_BAD-02      ---------------------------------------------
A0A3Q3FKT9_BAD-03      ---------------------------------------------
A0A3B5L9R9_BAD-01      ---------------------------------------------
A0A667ZNC6_BAD-01      ---------------------------------------------
A0A3P9B2E4_BAD-01      ---------------------------------------------
A0A668V3Q4_BAD-01      ---------------------------------------------
I3K7B6_BAD-01          ---------------------------------------------
A0A3Q3C680_BAD-01      ---------------------------------------------
A0A3P8QRJ7_BAD-01      ---------------------------------------------
A0A3Q4GGN3_BAD-01      ---------------------------------------------
A0A3B4GXJ6_BAD-01      ---------------------------------------------
A0A3Q2D5S0_BAD-01      ---------------------------------------------
A0A3Q0QNQ2_BAD-01      ---------------------------------------------
A0A3P8WI83_BAD-02      ---------------------------------------------
A0A3P8WI83_BAD-01      ---------------------------------------------
A0A3P9HNZ2_BAD-01      ---------------------------------------------
A0A3B3BQF7_BAD-01      ---------------------------------------------
A0A672JQ68_BAD-01      ---------------------------------------------
A0A2U9BAC9_BAD-01      ---------------------------------------------
A0A4W6EMZ7_BAD-01      ---------------------------------------------
A0A3B4VFC5_BAD-01      ---------------------------------------------
A0A3B4W9T1_BAD-01      ---------------------------------------------
A0A3Q1K1C7_BAD-01      ---------------------------------------------
A0A672YF93_BAD-01      ---------------------------------------------
A0A3Q1GWH9_BAD-01      ---------------------------------------------
A0A3Q1CPU7_BAD-01      ---------------------------------------------
A0A3P8TWH6_BAD-01      ---------------------------------------------
H3D8J8_BAD-01          ---------------------------------------------
A0A6F9CQZ0_BAD-02      ---------------------------------------------
A0A6F9CA11_BAD-02      ---------------------------------------------
A0A1S3N9Q3_BAD-01      ---------------------------------------------
A0A5F8GA49_BAD-01      ---------------------------------------------
H3ANP3_BAD-03          ---------------------------------------------
H3ANP3_BAD-01          ---------------------------------------------
H3ANP3_BAD-02          ---------------------------------------------
H3ANP3_BAD-04          ---------------------------------------------
G3VRY3_BAD-03          ---------------------------------------------
G3VRY3_BAD-02          ---------------------------------------------
G3VRY3_BAD-01          ---------------------------------------------
A0A4X2KAA5_BAD-01      ---------------------------------------------
A0A672V9F8_BAD-01      ---------------------------------------------
A0A674GQ16_BAD-01      ---------------------------------------------
A0A6I8NVP2_BAD-01      ---------------------------------------------
G3TP47_BAD-01          ---------------------------------------------
Q61337_BAD-05          ---------------------------------------------
Q61337_BAD-06          ---------------------------------------------
Q61337_BAD-03          ---------------------------------------------
Q61337_BAD-04          ---------------------------------------------
Q61337_BAD-02          ---------------------------------------------
Q61337_BAD-01          ---------------------------------------------
A0A287CT05_BAD-01      ---------------------------------------------
A0A287CT05_BAD-02      ---------------------------------------------
G5B6Q3_BAD-01          ---------------------------------------------
G5B6Q3_BAD-02          ---------------------------------------------
G1P8C5_BAD-01          ---------------------------------------------
A0A452ER54_BAD-02      ---------------------------------------------
W5P8G9_BAD-01          ---------------------------------------------
Q61337_BAD-07          ---------------------------------------------
H0WVR2_BAD-01          ---------------------------------------------
A0A2K6GWV0_BAD-01      ---------------------------------------------
F7DN67_BAD-01          ---------------------------------------------
Q45KI9_BAD-01          ---------------------------------------------
A0A3Q7SWS0_BAD-01      ---------------------------------------------
B4DZQ9_BAD-01          ---------------------------------------------
A0A2J8TYJ3_BAD-02      ---------------------------------------------
A0A2I2YFH2_BAD-02      ---------------------------------------------
A0A2I2YFH2_BAD-01      ---------------------------------------------
Q92934_BAD-01          ---------------------------------------------
Q92934_BAD-02          ---------------------------------------------
A0A2I3TBK7_BAD-02      ---------------------------------------------
A0A2R8Z674_BAD-01      ---------------------------------------------
A0A2J8TYJ3_BAD-03      ---------------------------------------------
H0V608_BAD-01          ---------------------------------------------
A0A2K5PDB1_BAD-01      ---------------------------------------------
U3F2S3_BAD-01          ---------------------------------------------
A0A2K5E6A6_BAD-01      ---------------------------------------------
A0A2K6TG62_BAD-01      ---------------------------------------------
A0A2K5M0A7_BAD-01      ---------------------------------------------
A0A1D5QBW1_BAD-01      ---------------------------------------------
A0A2K6E7I4_BAD-01      ---------------------------------------------
A0A2K5XJR2_BAD-01      ---------------------------------------------
A0A2K6N196_BAD-01      ---------------------------------------------
A0A2K6PUL3_BAD-01      ---------------------------------------------
A0A2K5HKU7_BAD-01      ---------------------------------------------
A0A0D9R491_BAD-01      ---------------------------------------------
A0A2K5VCA1_BAD-01      ---------------------------------------------
A0A4X1VE31_BAD-02      ---------------------------------------------
A0A4X1VE31_BAD-01      ---------------------------------------------
A0A287AEF3_BAD-01      ---------------------------------------------
A0A4X1VE31_BAD-03      ---------------------------------------------
A0A671ELU4_BAD-01      ---------------------------------------------
A0A452ER54_BAD-01      ---------------------------------------------
A0A452RJM6_BAD-01      ---------------------------------------------
A0A384DJL2_BAD-01      ---------------------------------------------
M3YNE7_BAD-01          ---------------------------------------------
A0A667H8Z9_BAD-01      ---------------------------------------------
A0A673V6P8_BAD-01      ---------------------------------------------
A0A4W2C9A8_BAD-01      ---------------------------------------------
A0A4W2C9A8_BAD-01      ---------------------------------------------
F1MUT9_BAD-01          ---------------------------------------------
Q3SYZ0_BAD-01          ---------------------------------------------
A0A4U1FMC3_BAD-01      ---------------------------------------------
A0A2Y9EHU3_BAD-01      ---------------------------------------------
A0A2I3TBK7_BAD-01      ---------------------------------------------
A0A2R8Z674_BAD-02      ---------------------------------------------
A0A2I2YFH2_BAD-03      ---------------------------------------------
Q92934_BAD-03          ---------------------------------------------
A0A2K5M0A7_BAD-02      ---------------------------------------------
A0A2K5XJR2_BAD-02      ---------------------------------------------
A0A2K6E7I4_BAD-02      ---------------------------------------------
A0A2K5PDB1_BAD-02      ---------------------------------------------
A0A2K5E6A6_BAD-02      ---------------------------------------------
A0A2K6TG62_BAD-02      ---------------------------------------------
A0A2K5HKU7_BAD-02      ---------------------------------------------
A0A2K6N196_BAD-02      ---------------------------------------------
A0A2K6PUL3_BAD-02      ---------------------------------------------
A0A2J8TYJ3_BAD-01      ---------------------------------------------
A0A2K5M0A7_BAD-03      ---------------------------------------------
A0A2K5XJR2_BAD-03      ---------------------------------------------
A0A2K6E7I4_BAD-03      ---------------------------------------------
A0A2I2YFH2_BAD-04      ---------------------------------------------
Q92934_BAD-04          ---------------------------------------------
A0A2I3TBK7_BAD-03      ---------------------------------------------
A0A2R8Z674_BAD-03      ---------------------------------------------
A0A2K5E6A6_BAD-03      ---------------------------------------------
A0A2K5PDB1_BAD-03      ---------------------------------------------
A0A2K6TG62_BAD-03      ---------------------------------------------
A0A6F9BAV3_BAD-01      ---------------------------------------------
A0A3P8YI30_BAD-02      ---------------------------------------------
A0A4W5R1T6_BAD-01      ---------------------------------------------
A0A060W8P9_BAD-01      ---------------------------------------------
B5X1T1_BAD-01          ---------------------------------------------
A0A673ZHY7_BAD-01      ---------------------------------------------
A0A671NP27_BAD-01      ---------------------------------------------
A0A672SAE4_BAD-01      ---------------------------------------------
A0A672SAE4_BAD-02      ---------------------------------------------
A0A671RUV0_BAD-01      ---------------------------------------------
A0A673HRQ3_BAD-01      ---------------------------------------------
A0A672RGH0_BAD-01      ---------------------------------------------
Q4V925_BAD-02          ---------------------------------------------
Q4V925_BAD-03          ---------------------------------------------
A7MCM4_BAD-01          ---------------------------------------------
Q4V925_BAD-01          ---------------------------------------------
Q4V925_BAD-04          ---------------------------------------------
A0A3B3QX41_BAD-01      ---------------------------------------------
A0A3Q3RXS8_BAD-01      ---------------------------------------------
A0A3Q0QNQ2_BAD-02      ---------------------------------------------
A0A3Q3WTY4_BAD-01      ---------------------------------------------
A0A3P8Y761_BAD-01      ---------------------------------------------
A0A4W5JLL9_BAD-01      ---------------------------------------------
A0A3B5Q2N7_BAD-01      ---------------------------------------------
A0A087X8P8_BAD-01      ---------------------------------------------
A0A3B3UA11_BAD-01      ---------------------------------------------
A0A3B3YFR1_BAD-01      ---------------------------------------------
A0A3P9Q7C3_BAD-01      ---------------------------------------------
A0A3B3HDU2_BAD-01      ---------------------------------------------
A0A3P9KSL7_BAD-02      VTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQR-----------
A0A3P9KSL7_BAD-01      VTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQARQNFLEPSIRT
A0A3B5BAL2_BAD-01      ---------------------------------------------
A0A665TUH3_BAD-01      ---------------------------------------------
A0A674MXC1_BAD-04      ---------------------------------------------
A0A674MXC1_BAD-01      ---------------------------------------------
A0A674MXC1_BAD-02      ---------------------------------------------
A0A674MXC1_BAD-03      ---------------------------------------------
A0A671TL42_BAD-01      ---------------------------------------------
A0A3Q3AEL8_BAD-01      ---------------------------------------------
A0A3Q3AEL8_BAD-02      ---------------------------------------------
A0A1A8AQV0_BAD-01      ---------------------------------------------
G3Q8B3_BAD-01          ---------------------------------------------
A0A3Q2Y0E4_BAD-01      ---------------------------------------------
A0A3Q3R5S3_BAD-01      ---------------------------------------------
                                                                    

© 1998-2022Legal notice