Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

214 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      ---------------------------------------MGTPENPLSAP
A0A673J9C6_BAD-01      --------------MKTYRSVGPMQLVSVLSISRRIR------------S
A0A4W5JLL9_BAD-02      -------------------MLSPSP-------------PLPFPTYPLSLS
A0A674DKC6_BAD-01      SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLP-LPLSLS
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      THVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR-----------
A0A673J9C6_BAD-01      CSAAVSALAIFHNLATTVYAHDALLRTQRPPERERKRER-------GKIL
A0A4W5JLL9_BAD-02      ASPPVS----------------------------------------FPLS
A0A674DKC6_BAD-01      ASPSSSPLLCLSPSSLSCLSLSSLSSPLSPPSPLSLSLPLLLPSPLSPLS
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTV--------------PVAQATRAGLPQY
A0A673J9C6_BAD-01      ELLLPCSVSCTVCELEVNCSCAATPHNTGACQDSSRNPNRA---------
A0A4W5JLL9_BAD-02      TSLFPSLSTSPLSLCPLSFISLY--------------PLSPHLFPLSL--
A0A674DKC6_BAD-01      SLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSS
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      WREAAGPG------------------------------------------
A0A673J9C6_BAD-01      -SESKHPD-----------TQITRKTVRRTP-------------------
A0A4W5JLL9_BAD-02      -HPSSPPS-----------HSFLVSPLSLTP-------------------
A0A674DKC6_BAD-01      PSPLSPPSPLSLPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFS
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      ------------------------------------------------MY
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          ---------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGS
A0A3B1JLM2_BAD-01      ------------MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDT
A0A4W4DXF5_BAD-01      ------------MHNQYLLRLRKANFTRED--YKKVIKAKTLREEG--ET
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      --------------------------------------------------
A0A673J9C6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      --------------------------------------------------
A0A674DKC6_BAD-01      LSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLTAFLFPL
A0A3P8YI30_BAD-01      ----------------------------------MFYSFCHSPCDECFLT
A0A3B4DUY7_BAD-01      -----------------------MSNQYLQKLRRARFNCEEERYKKVIKT
A0A4W4HE29_BAD-01      -------------MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSY
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      -----------------MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLN
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      ------MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENK
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      -------------------------------------------------M
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      ------------------------------------------------MN
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      RNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQF
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      ----------------------------------------MSTAARAAAG
A0A5F8GA49_BAD-01      --------MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESE
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G3VRY3_BAD-03          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          ------------------GPPENPSPASTHAQGVRMSGAEHPEKK-----
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-02          -----------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGG
Q61337_BAD-01          -----------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGG
A0A287CT05_BAD-01      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
A0A287CT05_BAD-02      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
G5B6Q3_BAD-01          -----------------MRTPENPSPAPTNAEGLRKLELGIRRLES----
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          ---------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGS
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      -------------------------MGSSGGKKLWLARPSPSTEEPLPLP
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A4X1VE31_BAD-03      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      ---------------------------MGTPENPSAAPTTRKLSIRRRRR
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      ------------------------------------------MAIINTII
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          DAGGRRWRPAAQSMFQI--PEF-EPSEQEDA--------STTDRGLGPSL
A0A3B1JLM2_BAD-01      LFRPLCWNSSGSTVFTM---EKTPPHSKEDD------ISPIDDHDESRWS
A0A4W4DXF5_BAD-01      PSNTSCWNPFRVTAFTM---EKA-PCGQRDD------ISALDDQDESRWS
A0A452IFQ4_BAD-01      -------------MFRI--QEF--PDEVFPG--------RGKEAPAPPES
A0A674I2R9_BAD-01      -------------MFRI--QEF--PDEVFPG--------RGKESPLPPES
C1C3S9_BAD-01          -----MGDSPHKSMFSI--EEF--PPTE-RG--------SAFSGTNPPGF
A0A6I8PXS6_BAD-01      -----MADSSPSAVFKL--EEF--DNEE-QG--------LPLPFVDPPRG
A0A337SAW2_BAD-01      --QGPRDRAWAQSMFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A673J9C6_BAD-01      --TDSRNRLIMAQMFSI--SDN-ESD-TETS--------EDCEDSDLTKN
A0A4W5JLL9_BAD-02      LPPSSSVDVSMAQMFTI--SDS-ESEPSEEV--------GETEKDQLAAG
A0A674DKC6_BAD-01      LTSSSSVDVSMAQMFTI--SDS-ESEPSEEV--------GETEKDQSSAG
A0A3P8YI30_BAD-01      ICNAFGQCLLRMDVFSLQAFKM---DHTQDCVGDIPENINEKYDLDHLGT
A0A3B4DUY7_BAD-01      LTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQDESNWS-ETVKN
A0A4W4HE29_BAD-01      REFTSAAGQLSEVVFTM--AQMFTISDTESD--------TSEGPGDTDQQ
A0A3B4CPH6_BAD-01      ----------MAHMFTL--SDDSDTSEDLGD---------------ADQP
A0A674AVP9_BAD-01      ---------------MD-HTHDCVDECESDH--------SGTTHNSEFQ-
A0A1S3L0Z2_BAD-01      ---------------MD-YTHDCVDECESDH--------SGTTRNSEFQ-
B5XEF1_BAD-01          ---------------MD-YTHDCVDECESDH--------SGTTRNSEFQ-
A0A4W5MZR2_BAD-01      ---------------MD-HTHDCVDECESDH--------SGTTHNSEFQ-
A0A060W8W7_BAD-01      ---------------MD-HIHDCVDECESDH--------SGTTHNSEFQ-
E7FBJ6_BAD-01          ----------MENTSHD-HQDDSSTLDEKER--------SHLKGTIKNH-
A0A673J5Q9_BAD-01      ----------MDNTLHD-HQDDSSTWNDKKK--------GR-EETIKNQ-
A0A671PX91_BAD-01      ----------MDNTLHD-HQDDSSTWNDKKK--------GR-EETIKNQ-
A0A672LB88_BAD-01      ----------MDNTLHD-HQDDSSTWNDKKK--------GR-EETIKNQ-
A0A673I6H5_BAD-01      ----------MDKRLHG-HQYDSSTLNDKKK--------GR-EETINTH-
A0A671SBB4_BAD-01      ----------MDKRLHD-HQNDSSTLNDKKK--------GR-EETINTH-
A0A672R7P6_BAD-01      ----------MDKRLHD-HRNDSSTLNDRKK--------GR-EETINTR-
A0A3P8Y761_BAD-02      -MGCSTPYRNGISTSTILPHTTGTGDRLLPY--------GLFCLITIGTR
A0A3B5L9R9_BAD-01      ----------MDTKFTI-SDGESDPSEDVEE--------RGDLQLMQEK-
H3D8J8_BAD-01          ----------MAAKFSLCSDSDSEPSEEVEE--------GERGSFSTS--
A0A6F9CQZ0_BAD-02      -------------MFTI-SDCKSEPSE-VGE--------TEKDKSAAGQ-
A0A6F9CA11_BAD-02      ----------MAQMFTI-SDSESEPSEDVGE--------TETDQSAAGK-
A0A1S3N9Q3_BAD-01      ----------MAQIFTI-SDSE---SEEVGE--------TENDQSSAGK-
A0A3Q2QC80_BAD-01      FPNSCLPDDTMAAKFTI-SDSDSEPPEEVEE--------EGNDQPADGK-
A0A3Q3FKT9_BAD-02      ----------MAAKFTI-SDSESGSEEEVKE--------EENDQSSAVE-
A0A3Q3FKT9_BAD-03      ISCLGVLDVTMAAKFTI-SDSESGSEEEVKE--------EENDQSSAVE-
A0A667ZNC6_BAD-01      -----------MASFTI-SDGESDPSEEVGE--------SETDKSLNHQ-
A0A3P9B2E4_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A668V3Q4_BAD-01      ----------MAANFTI-SDSESETSEEVGE--------EENQQPAGQD-
I3K7B6_BAD-01          ----------MAANFTI-SDSESETSEEVGE--------EENQQPAGQD-
A0A3Q3C680_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------EENQQSAGQA-
A0A3P8QRJ7_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A3Q4GGN3_BAD-01      ----------MAANFKI-SDSDSETSEEVGE--------GENQQSARQV-
A0A3B4GXJ6_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A3Q2D5S0_BAD-01      AQSVETSDPIMAATFTI-SDSDTEPSEEVEE--------TRNKEPRIRN-
A0A3Q0QNQ2_BAD-01      ----------FIHFLPF-IQGRGQQPSHLLQ--------LIWGTPRHSQ-
A0A3P8WI83_BAD-01      ----------MAAQFTI-SDSESEPEEEVEG--------GKIKHSLNDP-
A0A3P8WI83_BAD-02      VEVSIFPDVTMAAQFTI-SDSESEPEEEVEG--------GKIKHSLNDP-
A0A3P9HNZ2_BAD-01      ----------MAAKFTI-SD-DSESSEEVEG--------GKLDLGAAGG-
A0A3B3BQF7_BAD-01      ----------MAAKFSI-SDNDSESSEEVEG--------GRLDLAASGGE
A0A4W6EMZ7_BAD-02      LLNLPSPDVTMAANFTI-SDSESEASEEVEE--------GEMNQSSTEQ-
A0A672JQ68_BAD-01      ----------MAAKFSI-SDSESEPSEEVEE--------EETNE--TPA-
A0A2U9BAC9_BAD-01      ----------MAANFTI-SDSESEPSEEVEE--------GEVSQPWTGP-
A0A4W6EMZ7_BAD-01      ----------MAANFTI-SDSESEASEEVEE--------GEMNQSSTEQ-
A0A3B4VFC5_BAD-01      ----------MAANFTI-SDSESEPSEEVDE--------GEMSQSLTGQ-
A0A3B4W9T1_BAD-01      ----------MAANFTI-SDSESEPSEEVDE--------GEMSQSLTGQ-
A0A3Q1K1C7_BAD-01      ----------MAARFTI-SDSDSDPSEGMEE--------EGHNQSPPGQ-
A0A672YF93_BAD-01      ----------MAAKFTI-SDSESEPSEDLEE--------EQRRQPPTEQ-
A0A3Q1GWH9_BAD-01      ----------MAAKFSI-SDGDSEPEE--VE--------GENNHSPATE-
A0A3Q1CPU7_BAD-01      ----------MAAKFTI-SDSESEPSEEVEE--------GENNHSPATQ-
A0A3P8TWH6_BAD-01      ----------MAAKFTI-SDSESEPSEEVEE--------GENNHSPATQ-
A0A3Q3FKT9_BAD-01      -MTLTASDVTMAAKFTI--SDSESGSEEEVK-----------EEENDQSS
A0A3B1IH05_BAD-01      TCDSTAVSQPSKLDFTM--DHMFTISDESD---------ASEELGDSDQP
A0A5F8GA49_BAD-01      TPSWPDDASRPVSMFQI--PEF-EPGEQEDG----------------SER
H3ANP3_BAD-03          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-04          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-01          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-02          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
G3VRY3_BAD-01          -------------MFQI--SEF-EPSE--------------------PGE
G3VRY3_BAD-02          -------------MFQI--SEF-EPSE--------------------PGE
G3VRY3_BAD-03          -------------MFQI--SEF-EPSE--------------------PGE
A0A4X2KAA5_BAD-01      -----------MSMFQI--SEF-EPSEQETP--------KEDGFAYAPGE
A0A672V9F8_BAD-01      ----------------M--GGPCEVVGCSPP--------VP------PSA
A0A674GQ16_BAD-01      -------------MLRL--DETPEDRGSPPP--------SPWGGSPSPSQ
A0A6I8NVP2_BAD-01      -------------MFQI--PEF-EPSERGDV--------CTP--GGDPSQ
G3TP47_BAD-01          -KGRRRSSGGLQSMFQI--PEF-EQSDREDS--------TPADRGLGPSP
Q61337_BAD-05          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-04          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-06          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-03          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-02          RRWRPA----AQSMFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-01          RRWRPA----AQSMFQI--PEF-EPSEQEDA--------SATDRGLGPSL
A0A287CT05_BAD-01      GRRRGWHPAWTQSMFQI--PEF-EPSEQEDS--------SSAEGGLGPSP
A0A287CT05_BAD-02      GRRRGWHPAWTQSMFQI--PEF-EPSEQEDS--------SSAEGGLGPSP
G5B6Q3_BAD-01          ----------AQSMFQI--PEF-EPSEQEDS--------SSEERALGPTP
G5B6Q3_BAD-02          -------------MFQI--PEF-EPSEQEDS--------SSEERALGPTP
A0A2I3TBK7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-03          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5XJR2_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A096MLD5_BAD-03      -------------MFQI--PEF-EPSEQEDS--------RSAERGLGPSP
A0A2K6E7I4_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5PDB1_BAD-02      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
A0A2K5E6A6_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K6TG62_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5HKU7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6N196_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6PUL3_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5XJR2_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A096MLD5_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6E7I4_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-04      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-04          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I3TBK7_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5E6A6_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5PDB1_BAD-03      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
A0A2K6TG62_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
G1P8C5_BAD-01          --------PTAQSMFQI--PEF-EHSEQEDS--------SPADRGLGPCP
A0A452ER54_BAD-02      ------YRAWAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
W5P8G9_BAD-01          --QGPRYRAWAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
Q61337_BAD-07          --------------XQI--PEF-EPSEQEDA--------SATDRGLGPSL
O35147_BAD-01          DAGGRRWRPAAQSMFQI--PEF-EPSEQEDA--------STTDRGLGPSL
F7DN67_BAD-01          -------------MFQI--PEF-EQSEPEDS--------SPADRGLGPSP
Q45KI9_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPANRGLGPSP
A0A3Q7SWS0_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPANRGLGPSP
H0WVR2_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSSDRGLGPSP
A0A2K6GWV0_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAGRGLGPSP
H0V608_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSEERGLGPSP
A0A2K5PDB1_BAD-01      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
U3F2S3_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5E6A6_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K6TG62_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5M0A7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A1D5QBW1_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6E7I4_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5XJR2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A096MLD5_BAD-04      -------------MFQI--PEF-EPSEQEDS--------RSAERGLGPSP
A0A2K6N196_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6PUL3_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5HKU7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A0D9R491_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5VCA1_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
B4DZQ9_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A096MLD5_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-02          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I3TBK7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2J8TYJ3_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A4X1VE31_BAD-01      STGNRGPSLRAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-02      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A287AEF3_BAD-01      GRGRSRSGPASQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-03      GRGRSRQGYLSQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A671ELU4_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A452ER54_BAD-01      ESGGRQWAGPRGSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
G1MI17_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A452RJM6_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A384DJL2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
M3YNE7_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A667H8Z9_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A673V6P8_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A4W2C9A8_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4W2C9A8_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
F1MUT9_BAD-01          -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
Q3SYZ0_BAD-01          -------------MFQI--PEF-EQSEQEDS--------SRADRGLGPSP
A0A4U1FMC3_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A2Y9EHU3_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------MAFKMDHTQ--DCVGDIPENINE--------KYDLDHLGTTH
A0A4W5R1T6_BAD-01      HCGCPFSLQIFTMNHTH--DCVDDNPETMNE--------KDESDHSGTTH
A0A060W8P9_BAD-01      ------------MNHTH--DCVDDNPETMNE--------QDESDHSGTTH
B5X1T1_BAD-01          ------------MDHTH--DCVDDNPETMNE--------HDESDHSGTTH
A0A673ZHY7_BAD-01      ------------MDHTH--DCVDDNPETMNE--------QDESDHSGTTH
A0A671NP27_BAD-01      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A672SAE4_BAD-01      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A672SAE4_BAD-02      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A671RUV0_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQAKNNS
A0A673HRQ3_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQVKNNS
A0A672RGH0_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQVKNNS
Q4V925_BAD-03          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
Q4V925_BAD-02          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
A7MCM4_BAD-01          ----------MAHMFNI--SD-DSETETMED--------SEASSLDKHKS
Q4V925_BAD-01          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
Q4V925_BAD-04          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
A0A3B3QX41_BAD-01      -----MSGVTMAHMFTI--SG-NESDTSESD--------TPDVTANSQLG
A0A3Q3RXS8_BAD-01      ----------MAAKFS---IS-ESESDSSEE--------VEGGKQKKSSA
A0A3Q0QNQ2_BAD-02      -------------------MP-EPPRLVLFD--------VEEGQSPFREG
A0A3Q3WTY4_BAD-01      ----------MATNFTI--SS-DSESELSEE--------IEEGENSQLQT
A0A3P8Y761_BAD-01      ----------MENIFTI---S-DTESESSDV----------EETKKEWIA
A0A4W5JLL9_BAD-01      ----------MAQMFTI---S-DSESEPSEE--------VGETEKDQLAA
A0A3B5Q2N7_BAD-01      ----------MDTKFTI---S-DGESDPSED--------VEERGDLQLMQ
A0A087X8P8_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3UA11_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3YFR1_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3P9Q7C3_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3HDU2_BAD-01      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3P9KSL7_BAD-02      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3P9KSL7_BAD-01      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3B5BAL2_BAD-01      ----------MAAQFSI---S-GSESDP-EE--------VEEGENNHPPA
A0A665TUH3_BAD-01      ----------MSAQFTI---S-DSESDPSEE--------VEEGDMSQSL-
A0A674MXC1_BAD-04      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-01      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-02      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-03      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A671TL42_BAD-01      ----------MAANFTI--SS-ESDSEPSEE--------VEEGEHSQSPA
A0A3Q3AEL8_BAD-02      ----------MAAKFTI---S-DSESEPSDE--------VEEGKSKQPAA
A0A3Q3AEL8_BAD-01      ----------MAAKFTI---S-DSESEPSDE--------VEEGKSKQPAA
A0A1A8AQV0_BAD-01      ----------MAAHFTI---S-DSDSEPSEE--------VEEGEKKQPSA
G3Q8B3_BAD-01          ----------MAAHFTI---S-DSESEPSDG--------VEEREDGQLSS
A0A3Q2Y0E4_BAD-01      ----------MAANFSI---S-DSESEPSEE--------VEEGDDGQGAA
A0A3Q3R5S3_BAD-01      ----------MAANFTI---S-DSESESSEE--------VEEGKHSQSST
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      -----------------------------------LEF------------
A0A670YRG7_BAD-01      -----------------------------------LELRRR---------
Q6P7C5_BAD-01          TEDQP-------GPYLAPGLLGSI----VQQQPGQAANNSH---------
A0A3B1JLM2_BAD-01      EAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVR-LYSESQ---------
A0A4W4DXF5_BAD-01      ETIESDDSPRISNHHIMPNNTAT----EVGGRVR-LYSESQ---------
A0A452IFQ4_BAD-01      QRGHTPGSKQPDT----PT---------AEVRSR-IGSDTP---------
A0A674I2R9_BAD-01      QRGHTPGSKQPDT----PT---------AEVRSR-IGSDPP---------
C1C3S9_BAD-01          GG--DPGHKSSPNLRRIKG---------KETRQR-TESASE---------
A0A6I8PXS6_BAD-01      AGVRQPVAKSSPSLRRYPG---------KESRLR-TESASE---------
A0A337SAW2_BAD-01      TGDRP--RGPGKHQRTTPG--LLGE--AGHQQGQ-PASSNH---------
A0A673J9C6_BAD-01      NS-GS--QQKTNHDLAVPD-RLKGEQLGRHR-NL-SMNDED---------
A0A4W5JLL9_BAD-02      KG-MT--GGPIGHALTVPEMRLAGE--GRLRMNS-ESQAQE---------
A0A674DKC6_BAD-01      KG-MT--GGPIGHTLTVPEMRLAGE--GRLRMNS-ESQAQE---------
A0A3P8YI30_BAD-01      THYPEFQFCNTSTNTSNRTLP--------GVRVR-LYSESQ---------
A0A3B4DUY7_BAD-01      GDSPQLDSQHSMASNISPASPDELS--EVGCRVR-LYSESQ---------
A0A4W4HE29_BAD-01      GDSKEAEPSQSEQHLHVPNTLRGEW--TARQRNHSMNEAEL---------
A0A3B4CPH6_BAD-01      EASKRAELSQSGQHPLVPERFRE-----SRQRNHSMNEDAL---------
A0A674AVP9_BAD-01      ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
A0A1S3L0Z2_BAD-01      ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
B5XEF1_BAD-01          ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
A0A4W5MZR2_BAD-01      ---------LHVSTTMSTRPR-------PGERVR-LYSESQ---------
A0A060W8W7_BAD-01      ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
E7FBJ6_BAD-01          ---------GQHQDRTSANIS-------PQGRVR-LYSESQ---------
A0A673J5Q9_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A671PX91_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A672LB88_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A673I6H5_BAD-01      ---------GQHQDQTSPNIS-------PQGRVR-LYSESQ---------
A0A671SBB4_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-FYSESQ---------
A0A672R7P6_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A3P8Y761_BAD-02      DGTGAYGLFWLRNTHIHPLILCSFF--IGEGRIR-LNSESQ---------
A0A3B5L9R9_BAD-01      -----EKPLSQRHTLTLPELRST-----K---------------------
H3D8J8_BAD-01          ------------------------------GRIR-VNSESQ---------
A0A6F9CQZ0_BAD-02      ----GMTGGPLGHTLTVPEMRLA-----GEGRLR-LNSESQ---------
A0A6F9CA11_BAD-02      ----GMTGGPLGHALT----------------------------------
A0A1S3N9Q3_BAD-01      ----GMTGGPIGHALTVPEMRLA-----GEGRLR-MNSESQ---------
A0A3Q2QC80_BAD-01      -----VEPLRQRHALTLPELR-S-----GHGRIR-LNSESH---------
A0A3Q3FKT9_BAD-02      -----EPHVPQRHSLTLPELRLA-----GTGRIR-LNSESH---------
A0A3Q3FKT9_BAD-03      -----EPHVPQRHSLTLPELRLA-----GTGRIR-LNSESH---------
A0A667ZNC6_BAD-01      -----EQNHHLGHALTTPELRMS-----ASGRVR-LNSESH---------
A0A3P9B2E4_BAD-01      -------QESKPQTLSLPVTKTT-----AAGRLR-VNSESH---------
A0A668V3Q4_BAD-01      -------QESKPQTLALPVIKTT-----GAGRLR-LNSESH---------
I3K7B6_BAD-01          -------QESKPQTLALPVIKTT-----GAGRLR-LNSESH---------
A0A3Q3C680_BAD-01      -------QESKPQTLSLPVIKTT-----AAGRLR-VNSESH---------
A0A3P8QRJ7_BAD-01      -------QESKPQTLSLPVTKTT-----AAGRLR-VNSESH---------
A0A3Q4GGN3_BAD-01      -------QESKPQTLSLPVIKTT-----AAGRLR-VNSESH---------
A0A3B4GXJ6_BAD-01      -------QESKPQTLSLPVIKTT-----AAGRLR-VNSESH---------
A0A3Q2D5S0_BAD-01      --------------------SGK-----THRRIR-LSSESH---------
A0A3Q0QNQ2_BAD-01      ---------AIGHDQNTSPMRHP-----TARRIR-MNSESH---------
A0A3P8WI83_BAD-01      -----EQVVPHRHNLTLPELRVA-----GSRRIR-LNSESH---------
A0A3P8WI83_BAD-02      -----EQVVPHRHNLTLPELRVA-----GSRRIR-LNSESH---------
A0A3P9HNZ2_BAD-01      GGGGEGEHLHDRHSLTLPELRLT-----SNGRTR-LNSEST---------
A0A3B3BQF7_BAD-01      GGGGGGGHLHDRHALTLPELRLT-----SNGRTR-LNSEST---------
A0A4W6EMZ7_BAD-02      -----EQQIPQRNTVTLPELRLP-----VPGRIR-LNSESH---------
A0A672JQ68_BAD-01      -----DQRVRRRLDLSLNEFNLT-----ATGRIR-LNSESI---------
A0A2U9BAC9_BAD-01      -----GEQVPPRHTLALPELRMA-----ATGRIR-LNSESN---------
A0A4W6EMZ7_BAD-01      -----EQQIPQRNTVTLPELRLP-----VPGRIR-LNSESH---------
A0A3B4VFC5_BAD-01      -----EQELSQRHTLTLPELRGA-----ATGRTR-LNSESH---------
A0A3B4W9T1_BAD-01      -----EQELSQRHTLTLPELRGA-----ATGRTR-LNSESH---------
A0A3Q1K1C7_BAD-01      -----EQQVFPRHTLTLPELR-------ASGRIR-LNSESH---------
A0A672YF93_BAD-01      -----EQQISYSHSLTLPELRMA-----GAGRLR-LNSESQ---------
A0A3Q1GWH9_BAD-01      -----AMPVFARRNMALPELRTP-----ASGRIR-LNSESH---------
A0A3Q1CPU7_BAD-01      -----AMPVFARRNMALPELRTP-----ASGRLR-LNSESH---------
A0A3P8TWH6_BAD-01      -----AMPVFARRNMALPELRTP-----ASGRLR-LNSESH---------
A0A3Q3FKT9_BAD-01      AVEEP--HVPQRHSLTLPELRLA-----GTGRIR-LNSESH---------
A0A3B1IH05_BAD-01      EVSKTAEPSRSGQHITVPEKLRVE----PRQRNFSMNEEAL---------
A0A5F8GA49_BAD-01      APGQP--GGPGRRSSAAPGAQRHE----GAGDRR-PRLISY---------
H3ANP3_BAD-03          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSHTGV---------
H3ANP3_BAD-04          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSHTVF---------
H3ANP3_BAD-01          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSH------------
H3ANP3_BAD-02          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSH------------
G3VRY3_BAD-01          DPS------ASTAPSLAPLRPGPR----AA-----PGAHHH---------
G3VRY3_BAD-02          DPS------ASTAPSLAPLRPGPR----AA-----PGAHHH---------
G3VRY3_BAD-03          DPS------ASTAPSLAPLRPGPR----AA-----PGAHHH---------
A0A4X2KAA5_BAD-01      SRGLG--KHSATAPSLAPVRPGPR----PA-----PGAHHH---------
A0A672V9F8_BAD-01      AMSPA--PPAGGVPPPAPPRQVRP----AP-----P--PPS---------
A0A674GQ16_BAD-01      PGTPS--PGQRLPPTQNPPPGGTP----KP-----PGGTPK---------
A0A6I8NVP2_BAD-01      APAGP--GGLGRHTHTSPDL---A----SHLPGRRPPPAAHLSEAPPFSW
G3TP47_BAD-01          EGYWP--SGPSDRHRVAPGFLRDS----SHQQGQ-PTSSGH---------
Q61337_BAD-05          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-04          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-06          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-03          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-02          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-01          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
A0A287CT05_BAD-01      AGDRP---GCG----LAPGLPRDT----GHQQWQ-ATSSSN---------
A0A287CT05_BAD-02      AGDRP---GCG----LAPGLPRDT----GHQQWQ-ATSSSN---------
G5B6Q3_BAD-01          TGDRL---GPS----SPGGFLGDI----SHQQRQ-LISSRH---------
G5B6Q3_BAD-02          TGDRL---GPS----SPGGFLGDI----SHQQRQ-LISSRH---------
A0A2I3TBK7_BAD-01      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2R8Z674_BAD-02      AGDGP--SGSSKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-03      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-03          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5M0A7_BAD-02      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5XJR2_BAD-02      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-03      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6E7I4_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5PDB1_BAD-02      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5E6A6_BAD-02      AGDRP--PGSGKHPRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K6TG62_BAD-02      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5HKU7_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-ATSSSH---------
A0A2K6N196_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6PUL3_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5M0A7_BAD-03      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5XJR2_BAD-03      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-02      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6E7I4_BAD-03      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-04      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-04          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I3TBK7_BAD-03      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2R8Z674_BAD-03      AGDGP--SGSSKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5E6A6_BAD-03      AGDRP--PGSGKHPRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5PDB1_BAD-03      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K6TG62_BAD-03      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
G1P8C5_BAD-01          TGDQP--PGLNKHWSTVPGLLGEA----GHQQGQ-PASSSH---------
A0A452ER54_BAD-02      TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
W5P8G9_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
Q61337_BAD-07          TEDQP--G-----PYLAPGLLGSN----IHQQGR-AATNSH---------
O35147_BAD-01          TEDQP--G-----PYLAPGLLGSI----VQQQPGQAANNSH---------
F7DN67_BAD-01          TGDWP--SDPVRHQRTAPGLLGEA----GHQQGQ-PASSSH---------
Q45KI9_BAD-01          TGDRP--PSPGKHQQTAPGLLGEA----GHQQGQ-PASRKH---------
A0A3Q7SWS0_BAD-01      TGDRP------------PGLLGEA----GHQQGQ-PASRKH---------
H0WVR2_BAD-01          SGDQP--LGPGKNRCTTPSLLGDA----SHLQGQ-PASNTH---------
A0A2K6GWV0_BAD-01      SGDRP--SGPGKHPCTAPSFLGDA----SHQQGQ-PSSSSH---------
H0V608_BAD-01          TGDEL--GSS-----PAGGFLGDT----SHQQRQLRSSRSH---------
A0A2K5PDB1_BAD-01      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
U3F2S3_BAD-01          AGDRP--PGSGKHRRQAPGLPGDA----SHQQGQ-STSSSH---------
A0A2K5E6A6_BAD-01      AGDRP--PGSGKHPRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K6TG62_BAD-01      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5M0A7_BAD-01      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A1D5QBW1_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6E7I4_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5XJR2_BAD-01      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-04      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6N196_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6PUL3_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5HKU7_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-ATSSSH---------
A0A0D9R491_BAD-01      AGNRP--SDSGKHHHQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5VCA1_BAD-01      AGNRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
B4DZQ9_BAD-01          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-01      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-01      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-02      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-01          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-02          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I3TBK7_BAD-02      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2R8Z674_BAD-01      AGDGP--SGSSKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2J8TYJ3_BAD-01      AGDRP--SGSSKHHRQAPGLLRDA----SHQQEQ-PTSSSH---------
A0A4X1VE31_BAD-01      TGDRP--PGPSKPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A4X1VE31_BAD-02      TGDRP--PGPSKPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A287AEF3_BAD-01      TGTDP------QPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A4X1VE31_BAD-03      TGDRP--PGPSKPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A671ELU4_BAD-01      TGDQP--PGPGKHLCTAPGLLGEA----GHQQGQ-PASSSH---------
A0A452ER54_BAD-01      TGDRP--PGL------TPGLLGEA----GHQQGQ-PAGSSH---------
G1MI17_BAD-01          TGDQP--PGPGKHRQTAPGLLGEA----AHPQGQ-PASSNH---------
A0A452RJM6_BAD-01      TGDQP--PGPGKHRQTAPGLLGEA----AQPQGQ-PASSNH---------
A0A384DJL2_BAD-01      TGDQP--PGPGKHRQTAPGLLGEA----AHPQGQ-PASSNH---------
M3YNE7_BAD-01          TGDQP--PGLGKHLQTAPGLLGEA----GHQQGQ-PASSSH---------
A0A667H8Z9_BAD-01      TGDRP--RGPGKHQRTAPGLLGEA----GHQQGQ-PASSNH---------
A0A673V6P8_BAD-01      TGDRP--SGLGKHQRTAPGLLGEA----GPQQGQ-PASSSR---------
A0A4W2C9A8_BAD-01      TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
A0A4W2C9A8_BAD-01      TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
F1MUT9_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
Q3SYZ0_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
A0A4U1FMC3_BAD-01      TGDRP--PGPSKHRQTAPGLLGEA----GHQQGQ-PASSSH---------
A0A2Y9EHU3_BAD-01      TGDKP--PGPSKHRQTAPGLLGEA----GHQQGQ-PASSSH---------
A0A6F9BAV3_BAD-01      ------------------MSTRPR----PGGRVR-LYSESQ---------
A0A3P8YI30_BAD-02      YPEFQ------FCNTSTNTSNRTL----PGVRVR-LYSESQ---------
A0A4W5R1T6_BAD-01      YPEFQ------LHTVSTTTSTRPR----PGGRVR-LYSESQ---------
A0A060W8P9_BAD-01      YPEFQ------LHNVSTTTSIRPR----PGGRAR-LYSESQ---------
B5X1T1_BAD-01          YPEFQ------RHYVSTRTGIRPR----PGGRVR-LYSESQ---------
A0A673ZHY7_BAD-01      YPEFQ------LHYVSTRTSIRPR----PGERVR-LYSESQ---------
A0A671NP27_BAD-01      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A672SAE4_BAD-01      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A672SAE4_BAD-02      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A671RUV0_BAD-01      GSPQR-----KQH-LAVPD--------------R-LKGEQL---------
A0A673HRQ3_BAD-01      GSPQR-----KQH-LAVPD--------------R-LKGEQL---------
A0A672RGH0_BAD-01      GSPQR-----TQH-LAVPG--------------R-LKGEQL---------
Q4V925_BAD-03          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-02          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
A7MCM4_BAD-01          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-01          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-04          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
A0A3B3QX41_BAD-01      NNLKN-------------TKNPGE----AGGRVR-MRSESQ---------
A0A3Q3RXS8_BAD-01      RQEQQ--V-SQRHALALPELRTT---------------------------
A0A3Q0QNQ2_BAD-02      SFLLL--VSVISFFWSLPKAFSR---------------------------
A0A3Q3WTY4_BAD-01      EQEQQ--V-FQRHTLTLPELRMA---------------------------
A0A3P8Y761_BAD-01      GQGKT-GS-RLGLSLNLP----------GEGRIR-LNSESQ---------
A0A4W5JLL9_BAD-01      GKGMT-GG-PIGHALTVPEMRLA-----GEGRLR-MNSESQ---------
A0A3B5Q2N7_BAD-01      EKEKP--L-SQRHTLTLPELRST------TGRVR-LNSESI---------
A0A087X8P8_BAD-01      VKERP--L-SQRHTLTLPELRST------TGRVR-LNSESI---------
A0A3B3UA11_BAD-01      VKERP--L-SQRHTLTLPELRST------TGRVR-LNSESI---------
A0A3B3YFR1_BAD-01      VKERP--L-SQRHTLTLPELRST------TGRVR-LNSESI---------
A0A3P9Q7C3_BAD-01      VKERP--L-SQRHTLTLPELRST------TGRVR-LNSESI---------
A0A3B3HDU2_BAD-01      AGGEGEHL-HDRHSLTLPELRLT-----SNGRTR-LNSEST---------
A0A3P9KSL7_BAD-02      AGGEGEHL-HDRHSLTLPELRLT-----SNGRTR-LNSEST---------
A0A3P9KSL7_BAD-01      AGGEGEHL-HDRHSLTLPELRLT-----SNGRTR-LNSEST---------
A0A3B5BAL2_BAD-01      EQPMH--V-FERRNLALPELRTP-----AAGRIR-LNSESH---------
A0A665TUH3_BAD-01      --EQE--V-FQRHNLTLPEIRTA-----GAGRTR-LNSESH---------
A0A674MXC1_BAD-04      EQERQ--V-LQRHTLTLPELRLT-----GTSRTR-VSSESQ---------
A0A674MXC1_BAD-01      EQERQ--V-LQRHTLTLPELRLT-----GTSRTR-VSSESQ---------
A0A674MXC1_BAD-02      EQERQ--V-LQRHTLTLPELRLT-----GTSRTR-VSSESQ---------
A0A674MXC1_BAD-03      EQERQ--V-LQRHTLTLPELRLT-----GTSRTR-VSSESQ---------
A0A671TL42_BAD-01      EEGQQ--V-SQRHALTLPELRMA-----G--RIR-LNSESH---------
A0A3Q3AEL8_BAD-02      GPEDG-----VRQRLTLPELRHS-----KNGRLR-VNSESL---------
A0A3Q3AEL8_BAD-01      GPEDG-----VRQRLTLPELRHS-----KNGRLR-VNSESL---------
A0A1A8AQV0_BAD-01      GQEES-----VRPHPNLPELRLP-----LNGRIR-LNSESH---------
G3Q8B3_BAD-01          GQEQQ--R-LQRHTLTLPELRLSG----RKSQRI-VEKE-----------
A0A3Q2Y0E4_BAD-01      EKEQEQCL-RQGLRLTLPELPMEA----MSGRIR-LNSESH---------
A0A3Q3R5S3_BAD-01      SQEQQ--V-PPCHSLTLPELRMAA----TS-RNR-VSSESN---------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      -----------------------NNIRKD---------------------
A0A670YRG7_BAD-01      --------------------IGSDQLDSE---------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      ----------------VYN-INRWEDNEN---------------QDGASA
A0A4W4DXF5_BAD-01      ----------------AYT-VSHWEDTES---------------QDGVSA
A0A452IFQ4_BAD-01      --------------------------------------------SLEPEV
A0A674I2R9_BAD-01      --------------------------------------------SLEPEV
C1C3S9_BAD-01          --------------------------------------------ASETDS
A0A6I8PXS6_BAD-01      --------------------------------------------SSETDK
A0A337SAW2_BAD-01      --------------------------------------------HGGAGA
A0A673J9C6_BAD-01      --------------------------------------------LLETGA
A0A4W5JLL9_BAD-02      --------------------------------------------LQGRGP
A0A674DKC6_BAD-01      --------------------------------------------LQGRGP
A0A3P8YI30_BAD-01      ----------------VCS-QVGRQDNTE---------------FQVAMT
A0A3B4DUY7_BAD-01      ----------------VYT-VSRWQDNED------------------GLL
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------QESGAV
A0A674AVP9_BAD-01      ----------------VCSQVGKREDTEF---------------QDVMTP
A0A1S3L0Z2_BAD-01      ----------------VCSQVGKREDTEF---------------QDVMTP
B5XEF1_BAD-01          ----------------VRSQVGKREDTEF---------------QDVMTP
A0A4W5MZR2_BAD-01      ----------------VCSQVGKRENTEF---------------QDVMTP
A0A060W8W7_BAD-01      ----------------VCSQVGKREDTEF---------------QDVMTP
E7FBJ6_BAD-01          ----------------VYT-VSRWQDTET---------------QDGASV
A0A673J5Q9_BAD-01      ----------------VYT-VSRWQEAEP---------------QDGALA
A0A671PX91_BAD-01      ----------------VYT-VSRWQEAEP---------------QDGALA
A0A672LB88_BAD-01      ----------------VYT-VSRWQEAEP---------------QDGALV
A0A673I6H5_BAD-01      ----------------VYM-VSRWQEAVP---------------QDGASA
A0A671SBB4_BAD-01      ----------------VYM-VSRWQEAEP---------------QDGASA
A0A672R7P6_BAD-01      ----------------VYM-VSRWQEAEP---------------QDGASA
A0A3P8Y761_BAD-02      ----------------VFA-TSGGERSGE---------------LQGLGQ
A0A3B5L9R9_BAD-01      ---------------------------VE---------------LQARGE
H3D8J8_BAD-01          ----------------ASA-VSRD---EE---------------LQGNGD
A0A6F9CQZ0_BAD-02      ----------------AFS-TSRGKRNGE---------------LQGRGP
A0A6F9CA11_BAD-02      ----------------A----------QE---------------LQGSGP
A0A1S3N9Q3_BAD-01      ----------------A----------QE---------------LQGRGP
A0A3Q2QC80_BAD-01      ----------------AST-ISRE---EE---------------LQGRAE
A0A3Q3FKT9_BAD-02      ----------------AYT-VSRD---EE---------------LQARGE
A0A3Q3FKT9_BAD-03      ----------------AYT-VSRD---EE---------------LQARGE
A0A667ZNC6_BAD-01      ----------------VST-VSKD---EE---------------LLARGE
A0A3P9B2E4_BAD-01      ----------------TSS-IARD---EE---------------LMARGE
A0A668V3Q4_BAD-01      ----------------TSS-VARD---ED---------------LMARGE
I3K7B6_BAD-01          ----------------TSS-VARD---ED---------------LMARGE
A0A3Q3C680_BAD-01      ----------------TSS-IARD---EE---------------LMARGE
A0A3P8QRJ7_BAD-01      ----------------TSS-IARD---EE---------------LMARGE
A0A3Q4GGN3_BAD-01      ----------------TSS-IARD---EE---------------LMARGE
A0A3B4GXJ6_BAD-01      ----------------TSS-IARD---EE---------------LMARGE
A0A3Q2D5S0_BAD-01      ----------------A---FTRE---EE-----------------ARGE
A0A3Q0QNQ2_BAD-01      ----------------TSS-VSRD---EE---------------LVVRGE
A0A3P8WI83_BAD-01      ----------------AST-ISRE---EA---------------FQSWGE
A0A3P8WI83_BAD-02      ----------------AST-ISRE---EA---------------FQSWGE
A0A3P9HNZ2_BAD-01      ----------------AST-YSRD---ED---------------LAR--E
A0A3B3BQF7_BAD-01      ----------------VST-YSRD---ED---------------LPR--E
A0A4W6EMZ7_BAD-02      ----------------AST-ASRD---EG---------------LQVRGE
A0A672JQ68_BAD-01      ----------------AST-VSRD---EE---------------LQARAE
A0A2U9BAC9_BAD-01      ----------------AST-LSRD---EE---------------LLTRWD
A0A4W6EMZ7_BAD-01      ----------------AST-ASRD---EG---------------LQVRGE
A0A3B4VFC5_BAD-01      ----------------TST-VSRD---EE---------------FQARGE
A0A3B4W9T1_BAD-01      ----------------TST-VSRD---EE---------------FQARGE
A0A3Q1K1C7_BAD-01      ----------------AST-VYRD---EE---------------LQAKAD
A0A672YF93_BAD-01      ----------------VSN-VTRD---EE---------------LQMRGE
A0A3Q1GWH9_BAD-01      ----------------AST-LSRD---EE---------------LQAKGE
A0A3Q1CPU7_BAD-01      ----------------AST-LSRD---EE---------------LQARGE
A0A3P8TWH6_BAD-01      ----------------AST-LSRD---EE---------------LQARGE
A0A3Q3FKT9_BAD-01      ------------------A-YTVSRDEE----------------LQARGE
A0A3B1IH05_BAD-01      --------------------------------------------QESGAG
A0A5F8GA49_BAD-01      --PPLREG--------PAV-EVGP--------------------EAGAQA
H3ANP3_BAD-03          ------YG-WVKLRKRNNM-EILGRP------------------SSESQI
H3ANP3_BAD-04          ------WG-FT-----DNM-EILGRP------------------SSESQI
H3ANP3_BAD-01          ----------T-----DNM-EILGRP------------------SSESQI
H3ANP3_BAD-02          ----------T-----DNM-EILGRP------------------SSESQI
G3VRY3_BAD-01          ------EGAGA-----G-----RPRLISYPPLREGSREASP---EAEAEA
G3VRY3_BAD-02          ------EGAGA-----G-----RPRLISYPPLREGSREASP---EAEAEA
G3VRY3_BAD-03          ------EGAGA-----G-----RPRLISYPPLREGSREASP---EAEAEA
A0A4X2KAA5_BAD-01      ------EGAGA-----GAG-DRRPRLISYPPLREGPGEASP---EAEAEA
A0A672V9F8_BAD-01      ------PLWGC-----PRP-P----------CFVGGGVQARARLGSEGER
A0A674GQ16_BAD-01      ------AIFGG-----PLT-PLPPQRRGPGCCRSGGGAGG----GGDPQI
A0A6I8NVP2_BAD-01      LPPRLPPATGP-----RAK-EPSGRLNSE---------------PPDSEA
G3TP47_BAD-01          ------HG-GA-----AAV-ETRSRHSSY---------------PAGSDE
Q61337_BAD-05          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
Q61337_BAD-04          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
Q61337_BAD-06          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
Q61337_BAD-03          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
Q61337_BAD-02          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
Q61337_BAD-01          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
A0A287CT05_BAD-01      ------HG-GA-----GAT-ETRSRHSSY---------------PADTDL
A0A287CT05_BAD-02      ------HG-GA-----GAT-ETRSRHSSY---------------PADTDL
G5B6Q3_BAD-01          ------HG-GT-----GAT-ETRSRHSSY---------------PTGMEE
G5B6Q3_BAD-02          ------HG-GT-----GAT-ETRSRHSSY---------------PTGMEE
A0A2I3TBK7_BAD-01      ------HG---------------EGT--S---------------SPEERG
A0A2R8Z674_BAD-02      ------HG---------------EGT--S---------------SPEERG
A0A2I2YFH2_BAD-03      ------HG---------------EGT--S---------------SPEERR
Q92934_BAD-03          ------HG---------------EGT--S---------------SPEERG
A0A2K5M0A7_BAD-02      ------HG---------------GT---S---------------SPEERG
A0A2K5XJR2_BAD-02      ------HG---------------GT---S---------------SPEERG
A0A096MLD5_BAD-03      ------HG---------------GT---S---------------SPEERG
A0A2K6E7I4_BAD-02      ------HG---------------GT---S---------------SPEERG
A0A2K5PDB1_BAD-02      ------HG---------------GT---S---------------SPEERG
A0A2K5E6A6_BAD-02      ------HG---------------GT---S---------------SPEERG
A0A2K6TG62_BAD-02      ------HG---------------GT---S---------------SPEERG
A0A2K5HKU7_BAD-02      ------HG---------------GRAWYS---------------PS-ESE
A0A2K6N196_BAD-02      ------HG---------------GRAWYY---------------PA-ESE
A0A2K6PUL3_BAD-02      ------HG---------------GRAWYY---------------PA-ESE
A0A2K5M0A7_BAD-03      ------HG---------------GGAWYS---------------PSWESE
A0A2K5XJR2_BAD-03      ------HG---------------GGAWYS---------------PSWESE
A0A096MLD5_BAD-02      ------HG---------------GRAWYS---------------PSWESE
A0A2K6E7I4_BAD-03      ------HG---------------GRAWYS---------------PSWESE
A0A2I2YFH2_BAD-04      ------HG---------------GRTSYS---------------PSWESE
Q92934_BAD-04          ------HG---------------GRTSYS---------------PSWESE
A0A2I3TBK7_BAD-03      ------HG---------------GRTSYS---------------PSWESE
A0A2R8Z674_BAD-03      ------HG---------------GRTSYS---------------PSWESE
A0A2K5E6A6_BAD-03      ------HG---------------GE--YS---------------TCASAS
A0A2K5PDB1_BAD-03      ------HG------------------------------------------
A0A2K6TG62_BAD-03      ------HG------------------------------------------
G1P8C5_BAD-01          ------HD-GA-----GSV-EPRSRHSSY---------------PTGTEE
A0A452ER54_BAD-02      ------HG-GT-----GAV-ETRSRHSSY---------------PAGPED
W5P8G9_BAD-01          ------HG-GT-----GAV-ETRSRHSSY---------------PAGPED
Q61337_BAD-07          ------HG-GA-----GAM-ETRSRHSSY---------------PAGTEE
O35147_BAD-01          ------HG-GA-----GTM-ETRSRHSSY---------------PAGTEE
F7DN67_BAD-01          ------HG-GA-----GAV-ETRSRHSSY---------------PEGTED
Q45KI9_BAD-01          ------HG-GA-----GA--ETRSRHSSF---------------PAGTDE
A0A3Q7SWS0_BAD-01      ------HG-GA-----GA--ETRSRHSSF---------------PAGTDE
H0WVR2_BAD-01          ------HGAGP-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K6GWV0_BAD-01      ------HG-GA-----GSV-ETRSRHSSY---------------PAGTEE
H0V608_BAD-01          ------HG-GT-----VAM-ETRSRHRSY---------------PAGTEE
A0A2K5PDB1_BAD-01      ------HG-GA-----GAV-ETRSRHRSY---------------PAGTEE
U3F2S3_BAD-01          ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K5E6A6_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K6TG62_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEG
A0A2K5M0A7_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A1D5QBW1_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K6E7I4_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K5XJR2_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A096MLD5_BAD-04      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K6N196_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K6PUL3_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K5HKU7_BAD-01      ------HG-GA-----GAV-ETRSRHSSH---------------PAGTEE
A0A0D9R491_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2K5VCA1_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
B4DZQ9_BAD-01          ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
A0A096MLD5_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A2I2YFH2_BAD-01      ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
A0A2I2YFH2_BAD-02      ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
Q92934_BAD-01          ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
Q92934_BAD-02          ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
A0A2I3TBK7_BAD-02      ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
A0A2R8Z674_BAD-01      ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
A0A2J8TYJ3_BAD-01      ------HG-GA-----GAV-EIRSRHSSY---------------PAGTED
A0A4X1VE31_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PEGTEE
A0A4X1VE31_BAD-02      ------HG-GA-----GAV-ETRSRHSSY---------------PEGTEE
A0A287AEF3_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PEGTEE
A0A4X1VE31_BAD-03      ------HG-GA-----GAV-ETRSRHSSY---------------PEGTEE
A0A671ELU4_BAD-01      ------HG-GA-----GSV-EPRSRHSSY---------------PAGTEE
A0A452ER54_BAD-01      ------HG-GT-----GAV-ETRSRHSSY---------------PAGPED
G1MI17_BAD-01          ------HG-GA-----GAV-EPRSRHSSY---------------PAGTEE
A0A452RJM6_BAD-01      ------HG-GA-----GAV-EPRSRHSSY---------------PAGTEE
A0A384DJL2_BAD-01      ------HG-GA-----GAV-EPRSRHSSY---------------PAGTEE
M3YNE7_BAD-01          ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A667H8Z9_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A673V6P8_BAD-01      ------HG-GA-----GAV-ETRSRHSSY---------------PAGTEE
A0A4W2C9A8_BAD-01      ------HG-GT-----GAV-ETRSRHSSY---------------RAGPED
A0A4W2C9A8_BAD-01      ------HG-GT-----GAV-ETRSRHSSY---------------RAGPED
F1MUT9_BAD-01          ------HG-GT-----GAV-ETRSRHSSY---------------RAGPED
Q3SYZ0_BAD-01          ------HG-GT-----GAV-ETRSRHSSY---------------RAGPED
A0A4U1FMC3_BAD-01      ------HG-GT-----GAV-ETRSRHSSY---------------SAGTED
A0A2Y9EHU3_BAD-01      ------HG-GT-----GAV-DTRSRHSSY---------------SAGTED
A0A6F9BAV3_BAD-01      ----------------VCS-QVGKREDTE---------------FQDVMT
A0A3P8YI30_BAD-02      ----------------VCS-QVGRQDNTE---------------FQVAMT
A0A4W5R1T6_BAD-01      ----------------VFS-HVGRRDDTE---------------FQDAMT
A0A060W8P9_BAD-01      ----------------VCS-QVGRRDDTE---------------FQDAIT
B5X1T1_BAD-01          ----------------VCS-QVGRRDNTE---------------FQDVMT
A0A673ZHY7_BAD-01      ----------------VCS-QVGRREDTE---------------FQDVMT
A0A671NP27_BAD-01      ----------------GRH-RNLSMNDEN---------------LLETGA
A0A672SAE4_BAD-01      ----------------GRH-RNLSMNDED---------------LLETGA
A0A672SAE4_BAD-02      ----------------GRH-RNLSMNDED---------------LLETGA
A0A671RUV0_BAD-01      ----------------GRH-RNLSMNDED---------------LLETGA
A0A673HRQ3_BAD-01      ----------------GRH-RNLSMNDED---------------LLETGA
A0A672RGH0_BAD-01      ----------------GRH-RNLSMNDED---------------LLETGA
Q4V925_BAD-03          ----------------GRQ-RNLSMNEED---------------LLETGV
Q4V925_BAD-02          ----------------GRQ-RNLSMNEED---------------LLETGV
A7MCM4_BAD-01          ----------------GRQ-RNLSMNEED---------------LLETGV
Q4V925_BAD-01          ----------------GRQ-RNLSMNEED---------------LLETGV
Q4V925_BAD-04          ----------------GRQ-RNLSMNEED---------------LLETGV
A0A3B3QX41_BAD-01      ------------------V-SSIRSEDLD---------------FGEGGA
A0A3Q3RXS8_BAD-01      ------------------A-SNRIRLSSE---------------SQSRVD
A0A3Q0QNQ2_BAD-02      --------------------------DEE---------------LVVRGE
A0A3Q3WTY4_BAD-01      --------------------------GRT---------------LQVKGE
A0A3P8Y761_BAD-01      ----------------VFA-TSGGERSGE---------------LQGLGQ
A0A4W5JLL9_BAD-01      --------------------------AQE---------------LQGRGP
A0A3B5Q2N7_BAD-01      ------------------A-STISR-EVE---------------LQARGE
A0A087X8P8_BAD-01      ------------------A-STISR-EEE---------------LQARGE
A0A3B3UA11_BAD-01      ------------------A-STISR-EEE---------------LQARGE
A0A3B3YFR1_BAD-01      ------------------A-STISR-EEE---------------LQARGE
A0A3P9Q7C3_BAD-01      ------------------A-STISR-EEE---------------LQARGE
A0A3B3HDU2_BAD-01      ------------------A-STYSR-DED---------------LAR--E
A0A3P9KSL7_BAD-02      ------------------A-STYSR-DED---------------LAR--E
A0A3P9KSL7_BAD-01      ------------------A-STYSR-DED---------------LAR--E
A0A3B5BAL2_BAD-01      ------------------A-TTVSR-DEE---------------LQARGE
A0A665TUH3_BAD-01      ------------------T-STGSR-DED---------------FLARGD
A0A674MXC1_BAD-04      ------------------A-STFSR-EEE---------------LQGNGE
A0A674MXC1_BAD-01      ------------------A-STFSR-EEE---------------LQGNGE
A0A674MXC1_BAD-02      ------------------A-STFSR-EEE---------------LQGNGE
A0A674MXC1_BAD-03      ------------------A-STFSR-EEE---------------LQGNGE
A0A671TL42_BAD-01      ------------------A-STVSR-DVE---------------LQARGE
A0A3Q3AEL8_BAD-02      ------------------S-STSSRGEEE---------------LPARAD
A0A3Q3AEL8_BAD-01      ------------------S-STSSRGEEE---------------LPARAD
A0A1A8AQV0_BAD-01      ------------------V-SNVSRDEDL---------------LARVAE
G3Q8B3_BAD-01          ---------------------------------------------EELWL
A0A3Q2Y0E4_BAD-01      ------------------A-LAVSR-EEE---------------FQARVD
A0A3Q3R5S3_BAD-01      ------------------A-STVQ---------------------DAKSD
                                                                         

Q61337_BAD-09          ------------------------------------------XAAQRYGR
Q2PG01_BAD-01          -----------------------MEEEPSPFRGRSRSAPPNLWAAQRYGR
A0A2I3H4B2_BAD-01      -----------------------MGEEPSPFRGRSRSAPPNLWAAQRYGR
Q92934_BAD-05          -----------------------MGEEPSPFRGRSRSAPPNLWAAQRYGR
Q92934_BAD-06          -----------------------MGEEPSPFRGRSRSAPPNLWAAQRYGR
A0A670JUY4_BAD-01      -----------------------WTLALGTFRARSRSAPPILWAAQRYGR
A0A670YRG7_BAD-01      -----------------------TSDEVGAFRARSRSAPPILWAAQRYGR
Q6P7C5_BAD-01          -------------------------------------------HGGRFLT
A0A3B1JLM2_BAD-01      ----------------ED-G---GVGDGAPFRGRSQSAPAALWKAKKYGR
A0A4W4DXF5_BAD-01      ----------------EEGG---GACEGAPFRGRSQSAPAALWKAKKYGR
A0A452IFQ4_BAD-01      -----------------------QDEPGGAFRARSRSAPPILWAAMRYGR
A0A674I2R9_BAD-01      -----------------------QDEPGGAFRARSRSAPPILWAAMRYGR
C1C3S9_BAD-01          -----------------------VGEL-QHFRSRSRSAPSSLMVAARYGR
A0A6I8PXS6_BAD-01      -----------------------VGEL-HPFRSRSRSAPSS-MIATKYGR
A0A337SAW2_BAD-01      VETRSRHSSYPAGTEEDEGT---EEEEPSPFRGRSRSAPPNLWAALRYGR
A0A673J9C6_BAD-01      ----------------ADEG---DLVGGDPFRPRSRSAPPALWAAKKYGR
A0A4W5JLL9_BAD-02      ----------------GVEG---MPTDGASFRVRSQSAPPALWAAKKYGR
A0A674DKC6_BAD-01      ----------------GVEG---VPTDGASFRGRSQSAPPALWAAKRYGR
A0A3P8YI30_BAD-01      ----------------PTEE---SGGDAAPFRGRSQSAPPALWAAKKYGC
A0A3B4DUY7_BAD-01      ----------------AEDG---GAGDGAPFRGRSQSAPAALWKAKKYGR
A0A4W4HE29_BAD-01      -----------------------QDSGAESFRRRSRSAPPILWAAKKYGR
A0A3B4CPH6_BAD-01      ----------------RHGD---GAADGDSFRRRCRSAPPALWAAKKYGR
A0A674AVP9_BAD-01      ----------------TEEG---G-GDGASFRGRSQSAPPALWAAKKYGC
A0A1S3L0Z2_BAD-01      ----------------TEEG---G-GDGASFRGRSQSAPPALWAAKKYGC
B5XEF1_BAD-01          ----------------TEEG---G-GDGASFRGRSQSAPPALWAAKKYGC
A0A4W5MZR2_BAD-01      ----------------TEEG---G-GDGASFRGRSQSAPPALWAAKKYGC
A0A060W8W7_BAD-01      ----------------TEDG---G-GDGASFRGRSQSAPPALWAAKKYGC
E7FBJ6_BAD-01          ----------------EEN------GDGLPFRGRSQSAPAALWKAKKYGR
A0A673J5Q9_BAD-01      ----------------EENG---GTGDGLPFRGRSQSAPAVLWKAKKYGR
A0A671PX91_BAD-01      ----------------EENG---GTGDGLPFRGRSQSAPAALWKAKKYGR
A0A672LB88_BAD-01      ----------------EENG---GTGDGLPFRGRSQSAPAALWKAKKYGR
A0A673I6H5_BAD-01      ----------------EENG---GTGDGLPFRGRSQSAPAALWKAKKYGR
A0A671SBB4_BAD-01      ----------------EENG---GTGDGLPFRGRSQSAPAALWKAKKYGR
A0A672R7P6_BAD-01      ----------------EENG---GTGDGLPFRGRSQSAPAALWKAKKYGR
A0A3P8Y761_BAD-02      ----------------GLNC---VATEGLPFRVRSQSAPPALWAAKRYGR
A0A3B5L9R9_BAD-01      ----------------EEVG---TPTEGFPFRGRSLSAPPSLWAAKKYGR
H3D8J8_BAD-01          ----------------DEAG---TPTDGAPFRGRSRSAPPALWAAKKYGR
A0A6F9CQZ0_BAD-02      ----------------GVDG---IPTDGAPFRVRSQSAPPALWAAKRYGR
A0A6F9CA11_BAD-02      ----------------GVDG---VPTDGASFRVRSQSAPPALWAAKKYGR
A0A1S3N9Q3_BAD-01      ----------------GVEG---MPTDGASFRGRSQSAPPALWAAKRYGR
A0A3Q2QC80_BAD-01      ----------------EEAG---TPTEGLPFRNRSNSAPPALWAAKKYGR
A0A3Q3FKT9_BAD-02      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGR
A0A3Q3FKT9_BAD-03      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGR
A0A667ZNC6_BAD-01      ----------------GEDG------DGAPFRGRSQSAPPALWAAKKYGR
A0A3P9B2E4_BAD-01      ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGR
A0A668V3Q4_BAD-01      ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGQ
I3K7B6_BAD-01          ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGQ
A0A3Q3C680_BAD-01      ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGR
A0A3P8QRJ7_BAD-01      ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGR
A0A3Q4GGN3_BAD-01      ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGR
A0A3B4GXJ6_BAD-01      ----------------DEVC---TPTEGDPFRRRSKSAPPALWAAKKYGR
A0A3Q2D5S0_BAD-01      ----------------EEVG---TPTEGYPFRGRSNSAPPALWAAKKYGR
A0A3Q0QNQ2_BAD-01      ----------------DEIC---TPTEGDPFRRRSKSAPPALWAAKKYGQ
A0A3P8WI83_BAD-01      ----------------EEAG---TPTEGAPFRGRSRSAPPALWAAKKYGR
A0A3P8WI83_BAD-02      ----------------EEAG---TPTEGAPFRGRSRSAPPALWAAKKYGR
A0A3P9HNZ2_BAD-01      ----------------DEAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ
A0A3B3BQF7_BAD-01      ----------------DEAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ
A0A4W6EMZ7_BAD-02      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ
A0A672JQ68_BAD-01      ----------------EEVG---TPTEGAPFRGRSKSAPPALWAAKKYGQ
A0A2U9BAC9_BAD-01      ----------------EEAG---TPTDGAPFRGRSKSAPPALWAAMKYGQ
A0A4W6EMZ7_BAD-01      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ
A0A3B4VFC5_BAD-01      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ
A0A3B4W9T1_BAD-01      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGQ
A0A3Q1K1C7_BAD-01      ----------------EEAG---TPTDGAPFRARSKSAPPALWAAKKYGQ
A0A672YF93_BAD-01      ----------------DEAS---TPTEGAPFRARSKSAPPALWAAKKYGQ
A0A3Q1GWH9_BAD-01      ----------------EEAG---TPTEGAPFRARSKSAPPALWAAKKYGQ
A0A3Q1CPU7_BAD-01      ----------------EEAG---TPTDGAPFRARSKSAPPALWAAKKYGQ
A0A3P8TWH6_BAD-01      ----------------EEAG---TPTDGAPFRARSKSAPPALWAAKKYGQ
A0A3Q3FKT9_BAD-01      ----------------EEAG---TPTEGAPFRGRSKSAPPALWAAKKYGR
A0A3B1IH05_BAD-01      ----------------RHED---GARDGDSFRRRSRSAPPSLWAAKKYGR
A0A5F8GA49_BAD-01      ----------------ERAE---AEEDRGLFRSRSSSAPPILWAARRYGS
H3ANP3_BAD-03          ----------------SDSE---SLDELGPFRTRSRSAPPNFWAARKYGQ
H3ANP3_BAD-04          ----------------SDSE---SLDELGPFRTRSRSAPPNFWAARKYGQ
H3ANP3_BAD-01          ----------------SDSE---SLDELGPFRTRSRSAPPNFWAARKYGQ
H3ANP3_BAD-02          ----------------SDSE---SLDELGPFRTRSRSAPPNFWAARKYGQ
G3VRY3_BAD-01          ----------------EQSE---GEEERGLFRGRSSSAPPILWAARHYGS
G3VRY3_BAD-02          ----------------EQSE---GEEERGLFRGRSSSAPPILWAARHYGS
G3VRY3_BAD-03          ----------------EQSE---GEEERGLFRGRSSSAPPILWAARHYGS
A0A4X2KAA5_BAD-01      ----------------DFFE---GEEERSLFRSRSSSAPPILWAARRYGS
A0A672V9F8_BAD-01      ----------------G--P---GEPPPGV-RGRSRSAPPALWAARRFGR
A0A674GQ16_BAD-01      ----------------GAPP---GDPPPA--RGRSRSAPPVLWAAQRYGR
A0A6I8NVP2_BAD-01      ----------------EEH---------SPFRGRSHSAPPILWVAQRYGR
G3TP47_BAD-01          ----------------AEGL---EEDP-SPFRGRSLSAPPNLWAAQRYGR
Q61337_BAD-05          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
Q61337_BAD-04          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
Q61337_BAD-06          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
Q61337_BAD-03          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
Q61337_BAD-02          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
Q61337_BAD-01          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
A0A287CT05_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A287CT05_BAD-02      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
G5B6Q3_BAD-01          ----------------EAGM---KEEP-SPFRGRSRSAPPNLWAAQRYGR
G5B6Q3_BAD-02          ----------------EAGM---KEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2I3TBK7_BAD-01      ----------------HSNP---DAAKLQLDASLPVLVGSELGQG-----
A0A2R8Z674_BAD-02      ----------------HSNA---DAAKLQLDASLPVLVGSELGQG-----
A0A2I2YFH2_BAD-03      ----------------HSNA---DAAKLQLDASLPVLVGSELGQG-----
Q92934_BAD-03          ----------------HSNA---DAAKLQLDASLPVLVGSELGQG-----
A0A2K5M0A7_BAD-02      ----------------HSDA---DAAKLQLDASLPVLVGSELGQG-----
A0A2K5XJR2_BAD-02      ----------------HSDA---DAAKLQLDASLPVLVGSELGQG-----
A0A096MLD5_BAD-03      ----------------HSDA---DAAKLQLDASLPVLVGSELGQG-----
A0A2K6E7I4_BAD-02      ----------------HSDA---DAAKLQLDASLPVLVGSELGQG-----
A0A2K5PDB1_BAD-02      ----------------HSNA---DAAKRQLDASHPVLVGSELGQG-----
A0A2K5E6A6_BAD-02      ----------------HSNA---DAAKLQLDASHPVLVGSELGQG-----
A0A2K6TG62_BAD-02      ----------------HSNA---DAAKLQLDASHPVLVGSELGQG-----
A0A2K5HKU7_BAD-02      ----------------DSEN---PSARMLTEASAGMSAPATDSEAQHAEN
A0A2K6N196_BAD-02      ----------------DSEN---PSARMLAEASAGMSAPATDSEAQLAEN
A0A2K6PUL3_BAD-02      ----------------DSEN---PSARMLAEASAGMSAPATDSEAQLAEN
A0A2K5M0A7_BAD-03      ----------------DSEN---PSARMLAEASARMSAPATDSEAQHAEN
A0A2K5XJR2_BAD-03      ----------------DSEN---PSARMLAEASARMSAPATDSEAQLAEN
A0A096MLD5_BAD-02      ----------------DSEN---PSARMLAEASAPMSAPATDSEAQHAEN
A0A2K6E7I4_BAD-03      ----------------DSEN---PSARMLAEASARMSAPATDSEAQHAEN
A0A2I2YFH2_BAD-04      ----------------DSEN---PSAGMLAEASAGMSAPAADSEAQHAEN
Q92934_BAD-04          ----------------DSEN---PSAGMLAEASAGMSAPAADSEAQHAEN
A0A2I3TBK7_BAD-03      ----------------DSEN---PSAGMLAEASAGMSAPAADSEAQHAEN
A0A2R8Z674_BAD-03      ----------------DSEN---PSAGMLAEASAGMSAPAADSEAQHAEN
A0A2K5E6A6_BAD-03      ----------------SSEN---PSARMLSKASAGMSAPATDS-----EN
A0A2K5PDB1_BAD-03      ------------------EN---PSARMLSKTSAGMSSPATDSEAQHTEN
A0A2K6TG62_BAD-03      ------------------EN---PSAKMLSKASAGMSAPATDSEAQHTEN
G1P8C5_BAD-01          ----------------DDDT---EEGEPSPFRGRSRSAPPNLWAAQRYGR
A0A452ER54_BAD-02      ----------------DEGT---EEEDLGPFRGRSRSAPPNLWAAQRYGR
W5P8G9_BAD-01          ----------------DEGT---EEEDLGPFRGRSRSAPPNLWAAQRYGR
Q61337_BAD-07          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
O35147_BAD-01          ----------------DEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
F7DN67_BAD-01          ----------------EGME---GEEP-GPFRGRSRSAPPNLWAARRYGR
Q45KI9_BAD-01          ----------------DEGM---EEEELSPFRGRSSSAPPNLCAARRYGR
A0A3Q7SWS0_BAD-01      ----------------DEGM---EEEELSPFRGRSSSAPPNLCAALRYGR
H0WVR2_BAD-01          ----------------DEGI----EEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K6GWV0_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
H0V608_BAD-01          ----------------EEGM---EEEL-SPFRGRSRSAPPNLWAAQRYGR
A0A2K5PDB1_BAD-01      ----------------DEGM---EEEP-STFRGRSRSAPPNLWAAQRYGR
U3F2S3_BAD-01          ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K5E6A6_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K6TG62_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K5M0A7_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A1D5QBW1_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K6E7I4_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K5XJR2_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A096MLD5_BAD-04      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K6N196_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K6PUL3_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K5HKU7_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A0D9R491_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2K5VCA1_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
B4DZQ9_BAD-01          ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A096MLD5_BAD-01      ----------------DEGM---EEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2I2YFH2_BAD-01      ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2I2YFH2_BAD-02      ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
Q92934_BAD-01          ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
Q92934_BAD-02          ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2I3TBK7_BAD-02      ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2R8Z674_BAD-01      ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A2J8TYJ3_BAD-01      ----------------DEGM---GEEP-SPFRGRSRSAPPNLWAAQRYGR
A0A4X1VE31_BAD-01      ----------------DEGT---EDEELSPFRGRSLSAPPILWAAQRYGR
A0A4X1VE31_BAD-02      ----------------DEGT---EDEELSPFRGRSLSAPPILWAAQRYGR
A0A287AEF3_BAD-01      ----------------DEGT---EDEELSPFRGRSLSAPPILWAAQRYGR
A0A4X1VE31_BAD-03      ----------------DEGT---EDEELSPFRGRSLSAPPILWAAQRYGR
A0A671ELU4_BAD-01      ----------------DEEM---EEEEPSPFRGRSRSAPPNLWAAQRYGR
A0A452ER54_BAD-01      ----------------DEGT---EEEDLGPFRGRSRSAPPNLWAAQRYGR
G1MI17_BAD-01          ----------------DEGL---EEEELSPFRGRSSSAPPNLCAALRYGR
A0A452RJM6_BAD-01      ----------------DEGL---EEEELSPFRGRSSSAPPNLCAALRYGR
A0A384DJL2_BAD-01      ----------------DEGL---EEEELSPFRGRSSSAPPNLCAALRYGR
M3YNE7_BAD-01          ----------------DEGM---EEEELSPFRGRSRSAPPNLCAALRYGR
A0A667H8Z9_BAD-01      ----------------DEGT---EEEEPSPFRGRSRSAPPNLWAALRYGR
A0A673V6P8_BAD-01      ----------------DEGT---EEEEPSPFRGRSRSAPPNLCAALRYGR
A0A4W2C9A8_BAD-01      ----------------NEET---EEEDLGPFRGRSRSAPPNLWAAQRYGR
A0A4W2C9A8_BAD-01      ----------------NEET---EEEDLGPFRGRSRSAPPNLWAAQRYGR
F1MUT9_BAD-01          ----------------NEET---EEEDLGPFRGRSRSAPPNLWAAQRYGR
Q3SYZ0_BAD-01          ----------------NEET---EEEDLGPFRGRSRSAPPNLWAAQRYGR
A0A4U1FMC3_BAD-01      ----------------EEGT---EEEEPSPFRGRSRSAPPNLWAARRYGR
A0A2Y9EHU3_BAD-01      ----------------DEGT---EEEEPSPFRGRSRSAPPNLWAAQRYGR
A0A6F9BAV3_BAD-01      ----------------PTEE---GGGDGASFRGRSQSAPPALWAAKKYGC
A0A3P8YI30_BAD-02      ----------------PTEE---SGGDAAPFRGRSQSAPPALWAAKKYGC
A0A4W5R1T6_BAD-01      ----------------PTEE---GGGDGAPFRSRSQSAPPALWAAKKYGR
A0A060W8P9_BAD-01      ----------------PTEE---GGGDGAPFRSRSQSAPPTLWAAKKYGR
B5X1T1_BAD-01          ----------------PTEE---GGGDGAPFRSRSQSAPPTLWAAKKYGR
A0A673ZHY7_BAD-01      ----------------PTEE---GGGDGAPFRSRSQSAPPTLWAAKKYGR
A0A671NP27_BAD-01      ----------------ADEG---DLVGSDPFRPRSRSAPPALWAAKKYGR
A0A672SAE4_BAD-01      ----------------ADEG---DLVGGDPFRPRSRSAPPALWAAKKYGR
A0A672SAE4_BAD-02      ----------------ADEG---DLVGGDPFRPRSRSAPPALWAAKKYGR
A0A671RUV0_BAD-01      ----------------ADEG---DLVGGDPFRPRSRSAPPALWAAKKYGQ
A0A673HRQ3_BAD-01      ----------------ADEG---DLVGGDPFRPRSRSAPPALWAAKKYGQ
A0A672RGH0_BAD-01      ----------------ADEG---DLVGGDPFRPRSRSAPPALWAAKKYGQ
Q4V925_BAD-03          ----------------AEDP---HML-GDPFRPRSRSAPPALWAAKKYGQ
Q4V925_BAD-02          ----------------AEDP---HML-GDPFRPRSRSAPPALWAAKKYGQ
A7MCM4_BAD-01          ----------------AEDP---HML-GDPFRPRSRSAPPALWAAKKYGQ
Q4V925_BAD-01          ----------------AEDP---HML-GDPFRPRSRSAPPALWAAKKYGQ
Q4V925_BAD-04          ----------------AEDP---HML-GDPFRPRSRSAPPALWAAKKYGQ
A0A3B3QX41_BAD-01      ----------------SEEGGGVCPGDGTPFRGRSRSAPPALWAAQRYGR
A0A3Q3RXS8_BAD-01      ----------------EEAG---TPTDGAPFRGRSKSAPPALWAAKKYGQ
A0A3Q0QNQ2_BAD-02      ----------------DEIC---TPTEGDPFRRRSKSAPPALWAAKKYGQ
A0A3Q3WTY4_BAD-01      ----------------DEAG---TPTDGAPFRGRSKSAPPSLWAAKKYGQ
A0A3P8Y761_BAD-01      ----------------GLNC---VATEGLPFRVRSQSAPPALWAAKRYGR
A0A4W5JLL9_BAD-01      ----------------GVEG---MPTDGASFRVRSQSAPPALWAAKKYGR
A0A3B5Q2N7_BAD-01      ----------------EEVG---TPTEGFPFRGRSLSAPPSLWAAKKYGR
A0A087X8P8_BAD-01      ----------------EEVG---TPTEGFPFRGRSNSAPPSLWAAKKYGR
A0A3B3UA11_BAD-01      ----------------EEVG---TPTEGFPFRGRSNSAPPSLWAAKKYGR
A0A3B3YFR1_BAD-01      ----------------EEVG---TPTEGFPFRGRSNSAPPSLWAAKKYGR
A0A3P9Q7C3_BAD-01      ----------------EEVG---TPTEGFPFRVRSNSAPPSLWAAKKYGR
A0A3B3HDU2_BAD-01      ----------------DEAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ
A0A3P9KSL7_BAD-02      ----------------DEAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ
A0A3P9KSL7_BAD-01      ----------------DEAG---TPTDGLAFRGRSKSAPPALWAAKKYGQ
A0A3B5BAL2_BAD-01      ----------------EEAG---TPTDGAPFRGRSKSAPPALWAAKKYGQ
A0A665TUH3_BAD-01      ----------------DEAG---TPTDGAPFRGRSKSAPPALWAAKKYGQ
A0A674MXC1_BAD-04      ----------------DEAG---TPTEGAPFRGRSRSAPPALWAAQRYGR
A0A674MXC1_BAD-01      ----------------DEAG---TPTEGAPFRGRSRSAPPALWAAQRYGR
A0A674MXC1_BAD-02      ----------------DEAG---TPTEGAPFRGRSRSAPPALWAAQRYGR
A0A674MXC1_BAD-03      ----------------DEAG---TPTEGAPFRGRSRSAPPALWAAQRYGR
A0A671TL42_BAD-01      ----------------DEAG---TPTDGAPFRGRSKSAPPALWAAKKYGR
A0A3Q3AEL8_BAD-02      ----------------DEPG---TPTEGYPFRGRSKSAPPALWAAKKYGR
A0A3Q3AEL8_BAD-01      ----------------DEPG---TPTEGYPFRGRSKSAPPALWAAKKYGR
A0A1A8AQV0_BAD-01      ----------------EEPG---TPTEGFPFRGRSKSAPPALWAAKKYGR
G3Q8B3_BAD-01          ----------------DETG---TPTEGAPFRVRSKSAPPALWAAKKYGR
A0A3Q2Y0E4_BAD-01      ----------------EEVG---TPTDGAPFRGRSKSAPPVLWAAKKYGR
A0A3Q3R5S3_BAD-01      ----------------EEAG---TPTDGAPFRGRSKSAPPALWAAKKYGR
                                                                         

Q61337_BAD-09          -ELRRMSDEFEGSFKF-------------------------------HLG
Q2PG01_BAD-01          -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2I3H4B2_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
Q92934_BAD-05          -ELRRMSDEFVDSFKK-------------------------------GLP
Q92934_BAD-06          -ELRRMSDEFVDSFKK-------------------------------GLP
A0A670JUY4_BAD-01      -ELRRMSDEFHGEL-Q-------------------------------KLP
A0A670YRG7_BAD-01      -ELRRMSDEFHG------------------------------------LP
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      -QLRRMSDEFDTWLDK------------------------------GDLR
A0A4W4DXF5_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEIR
A0A452IFQ4_BAD-01      -ELRRMSDEFDVALQV--------------------------------LP
A0A674I2R9_BAD-01      -ELRRMSDEFDVALQV--------------------------------LP
C1C3S9_BAD-01          -ELRRMSDEFDQIFTS--------------------------------IP
A0A6I8PXS6_BAD-01      -ELRRMSDEFEKSFTG--------------------------------LP
A0A337SAW2_BAD-01      -ELRRMSDEFQGSFKG--------------------------------LP
A0A673J9C6_BAD-01      -QLRRMSDEFDILLDK------------------------------G-MK
A0A4W5JLL9_BAD-02      -QLRRMSDEFDTWLDK------------------------------GEMR
A0A674DKC6_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEMR
A0A3P8YI30_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
A0A3B4DUY7_BAD-01      -QLRRMSDEFDTWLDK------------------------------GDTR
A0A4W4HE29_BAD-01      -QLRKMSDEFDTLLDK-------------------------------GMK
A0A3B4CPH6_BAD-01      -QLRKMSDEFDTLLDK-------------------------------GMK
A0A674AVP9_BAD-01      -QLRRMSDEFDTWLDK------------------------------GVPK
A0A1S3L0Z2_BAD-01      -QLRRMSDEFDTWLDK------------------------------GVPK
B5XEF1_BAD-01          -QLRRMSDEFDTWLDK------------------------------GVPK
A0A4W5MZR2_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
A0A060W8W7_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
E7FBJ6_BAD-01          -QLRRMSDEFDTWLDK------------------------------GVSK
A0A673J5Q9_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEVK
A0A671PX91_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEVK
A0A672LB88_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEVK
A0A673I6H5_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEVK
A0A671SBB4_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEVK
A0A672R7P6_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEVK
A0A3P8Y761_BAD-02      -QLRRMSDEFDTWLDK------------------------------GQMK
A0A3B5L9R9_BAD-01      -QLRRMSDEFVNLLDK------------------------------GEMR
H3D8J8_BAD-01          -QLRRMSDEFDSLLDK------------------------------GGMR
A0A6F9CQZ0_BAD-02      -QLRRMSDEFDTWLDK------------------------------GEMK
A0A6F9CA11_BAD-02      -QLRRMSDEFDTWLDK------------------------------GEMR
A0A1S3N9Q3_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEMR
A0A3Q2QC80_BAD-01      -QLRRMSDEFGSLLDK------------------------------GELR
A0A3Q3FKT9_BAD-02      -QLRRMSDEFDILLDK------------------------------GVRI
A0A3Q3FKT9_BAD-03      -QLRRMSDEFDILLDK------------------------------GEMK
A0A667ZNC6_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3P9B2E4_BAD-01      -QLRRMSDEFDSLLDK------------------------------G---
A0A668V3Q4_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMK
I3K7B6_BAD-01          -KLRRMSDEFDSLLDK------------------------------GEMK
A0A3Q3C680_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3P8QRJ7_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3Q4GGN3_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3B4GXJ6_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3Q2D5S0_BAD-01      -QLRRMSDEFVTLLDK------------------------------GELR
A0A3Q0QNQ2_BAD-01      -QLRRMSDEFDSLLDK------------------------------G-MK
A0A3P8WI83_BAD-01      -QLRRMSDEFDSLLDK------------------------------G-MR
A0A3P8WI83_BAD-02      -QLRRMSDEFDSLLDK------------------------------G-MR
A0A3P9HNZ2_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3B3BQF7_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A4W6EMZ7_BAD-02      -KLRRMSDEFDSLLDK------------------------------GEMR
A0A672JQ68_BAD-01      -RLRRMSDEFDSLLDK------------------------------GEMK
A0A2U9BAC9_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMR
A0A4W6EMZ7_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMR
A0A3B4VFC5_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMR
A0A3B4W9T1_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMR
A0A3Q1K1C7_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A672YF93_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3Q1GWH9_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3Q1CPU7_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3P8TWH6_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
A0A3Q3FKT9_BAD-01      -QLRRMSDEFDILLDK----------GVRIKGGGGGSRGGCGLVVESVVS
A0A3B1IH05_BAD-01      -QLRKMSDEFDKGLEQ-------------------------------GMK
A0A5F8GA49_BAD-01      -ELRRMSDEFDCSF-K-------------------------------GLP
H3ANP3_BAD-03          -ELRRMSDEFDMSF-L-------------------------------GLP
H3ANP3_BAD-04          -ELRRMSDEFDMSF-L-------------------------------GLP
H3ANP3_BAD-01          -ELRRMSDEFDMSF-L-------------------------------GLP
H3ANP3_BAD-02          -ELRRMSDEFDMSF-L-------------------------------GLP
G3VRY3_BAD-01          -ELRRMSDEFHCTF-K-------------------------------GLP
G3VRY3_BAD-02          -ELRRMSDEFHCTF-K-------------------------------GLP
G3VRY3_BAD-03          -ELRRMSDEFHCTF-K-------------------------------GLP
A0A4X2KAA5_BAD-01      -ELRRMSDEFDCTF-K-------------------------------GLP
A0A672V9F8_BAD-01      -QLRRMSDEFQQQV-G-------------------------------VLP
A0A674GQ16_BAD-01      -RLRRMSDEFQLQ----------------------------------VLP
A0A6I8NVP2_BAD-01      -ELRRMSDEFDCTF-Q-------------------------------GLP
G3TP47_BAD-01          -ELRRMSDEFQGYF-K-------------------------------GLP
Q61337_BAD-05          -ELRRMSDEFEGSF-K-------------------------------VSA
Q61337_BAD-04          -ELRRMSDEFEGSF-K-------------------------------GLP
Q61337_BAD-06          -ELRRMSDEFEGSF-K-------------------------------GLP
Q61337_BAD-03          -ELRRMSDEFEGSF-K-------------------------------GLP
Q61337_BAD-02          -ELRRMSDEFEGSF-K-------------------------------G--
Q61337_BAD-01          -ELRRMSDEFEGSF-K-------------------------------GLP
A0A287CT05_BAD-01      -ELRRMSDEFEGSF-K-------------------------------GLP
A0A287CT05_BAD-02      -ELRRMSDEFEGSF-K----------------------------------
G5B6Q3_BAD-01          -ELRRMSDEFVDSF-K-------------------------------GLP
G5B6Q3_BAD-02          -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2I3TBK7_BAD-01      -KLRPLPVTFAPHP-E-------------------------------TPP
A0A2R8Z674_BAD-02      -KLRPLPVTFAPHP-E-------------------------------TPP
A0A2I2YFH2_BAD-03      -KLRPLPVTFAAHP-E-------------------------------TPP
Q92934_BAD-03          -KLRPLPVTFAPHP-E-------------------------------TPP
A0A2K5M0A7_BAD-02      -KLRPLPVTFAPRP-E-------------------------------TPP
A0A2K5XJR2_BAD-02      -KLRPLPVTFAPRP-E-------------------------------TPP
A0A096MLD5_BAD-03      -KLRPLPVTFAPRP-E-------------------------------TPP
A0A2K6E7I4_BAD-02      -KLRTLPVTFAPRP-E-------------------------------TPP
A0A2K5PDB1_BAD-02      -RIRSLPVTFAPHP-K-------------------------------TPP
A0A2K5E6A6_BAD-02      -RLRSLPVTFAPHP-E-------------------------------TPP
A0A2K6TG62_BAD-02      -RLRSLPVTFAPHP-E-------------------------------TLP
A0A2K5HKU7_BAD-02      VKLEALGL-WRPGV-A-------------------------------TAP
A0A2K6N196_BAD-02      VKLEALGL-WRPGV-A-------------------------------TAP
A0A2K6PUL3_BAD-02      VKLEALGL-WRPGV-A-------------------------------TAP
A0A2K5M0A7_BAD-03      VKLKALGL-WRPGV-A-------------------------------TAP
A0A2K5XJR2_BAD-03      VKLKALGL-WRPGV-A-------------------------------TAP
A0A096MLD5_BAD-02      VKLKALGL-WRRGV-A-------------------------------TAP
A0A2K6E7I4_BAD-03      VKLKALGL-WRPAV-A-------------------------------TAP
A0A2I2YFH2_BAD-04      VKLEALGL-WRSGV-A-------------------------------TAP
Q92934_BAD-04          VKLEALGL-WRSGV-A-------------------------------TAP
A0A2I3TBK7_BAD-03      VKLEALGL-WRSGV-A-------------------------------TAP
A0A2R8Z674_BAD-03      VKLEALGL-WRSGV-A-------------------------------TAP
A0A2K5E6A6_BAD-03      VKLE-VPC-W---V-A-------------------------------TAP
A0A2K5PDB1_BAD-03      VKLEALGL-WRPGV-A-------------------------------TDR
A0A2K6TG62_BAD-03      VKLEALEP-WRHGV-A-------------------------------TAR
G1P8C5_BAD-01          -ELRRMSDEFQGSFKK-------------------------------GLP
A0A452ER54_BAD-02      -ELRRMSDEFHVSF-K-------------------------------GLP
W5P8G9_BAD-01          -ELRRMSDEFHVSF-K-------------------------------GLP
Q61337_BAD-07          -ELRRMSDEFEGSFKS----------------------------------
O35147_BAD-01          -ELRRMSDEFEGSF-K-------------------------------GLP
F7DN67_BAD-01          -ELRRMSDEFQVSF-Q-------------------------------ALP
Q45KI9_BAD-01          -ELRRMSDEFQGSF-K-------------------------------GLP
A0A3Q7SWS0_BAD-01      -ELRRMSDEFQGSF-K-------------------------------GLP
H0WVR2_BAD-01          -ELRRMSDEFEDSFKK-------------------------------GLP
A0A2K6GWV0_BAD-01      -ELRRMSDEFEDSFKK-------------------------------GLP
H0V608_BAD-01          -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K5PDB1_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
U3F2S3_BAD-01          -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K5E6A6_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K6TG62_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K5M0A7_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A1D5QBW1_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K6E7I4_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K5XJR2_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A096MLD5_BAD-04      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K6N196_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K6PUL3_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K5HKU7_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A0D9R491_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
A0A2K5VCA1_BAD-01      -ELRRMSDEFVDSF-K-------------------------------GLP
B4DZQ9_BAD-01          -ELRRMSDEFVDSFKK-------------------------------GLP
A0A096MLD5_BAD-01      -ELRRMSDEFVDSFKK-------------------------------GLP
A0A2I2YFH2_BAD-01      -ELRRMSDEFVDSFKK-------------------------------GLP
A0A2I2YFH2_BAD-02      -ELRRMSDEFVDSFKK-------------------------------GLP
Q92934_BAD-01          -ELRRMSDEFVDSFKK-------------------------------GLP
Q92934_BAD-02          -ELRRMSDEFVDSFKK-------------------------------GLP
A0A2I3TBK7_BAD-02      -ELRRMSDEFVDSFKK-------------------------------GLP
A0A2R8Z674_BAD-01      -ELRRMSDEFVDSFKK-------------------------------GLP
A0A2J8TYJ3_BAD-01      -ELRRMSDEFVDSFKK-------------------------------GLP
A0A4X1VE31_BAD-01      -ELRRMSDEFQGSF-KVSARVGLYPRVSSQWAVPFESQGLSGSEVQAPLQ
A0A4X1VE31_BAD-02      -ELRRMSDEFQGSFKK-------------------------------GLP
A0A287AEF3_BAD-01      -ELRRMSDEFQGSFKK-------------------------------GLP
A0A4X1VE31_BAD-03      -ELRRMSDEFQGSF-K-------------------------------GLP
A0A671ELU4_BAD-01      -ELRRMSDEFEGSF-K-------------------------------GLP
A0A452ER54_BAD-01      -ELRRMSDEFHVSF-K-------------------------------GLP
G1MI17_BAD-01          -ELRRMSDEFQGSF-K-------------------------------GLP
A0A452RJM6_BAD-01      -ELRRMSDEFQGSF-K-------------------------------GLP
A0A384DJL2_BAD-01      -ELRRMSDEFQGSF-K-------------------------------GLP
M3YNE7_BAD-01          -ELRRMSDEFQGSF-K-------------------------------GLP
A0A667H8Z9_BAD-01      -ELRRMSDEFQGSF-K-------------------------------GLP
A0A673V6P8_BAD-01      -ELRRMSDEFQGSF-K-------------------------------GLP
A0A4W2C9A8_BAD-01      -ELRRMSDEFHVSF-K-------------------------------GLP
A0A4W2C9A8_BAD-01      -ELRRMSDEFHVSF-K-------------------------------GLP
F1MUT9_BAD-01          -ELRRMSDEFHVSF-K-------------------------------GLP
Q3SYZ0_BAD-01          -ELRRMSDEFHVSF-K-------------------------------GLP
A0A4U1FMC3_BAD-01      -ELRRMSDEFHGSF-K-------------------------------GLP
A0A2Y9EHU3_BAD-01      -ELRRMSDEFHGSF-K-------------------------------GLP
A0A6F9BAV3_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
A0A3P8YI30_BAD-02      -QLRRMSDEFDTWLDK------------------------------GEPK
A0A4W5R1T6_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
A0A060W8P9_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
B5X1T1_BAD-01          -QLRRMSDEFDTWLDK------------------------------GEPK
A0A673ZHY7_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEPK
A0A671NP27_BAD-01      -QLRRMSDEFDILLDK------------------------------G-MK
A0A672SAE4_BAD-01      -QLRRMSDEFDILLDK------------------------------G-MK
A0A672SAE4_BAD-02      -QLRRMSDEFDILLDK------------------------------G-MK
A0A671RUV0_BAD-01      -QLRRMSDEFDILLDK------------------------------G-MK
A0A673HRQ3_BAD-01      -QLRRMSDEFDILLDK------------------------------G-MK
A0A672RGH0_BAD-01      -QLRRMSDEFDILLDK------------------------------G-MK
Q4V925_BAD-03          -QLRRMSDEF----DK------------------------------G-MK
Q4V925_BAD-02          -QLRRMSDEF----DK------------------------------G-MK
A7MCM4_BAD-01          -QLRRMSDEF----DK------------------------------GQMK
Q4V925_BAD-01          -QLRRMSDEF----DK------------------------------GQMK
Q4V925_BAD-04          -QLRRMSDEF----DK------------------------------GQMK
A0A3B3QX41_BAD-01      -QLRRMSDEFDTLLDK------------------------------G-MK
A0A3Q3RXS8_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3Q0QNQ2_BAD-02      -QLRRMSDEFDSLLDK------------------------------GMKK
A0A3Q3WTY4_BAD-01      -RLRRMSDEF----DR------------------------------QEWK
A0A3P8Y761_BAD-01      -QLRRMSDEFDTWLDK------------------------------GQMK
A0A4W5JLL9_BAD-01      -QLRRMSDEFDTWLDK------------------------------GEMR
A0A3B5Q2N7_BAD-01      -QLRRMSDEFVNLLDK------------------------------GEMR
A0A087X8P8_BAD-01      -QLRRMSDEFVNLLDK------------------------------GEMR
A0A3B3UA11_BAD-01      -QLRRMSDEFVNLLDK------------------------------GEMR
A0A3B3YFR1_BAD-01      -QLRRMSDEFVNLLDK------------------------------GEMR
A0A3P9Q7C3_BAD-01      -QLRRMSDEFVNLLDK------------------------------GEMR
A0A3B3HDU2_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3P9KSL7_BAD-02      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3P9KSL7_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3B5BAL2_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMK
A0A665TUH3_BAD-01      -KLRRMSDEFDSLLDK------------------------------GEMR
A0A674MXC1_BAD-04      -QLRRMSDEFDSLLDK------------------------------GGMR
A0A674MXC1_BAD-01      -QLRRMSDEFDSLLDK------------------------------GGMR
A0A674MXC1_BAD-02      -QLRRMSDEFDSLLDK------------------------------GGMR
A0A674MXC1_BAD-03      -QLRRMSDEFDSLLDK------------------------------GGMR
A0A671TL42_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3Q3AEL8_BAD-02      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3Q3AEL8_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
A0A1A8AQV0_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMR
G3Q8B3_BAD-01          -QLRRMSDEFDSLLDK------------------------------GEMR
A0A3Q2Y0E4_BAD-01      -QLRRMSDEFDSLMDK------------------------------GELK
A0A3Q3R5S3_BAD-01      -QLRRMSDEFDSLLDK------------------------------GEMK
                                                                         

Q61337_BAD-09          SRHTHH---------------PVSLTAQCRA-----------SW------
Q2PG01_BAD-01          RPKSAG---------------TATQM-RQSS-----------SW------
A0A2I3H4B2_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
Q92934_BAD-05          RPKSAG---------------TATQM-RQSS-----------SW------
Q92934_BAD-06          RPKSAG--------------------------------------------
A0A670JUY4_BAD-01      RPKSAG---------------TATQM-RRTL-----------GW------
A0A670YRG7_BAD-01      RPKSAG---------------TCSHMDRPPP-----------SW------
Q6P7C5_BAD-01          ---------------------SIIFL-SHVP-------------------
A0A3B1JLM2_BAD-01      RTTGPG-------------------R-HTNR-----------GW------
A0A4W4DXF5_BAD-01      RVSSPG---------------KLSQK-QTNQ-----------GW------
A0A452IFQ4_BAD-01      RPKSAG---------------TTSQL-HRGN-----------SW------
A0A674I2R9_BAD-01      RPKSAG---------------TTSQL-HRGN-----------SW------
C1C3S9_BAD-01          RPKSAS---------------AATEM-TVSK-----------SF------
A0A6I8PXS6_BAD-01      RPKSAS---------------AAGQM-TGNR-----------SI------
A0A337SAW2_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A673J9C6_BAD-01      RVKSAG---------------TTRQM-QQSP-----------SW------
A0A4W5JLL9_BAD-02      RVKSAG---------------AAKQM-TKSP-----------SW------
A0A674DKC6_BAD-01      RVKSAG---------------AAKQM-TKSP-----------SW------
A0A3P8YI30_BAD-01      RGIIPG---------------RAKQV-YR-------------GW------
A0A3B4DUY7_BAD-01      RASSPG-----------------KQT-NR-------------GW------
A0A4W4HE29_BAD-01      RARSAG---------------AARQM-HTSP-----------SW------
A0A3B4CPH6_BAD-01      RVRSAG---------------AARQM-HASP-----------SW------
A0A674AVP9_BAD-01      RGIIPR----------------GGKQ-KVSR-----------GW------
A0A1S3L0Z2_BAD-01      RGIIPR----------------GGKQ-KVSR-----------GW------
B5XEF1_BAD-01          RGIIPR----------------GGKQ-KVSR-----------GW------
A0A4W5MZR2_BAD-01      RGISPG----------------GGKQ-KVSR-----------GW------
A0A060W8W7_BAD-01      RGISPG----------------GGKQ-KVSR-----------GW------
E7FBJ6_BAD-01          TP--------------------NSQK-QTYR-----------GW------
A0A673J5Q9_BAD-01      RA--------------------NSQK-QTYR-----------GW------
A0A671PX91_BAD-01      RA--------------------NSQK-QTYR-----------GW------
A0A672LB88_BAD-01      RA--------------------NSQK-QTYR-----------GW------
A0A673I6H5_BAD-01      RA--------------------NSQK-QTYR-----------GW------
A0A671SBB4_BAD-01      RA--------------------NSQK-QTYR-----------GW------
A0A672R7P6_BAD-01      RA--------------------NSQK-QTYR-----------GW------
A0A3P8Y761_BAD-02      RVKSAG---------------AAKQM-TTSP-----------SW------
A0A3B5L9R9_BAD-01      NVSSDG---------------SNRPI-HHSR-----------SW------
H3D8J8_BAD-01          KTSSAG---------------SARQM-HHSR-----------SW------
A0A6F9CQZ0_BAD-02      QLKSVG---------------AAKQM-TQSP-----------SW------
A0A6F9CA11_BAD-02      RVKSAG---------------AAKQM-TKSP-----------SW------
A0A1S3N9Q3_BAD-01      RVKSAG---------------AAKQM-TKSP-----------SW------
A0A3Q2QC80_BAD-01      KVSSAG---------------TNRPI-HHSR-----------SW------
A0A3Q3FKT9_BAD-02      KGGGGGSRGGCGLVVESVVSQPKSQE-FNTQ-----------LLQPHVRC
A0A3Q3FKT9_BAD-03      KVRSPG---------------PAKQM-HHSK-----------SW------
A0A667ZNC6_BAD-01      RVRSAG---------------TAKQM-QHSK-----------SW------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      ----------------------LKKL-HHSK-----------TW------
I3K7B6_BAD-01          ----------------------LKKL-HHSK-----------TW------
A0A3Q3C680_BAD-01      ----------------------VKKL-HHSK-----------TW------
A0A3P8QRJ7_BAD-01      ----------------------VKKL-HHSK-----------TW------
A0A3Q4GGN3_BAD-01      ----------------------LKKL-HHSK-----------TW------
A0A3B4GXJ6_BAD-01      ----------------------VKKL-HHSK-----------TW------
A0A3Q2D5S0_BAD-01      KVSSTG---------------TNRPI-RHSK-----------SW------
A0A3Q0QNQ2_BAD-01      KAKNAG---------------TTRKM-HHSK-----------TW------
A0A3P8WI83_BAD-01      KVKSAG---------------TARQM-HHSK-----------SW------
A0A3P8WI83_BAD-02      KVKSAG---------------TARQM-HHSK-----------SW------
A0A3P9HNZ2_BAD-01      KVRSTG---------------AAKQM-LHST-----------SW------
A0A3B3BQF7_BAD-01      KVRSAG---------------ATKQM-HHST-----------SW------
A0A4W6EMZ7_BAD-02      RVKSAT---------------TTRQM-HHSK-----------SW------
A0A672JQ68_BAD-01      KLRNPG---------------QARQI-HHSR-----------SW------
A0A2U9BAC9_BAD-01      KVKSAG---------------TARQM-HHSQ-----------SW------
A0A4W6EMZ7_BAD-01      RVKSAT---------------TTRQM-HHSK-----------SW------
A0A3B4VFC5_BAD-01      KVKSAG---------------TAKQM-HHSK-----------SW------
A0A3B4W9T1_BAD-01      KVKSAG---------------TAKQM-HHSK-----------SW------
A0A3Q1K1C7_BAD-01      KVRSAG---------------TARQM-HHSK-----------SW------
A0A672YF93_BAD-01      RVRSAG---------------TARQM-HHSK-----------TW------
A0A3Q1GWH9_BAD-01      RVRSAG---------------TARQM-HHSK-----------SW------
A0A3Q1CPU7_BAD-01      RVRSAG---------------TARQM-HHSK-----------SW------
A0A3P8TWH6_BAD-01      RVRSAG---------------TARQM-HHSK-----------SW------
A0A3Q3FKT9_BAD-01      QPKSQE---------------FNTQL-LQPHVRCVLGSLNVYKW------
A0A3B1IH05_BAD-01      RVRSAG---------------AARQM-QNSP-----------SW------
A0A5F8GA49_BAD-01      RPKSAG---------------TASQM-RRSH-----------GW------
H3ANP3_BAD-03          RPKSAG---------------AAGEM-VDES-----------WW------
H3ANP3_BAD-04          RPKSAG---------------AAGEM-VDES-----------WW------
H3ANP3_BAD-01          RPKSAG---------------AAGEM-VDES-----------WW------
H3ANP3_BAD-02          RPKSAG---------------AAGEM-VDES-----------WW------
G3VRY3_BAD-01          RPKSAG---------------TASQM-RRSH-----------GW------
G3VRY3_BAD-02          RPKSAG---------------TASQM-RRSH-----------GW------
G3VRY3_BAD-03          RPKSAG---------------TASQM-RRSH-----------GW------
A0A4X2KAA5_BAD-01      RPKSAG---------------TASQM-RRSH-----------GW------
A0A672V9F8_BAD-01      RASSAG---------------GA-------G-----------GW------
A0A674GQ16_BAD-01      RPRSVG---------------GAPP---GGG-----------GW------
A0A6I8NVP2_BAD-01      RPKSAG---------------TAAQL-QRPS-----------GW------
G3TP47_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
Q61337_BAD-05          SVRCDG---------------T----------------------------
Q61337_BAD-04          RPKSAG---------------TATQM-RQSA-----------GW------
Q61337_BAD-06          RPKSAG---------------TATQM-RQSA-----------GW------
Q61337_BAD-03          RPKSAG---------------TATQM-RQSA-----------GW------
Q61337_BAD-02          -----------------------EEL-TYSL-----------SP------
Q61337_BAD-01          RPKSAG---------------TATQM-RQSA-----------GW------
A0A287CT05_BAD-01      RPRSAG---------------TASQM-RQSS-----------SW------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          RPKSAG---------------TATKL-WQSS-----------SW------
G5B6Q3_BAD-02          RPKSAG---------------TATKL-WQSS-----------SW------
A0A2I3TBK7_BAD-01      VPTALG---------------SHLEY-GR---------------------
A0A2R8Z674_BAD-02      VPTALG---------------SHLEY-GR---------------------
A0A2I2YFH2_BAD-03      VPTALG---------------SHLEY-GR---------------------
Q92934_BAD-03          VPTALG---------------SHLEY-GR---------------------
A0A2K5M0A7_BAD-02      ALTVLV---------------GHLGY-GR---------------------
A0A2K5XJR2_BAD-02      ALTVLV---------------GHLGY-GR---------------------
A0A096MLD5_BAD-03      ALTVLV---------------GHLGY-GR---------------------
A0A2K6E7I4_BAD-02      ALTVLV---------------GHLGY-GR---------------------
A0A2K5PDB1_BAD-02      ALIALS---------------GHLGY-GR---------------------
A0A2K5E6A6_BAD-02      VPIALG---------------GHLGY-GR---------------------
A0A2K6TG62_BAD-02      APIALG---------------GHLGH-GR---------------------
A0A2K5HKU7_BAD-02      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A2K6N196_BAD-02      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A2K6PUL3_BAD-02      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A2K5M0A7_BAD-03      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A2K5XJR2_BAD-03      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A096MLD5_BAD-02      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A2K6E7I4_BAD-03      TPRGRR---------------RTKGW-RRSP-----------AP------
A0A2I2YFH2_BAD-04      TPRGRR---------------TTKGW-GRSP-----------AP------
Q92934_BAD-04          TPRGRR---------------TTKGW-GRSP-----------AP------
A0A2I3TBK7_BAD-03      TPRGRR---------------TTKGW-GRSP-----------AP------
A0A2R8Z674_BAD-03      TPRGRR---------------TTKGW-GRSP-----------AP------
A0A2K5E6A6_BAD-03      TPQGRR---------------RTKGW-RRSP-----------AP------
A0A2K5PDB1_BAD-03      TPQGRR---------------RTKGW-RRSP-----------AP------
A0A2K6TG62_BAD-03      TPQGRR---------------GTKGW-RRSP-----------AL------
G1P8C5_BAD-01          RPKSAG---------------TATQM-WQKS-----------SW------
A0A452ER54_BAD-02      RPKSAG---------------TATQM-RQSP-----------SW------
W5P8G9_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
Q61337_BAD-07          ---MLG---------------LAVLI-RPLS-----------VS------
O35147_BAD-01          RPKSAG---------------TATQM-RQSA-----------SW------
F7DN67_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
Q45KI9_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
A0A3Q7SWS0_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
H0WVR2_BAD-01          RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K6GWV0_BAD-01      RPKSAG---------------TATQI-RQSS-----------SW------
H0V608_BAD-01          RPKSAG---------------TATKL-WQNS-----------NW------
A0A2K5PDB1_BAD-01      RPKSAG---------------TATQM-RQSA-----------SW------
U3F2S3_BAD-01          RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K5E6A6_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K6TG62_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K5M0A7_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A1D5QBW1_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K6E7I4_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K5XJR2_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A096MLD5_BAD-04      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K6N196_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K6PUL3_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K5HKU7_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A0D9R491_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2K5VCA1_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
B4DZQ9_BAD-01          RPKSAG---------------TATQM-RQSP-----------RR------
A0A096MLD5_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2I2YFH2_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2I2YFH2_BAD-02      RPKSAG---------------TATQM-RQSS-----------SW------
Q92934_BAD-01          RPKSAG---------------TATQM-RQSS-----------SW------
Q92934_BAD-02          RPKSAG---------------TATQM-RQSS-----------SW------
A0A2I3TBK7_BAD-02      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2R8Z674_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A2J8TYJ3_BAD-01      RPKSAG---------------TATQM-RQSS-----------SW------
A0A4X1VE31_BAD-01      KAKTPG---------------FPKSL-KREA-----------GW------
A0A4X1VE31_BAD-02      RPKSAG---------------TATQM-RQSP-----------SW------
A0A287AEF3_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A4X1VE31_BAD-03      RPKSAG---------------TATQM-RQSP-----------SW------
A0A671ELU4_BAD-01      RPKSAG---------------TATQM-RQNS-----------SW------
A0A452ER54_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
G1MI17_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
A0A452RJM6_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A384DJL2_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
M3YNE7_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
A0A667H8Z9_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A673V6P8_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A4W2C9A8_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A4W2C9A8_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
F1MUT9_BAD-01          RPKSAG---------------TATQM-RQSP-----------SW------
Q3SYZ0_BAD-01          RPKSAG---------------TATEM-RQSP-----------SW------
A0A4U1FMC3_BAD-01      RPNSAG---------------TATQM-RQSP-----------SW------
A0A2Y9EHU3_BAD-01      RPKSAG---------------TATQM-RQSP-----------SW------
A0A6F9BAV3_BAD-01      RGISPG---------------GCKQ--KVSR-----------GW------
A0A3P8YI30_BAD-02      RGIIPG---------------RAKQ---VYR-----------GW------
A0A4W5R1T6_BAD-01      RGISPG---------------GIKQ--EVSR-----------GW------
A0A060W8P9_BAD-01      RGISPG---------------GVKQ--EVSR-----------GW------
B5X1T1_BAD-01          RGISPG---------------GVKQ--EVSR-----------GW------
A0A673ZHY7_BAD-01      RGISPG---------------GVKQ--EVSR-----------GW------
A0A671NP27_BAD-01      RVKSAG---------------TTRQM-QQSP-----------SW------
A0A672SAE4_BAD-01      RVKSAG---------------TTRQM-QQSP-----------SW------
A0A672SAE4_BAD-02      RVKSAG---------------TTRQM-QQSP-----------SW------
A0A671RUV0_BAD-01      RVKSAG---------------TTRQM-RQSP-----------SW------
A0A673HRQ3_BAD-01      RVKSAG---------------TTRQM-RQSP-----------SW------
A0A672RGH0_BAD-01      RVKSAG---------------TTRQM-RQSP-----------SW------
Q4V925_BAD-03          RVKSAG---------------TARQM-SQSP-----------SW------
Q4V925_BAD-02          RVKSAG---------------TARQM-SQSP-----------SW------
A7MCM4_BAD-01          RVKSAG---------------TARQM-SQSP-----------SW------
Q4V925_BAD-01          RVKSAG---------------TARQM-SQSP-----------SW------
Q4V925_BAD-04          RVKSAG---------------TARQM-SQSP-----------SW------
A0A3B3QX41_BAD-01      RVRSAG---------------AARQM-QASP-----------SW------
A0A3Q3RXS8_BAD-01      -VRNAG---------------KAQKM-HHSK-----------TW------
A0A3Q0QNQ2_BAD-02      -AKNAG---------------TTRKM-HHSK-----------TW------
A0A3Q3WTY4_BAD-01      -TRSAG---------------TATQM-HQSR-----------SW------
A0A3P8Y761_BAD-01      RVKSAG---------------AAKQM-TTSP-----------SW------
A0A4W5JLL9_BAD-01      RVKSAG---------------AAKQM-TKSP-----------SW------
A0A3B5Q2N7_BAD-01      NVSSDG---------------SNRPI-HHSR-----------SW------
A0A087X8P8_BAD-01      KVSSTG---------------SNRPI-HHSR-----------SW------
A0A3B3UA11_BAD-01      KVSSTG---------------SNRPI-HHSR-----------SW------
A0A3B3YFR1_BAD-01      KVSSTG---------------SNRPI-HHSR-----------SW------
A0A3P9Q7C3_BAD-01      KVSSAG---------------SNGPI-HHSR-----------SW------
A0A3B3HDU2_BAD-01      KVRSTG---------------AAKQM-LHST-----------SW------
A0A3P9KSL7_BAD-02      KVRSTG---------------AAKQM-LHST-----------SW------
A0A3P9KSL7_BAD-01      KVRSTG---------------AAKQM-LHST-----------SW------
A0A3B5BAL2_BAD-01      RVRSAG---------------TAKQM-HHSK-----------SW------
A0A665TUH3_BAD-01      KVKSVG---------------SAKQM-HHSK-----------SW------
A0A674MXC1_BAD-04      KTNSTG---------------STKPM-HHSR-----------SW------
A0A674MXC1_BAD-01      KTNSTG---------------STKPM-HHSR-----------SW------
A0A674MXC1_BAD-02      KTNSTG---------------STKPM-HHSR-----------SW------
A0A674MXC1_BAD-03      KTNSTG---------------STKPM-HHSR-----------SW------
A0A671TL42_BAD-01      KVKSAG---------------TPKQM-HHSR-----------SW------
A0A3Q3AEL8_BAD-02      KVKSAG---------------TTKQI-HHSR-----------SW------
A0A3Q3AEL8_BAD-01      KVKSAG---------------TTKQI-HHSR-----------SW------
A0A1A8AQV0_BAD-01      KVRSAG---------------STKPM-HHSR-----------SW------
G3Q8B3_BAD-01          RVKSAG---------------TTKQM-QHSK-----------SW------
A0A3Q2Y0E4_BAD-01      FKSAGG---------------TSRAI-HHSK-----------TW------
A0A3Q3R5S3_BAD-01      RVRSAG---------------AASQM-HHSK-----------SW------
                                                                         

Q61337_BAD-09          --------------------WWGP-----------------------DSG
Q2PG01_BAD-01          ---------TRVF-----QSWWDR-----------------------NLG
A0A2I3H4B2_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
Q92934_BAD-05          ---------TR---------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      ---------KEVL-----QSWWRR-----------------------NSP
A0A670YRG7_BAD-01      ---------KDTL-----RSWWLY-----------------------SGS
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      ---------FSFL-------WGTK-----------------------EEE
A0A4W4DXF5_BAD-01      ---------FSFL-------WCSK-----------------------EEE
A0A452IFQ4_BAD-01      ---------KETL-----QAWLGH-----------------------RPA
A0A674I2R9_BAD-01      ---------KETL-----QAWLGH-----------------------RPA
C1C3S9_BAD-01          ---------GETF-----FNFFRR-----------------------KNK
A0A6I8PXS6_BAD-01      ---------RDLI-----MGLFSR-----------------------RKS
A0A337SAW2_BAD-01      ---------TRFI-------QSWW-----------------------DRN
A0A673J9C6_BAD-01      ---------FAFL-------WSHK-----------------------ESD
A0A4W5JLL9_BAD-02      ---------WAYL-------FSHK-----------------------ETE
A0A674DKC6_BAD-01      ---------WAYL-------FSHK-----------------------ETE
A0A3P8YI30_BAD-01      ---------FSFL-------WSPK-----------------------EAE
A0A3B4DUY7_BAD-01      ---------FSFL-------WGSK-----------------------EEE
A0A4W4HE29_BAD-01      ---------FAFL-------WSHK-----------------------ESD
A0A3B4CPH6_BAD-01      ---------FTFL-------WSHK-----------------------ESD
A0A674AVP9_BAD-01      ---------FSFL-------WSPK-----------------------EAE
A0A1S3L0Z2_BAD-01      ---------FSFL-------WSPK-----------------------EAE
B5XEF1_BAD-01          ---------FSFL-------WSPK-----------------------EAE
A0A4W5MZR2_BAD-01      ---------FSFL-------WSPK-----------------------EAE
A0A060W8W7_BAD-01      ---------FSFL-------WSPK-----------------------EAE
E7FBJ6_BAD-01          ---------FSFL-------WSPK-----------------------EEE
A0A673J5Q9_BAD-01      ---------FSFL-------WSPK-----------------------EEE
A0A671PX91_BAD-01      ---------FSFL-------WSPK-----------------------EEE
A0A672LB88_BAD-01      ---------FSFL-------WSSK-----------------------EEE
A0A673I6H5_BAD-01      ---------FSFL-------WSSK-----------------------EEE
A0A671SBB4_BAD-01      ---------FSFL-------LSSK-----------------------EEE
A0A672R7P6_BAD-01      ---------FSFL-------WSSK-----------------------DEE
A0A3P8Y761_BAD-02      ---------WAFL-------FSHK-----------------------ETE
A0A3B5L9R9_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
H3D8J8_BAD-01          ---------WSYL-------FSHQ-----------------------ETE
A0A6F9CQZ0_BAD-02      ---------WAYL-------FSHQ-----------------------ETE
A0A6F9CA11_BAD-02      ---------WAYL-------FSHQ-----------------------ETE
A0A1S3N9Q3_BAD-01      ---------WAYL-------FSHK-----------------------ETE
A0A3Q2QC80_BAD-01      ---------WNYL-------FSHQ-----------------------ETE
A0A3Q3FKT9_BAD-02      VLGSLNVYKWDYL-------ILII-----------------------TLH
A0A3Q3FKT9_BAD-03      ---------WSYL-------FSHQ-----------------------ETE
A0A667ZNC6_BAD-01      ---------WNYL-------FSHQ-----------------------ETE
A0A3P9B2E4_BAD-01      --------------------VRMG-----------------------VSQ
A0A668V3Q4_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
I3K7B6_BAD-01          ---------WSYL-------FSHQ-----------------------ETE
A0A3Q3C680_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3P8QRJ7_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3Q4GGN3_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3B4GXJ6_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3Q2D5S0_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A3Q0QNQ2_BAD-01      ---------WSYL-------FSHQ-----------------------ESD
A0A3P8WI83_BAD-01      ---------WSYL-------FSHQ-----------------------ELE
A0A3P8WI83_BAD-02      ---------WSYL-------FSHQ-----------------------ELE
A0A3P9HNZ2_BAD-01      ---------WNYL-------FSHP-----------------------EAE
A0A3B3BQF7_BAD-01      ---------WNYL-------FSHP-----------------------EAE
A0A4W6EMZ7_BAD-02      ---------WSYL-------FSHQ-----------------------ETE
A0A672JQ68_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A2U9BAC9_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A4W6EMZ7_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3B4VFC5_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3B4W9T1_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3Q1K1C7_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A672YF93_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A3Q1GWH9_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A3Q1CPU7_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A3P8TWH6_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A3Q3FKT9_BAD-01      ---------DYLILIITLHSSL----------------------------
A0A3B1IH05_BAD-01      ---------FAFL-------WSHK-----------------------ESD
A0A5F8GA49_BAD-01      ---------TRTV-----QSWFGR-----------------------NLG
H3ANP3_BAD-03          ---------KKLI-----RSLKGR-------------------------G
H3ANP3_BAD-04          ---------KKLI-----RSLKGR-------------------------G
H3ANP3_BAD-01          ---------KKLI-----RSLKGR-------------------------G
H3ANP3_BAD-02          ---------KKLI-----RSLKGR-------------------------G
G3VRY3_BAD-01          ---------TRTF-----QSWFGR-----------------------NLG
G3VRY3_BAD-02          ---------TRTF-----QSWFGR-----------------------NLG
G3VRY3_BAD-03          ---------TRTF-----QSWFGR-----------------------NLG
A0A4X2KAA5_BAD-01      ---------ARTF-----QSWLSR-----------------------SLG
A0A672V9F8_BAD-01      ---------REVL-----RSWWGAPPPPRPRPAATPPLTAPPRVPPPRFG
A0A674GQ16_BAD-01      ---------RETL-----RAWWGS-RRPRPAPPAPPPDRPPPQ--KPHLG
A0A6I8NVP2_BAD-01      ---------TRVL-----RSWWNR-----------------------SSS
G3TP47_BAD-01          ---------TRII-----QAWWDR-----------------------NLG
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          ---------TRII-----QSWWDR-----------------------NLG
Q61337_BAD-06          ---------TRII-----QSWWDR-----------------------NLG
Q61337_BAD-03          ---------TRII-----QSWWDR-----------------------NLG
Q61337_BAD-02          ---------FRCV-----Q-------------------------------
Q61337_BAD-01          ---------TRII-----QSWWDR-----------------------NLG
A0A287CT05_BAD-01      ---------TRFI-----QSWWDR-----------------------NLG
A0A287CT05_BAD-02      ---------VTFS-----QSPFLR-----------------------A--
G5B6Q3_BAD-01          ---------TRAI-----QSWWDR-----------------------NLG
G5B6Q3_BAD-02          ---------TRAI-----QSWWDR-----------------------NLG
A0A2I3TBK7_BAD-01      ------------------KYFPQA-----------------------YAK
A0A2R8Z674_BAD-02      ------------------KYFPQA-----------------------YAK
A0A2I2YFH2_BAD-03      ------------------KYFPQA-----------------------YAK
Q92934_BAD-03          ------------------KYFPQA-----------------------YAK
A0A2K5M0A7_BAD-02      ------------------KCFPQA-----------------------LCK
A0A2K5XJR2_BAD-02      ------------------KCFPQA-----------------------SCK
A0A096MLD5_BAD-03      ------------------KCFPQA-----------------------LCK
A0A2K6E7I4_BAD-02      ------------------KCFPQA-----------------------LCK
A0A2K5PDB1_BAD-02      ------------------KCFLQ---------------------------
A0A2K5E6A6_BAD-02      ------------------KCFLQ---------------------------
A0A2K6TG62_BAD-02      ------------------KCFLQ---------------------------
A0A2K5HKU7_BAD-02      ---------FGAA-----RAPRPL-----------------------TSG
A0A2K6N196_BAD-02      ---------FGAA-----RAPRPL-----------------------TSG
A0A2K6PUL3_BAD-02      ---------FGAA-----RAPRPL-----------------------TSG
A0A2K5M0A7_BAD-03      ---------FGAA-----RAPRPP-----------------------TSG
A0A2K5XJR2_BAD-03      ---------FGAA-----RAPRPP-----------------------TSG
A0A096MLD5_BAD-02      ---------FGAA-----RAPRPP-----------------------TSG
A0A2K6E7I4_BAD-03      ---------FGAA-----RAPRPP-----------------------TSG
A0A2I2YFH2_BAD-04      ---------FGAA-----RARRPP-----------------------TSG
Q92934_BAD-04          ---------FGAA-----RARRPP-----------------------TSG
A0A2I3TBK7_BAD-03      ---------FGAA-----RARRPP-----------------------TSG
A0A2R8Z674_BAD-03      ---------FGAA-----RARRPP-----------------------TSG
A0A2K5E6A6_BAD-03      ---------FGAV-----RAQHPP-----------------------TSG
A0A2K5PDB1_BAD-03      ---------FGAV-----RARHPP-----------------------TSG
A0A2K6TG62_BAD-03      ---------FGAV-----RARHPP-----------------------TSG
G1P8C5_BAD-01          ---------TRFF-----QSWWDR-----------------------NSG
A0A452ER54_BAD-02      ---------TRFL-----QSWLSR-----------------------NLG
W5P8G9_BAD-01          ---------TRFL-----QSWLSR-----------------------NLG
Q61337_BAD-07          ---------SDLLGFPPSSSFVQD-----------------------PVP
O35147_BAD-01          ---------TRII-----QSWWDR-----------------------NLG
F7DN67_BAD-01          ---------TRAI-----QSWWDR-----------------------NLG
Q45KI9_BAD-01          ---------TRVI-----QSWWDR-----------------------NLG
A0A3Q7SWS0_BAD-01      ---------TRVI-----QSWWDR-----------------------NLG
H0WVR2_BAD-01          ---------TRVI-----QSWWDR-----------------------NVG
A0A2K6GWV0_BAD-01      ---------TRVI-----QSWWDR-----------------------NVG
H0V608_BAD-01          ---------TRAI-----QSWWDR-----------------------NLG
A0A2K5PDB1_BAD-01      ---------TRVI-----QSWWDR-----------------------NLG
U3F2S3_BAD-01          ---------TRVI-----QSWWDR-----------------------NLG
A0A2K5E6A6_BAD-01      ---------TQVI-----QSWWDR-----------------------NLG
A0A2K6TG62_BAD-01      ---------TRVI-----QSWWDR-----------------------NLG
A0A2K5M0A7_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A1D5QBW1_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2K6E7I4_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2K5XJR2_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A096MLD5_BAD-04      ---------TRVF-----QSWWDR-----------------------NLG
A0A2K6N196_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2K6PUL3_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2K5HKU7_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A0D9R491_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2K5VCA1_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
B4DZQ9_BAD-01          ---------LR---------------------------------------
A0A096MLD5_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2I2YFH2_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2I2YFH2_BAD-02      ---------TRVF-----QSWWDR-----------------------NLG
Q92934_BAD-01          ---------TRVF-----QSWWDR-----------------------NLG
Q92934_BAD-02          ---------TRVF-----QSWWDR-----------------------NLG
A0A2I3TBK7_BAD-02      ---------TRVF-----QSWWDR-----------------------NLG
A0A2R8Z674_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A2J8TYJ3_BAD-01      ---------TRVF-----QSWWDR-----------------------NLG
A0A4X1VE31_BAD-01      -----------------------------------------------HLG
A0A4X1VE31_BAD-02      ---------KRFL-----QSWWYR-----------------------NSG
A0A287AEF3_BAD-01      ---------KRFL-----QSWWYR-----------------------NSG
A0A4X1VE31_BAD-03      ---------KRFL-----QSWWYR-----------------------NSG
A0A671ELU4_BAD-01      ---------TRIF-----QSLW----------------------------
A0A452ER54_BAD-01      ---------TRFL-----QSWLSR-----------------------NLG
G1MI17_BAD-01          ---------TRVI-----QSWWDR-----------------------NLG
A0A452RJM6_BAD-01      ---------TRVI-----QSWWDR-----------------------NLG
A0A384DJL2_BAD-01      ---------TRVI-----QSWWDR-----------------------NLG
M3YNE7_BAD-01          ---------TRVI-----QSWWDR-----------------------NLG
A0A667H8Z9_BAD-01      ---------TRFI-----QSWWDR-----------------------NLG
A0A673V6P8_BAD-01      ---------TRFI-----QSWWDR-----------------------NLG
A0A4W2C9A8_BAD-01      ---------TRFL-----QSWLSR-----------------------NLG
A0A4W2C9A8_BAD-01      ---------TRFL-----QSWLSR-----------------------NLG
F1MUT9_BAD-01          ---------TRFL-----QSWLSR-----------------------NLG
Q3SYZ0_BAD-01          ---------TRFL-----QSWLSR-----------------------NLG
A0A4U1FMC3_BAD-01      ---------TRFL-----QSWWNR-----------------------NLG
A0A2Y9EHU3_BAD-01      ---------TRFL-----QSWWNR-----------------------NLG
A0A6F9BAV3_BAD-01      ---------FSFL-------WSPK-----------------------EAE
A0A3P8YI30_BAD-02      ---------FSFL-------WSPK-----------------------EAE
A0A4W5R1T6_BAD-01      ---------FSFL-------WSPK-----------------------ESE
A0A060W8P9_BAD-01      ---------FSFL-------WSPN-----------------------EAE
B5X1T1_BAD-01          ---------FSFL-------WSPK-----------------------KAE
A0A673ZHY7_BAD-01      ---------FSFL-------WSPK-----------------------KAE
A0A671NP27_BAD-01      ---------FAFL-------WSHK-----------------------ESD
A0A672SAE4_BAD-01      ---------FAFL-------WSHK-----------------------ESD
A0A672SAE4_BAD-02      ---------FAFL-------WSHK-----------------------ESD
A0A671RUV0_BAD-01      ---------LAFL-------WSHK-----------------------ESD
A0A673HRQ3_BAD-01      ---------LAFL-------WSHK-----------------------ESD
A0A672RGH0_BAD-01      ---------LAFL-------WSHK-----------------------ESD
Q4V925_BAD-03          ---------LAFL-------WSHK-----------------------ESD
Q4V925_BAD-02          ---------LAFL-------WSHK-----------------------ESD
A7MCM4_BAD-01          ---------LAFL-------WSHK-----------------------ESD
Q4V925_BAD-01          ---------LAFL-------WSHK-----------------------ESD
Q4V925_BAD-04          ---------LAFL-------WSHK-----------------------ESD
A0A3B3QX41_BAD-01      ---------FAFL-------WSHK-----------------------ESD
A0A3Q3RXS8_BAD-01      ---------WSYL-------FSYQ-----------------------ETD
A0A3Q0QNQ2_BAD-02      ---------WSYL-------FSHQ-----------------------ESD
A0A3Q3WTY4_BAD-01      ---------WSYL-------FSHQ-----------------------ETD
A0A3P8Y761_BAD-01      ---------WAFL-------FSHK-----------------------ETE
A0A4W5JLL9_BAD-01      ---------WAYL-------FSHK-----------------------ETE
A0A3B5Q2N7_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A087X8P8_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3B3UA11_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3B3YFR1_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3P9Q7C3_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3B3HDU2_BAD-01      ---------WNYL-------FSHP-----------------------EAE
A0A3P9KSL7_BAD-02      ---------WNYL-------FSHP-----------------------EAE
A0A3P9KSL7_BAD-01      ---------WNYL-------FSHP-----------------------EAE
A0A3B5BAL2_BAD-01      ---------WSYL-------FSHQ-----------------------ELE
A0A665TUH3_BAD-01      ---------WNYL-------FSHQ-----------------------ETE
A0A674MXC1_BAD-04      ---------WSYL-------FSHQ-----------------------ETE
A0A674MXC1_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A674MXC1_BAD-02      ---------WSYL-------FSHQ-----------------------ETE
A0A674MXC1_BAD-03      ---------WSYL-------FSHQ-----------------------ETE
A0A671TL42_BAD-01      ---------WSYL-------FSHQ-----------------------EME
A0A3Q3AEL8_BAD-02      ---------WNYL-------FSHQ-----------------------ETD
A0A3Q3AEL8_BAD-01      ---------WNYL-------FSHQ-----------------------ETD
A0A1A8AQV0_BAD-01      ---------WNYL-------FSHQ-----------------------ESD
G3Q8B3_BAD-01          ---------WSSL-------FSHQ-----------------------EME
A0A3Q2Y0E4_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
A0A3Q3R5S3_BAD-01      ---------WSYL-------FSHQ-----------------------ETE
                                                                         

Q61337_BAD-09          CQNEAHSFLLLP--------------------------------------
Q2PG01_BAD-01          R---------GSSAPSQ---------------------------------
A0A2I3H4B2_BAD-01      R---------GSSAPSQ---------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      G---------NGPRSPP---------------------------------
A0A670YRG7_BAD-01      DIMALSRFSPSAPSTLN---------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      GRE-----------------------------------------------
A0A4W4DXF5_BAD-01      GRK-----------------------------------------------
A0A452IFQ4_BAD-01      RDALPRSSK-----------------------------------------
A0A674I2R9_BAD-01      RDAPPRSSK-----------------------------------------
C1C3S9_BAD-01          DRSQSENDKH----------------------------------------
A0A6I8PXS6_BAD-01      KGRDESGDEE----------------------------------------
A0A337SAW2_BAD-01      LGRGGSAPSQ----------------------------------------
A0A673J9C6_BAD-01      AESRP------AE-------------------------------------
A0A4W5JLL9_BAD-02      TEHTPTIPPRSSE-------------------------------------
A0A674DKC6_BAD-01      TEHTPTIPPRSSE-------------------------------------
A0A3P8YI30_BAD-01      GRD-----------------------------------------------
A0A3B4DUY7_BAD-01      GRE-----------------------------------------------
A0A4W4HE29_BAD-01      TETSSSVTAPDTRPAE----------------------------------
A0A3B4CPH6_BAD-01      SEASSSLTAPDTRPAE----------------------------------
A0A674AVP9_BAD-01      GRE-----------------------------------------------
A0A1S3L0Z2_BAD-01      GRE-----------------------------------------------
B5XEF1_BAD-01          GRE-----------------------------------------------
A0A4W5MZR2_BAD-01      GRE-----------------------------------------------
A0A060W8W7_BAD-01      GRE-----------------------------------------------
E7FBJ6_BAD-01          GRE-----------------------------------------------
A0A673J5Q9_BAD-01      GRE-----------------------------------------------
A0A671PX91_BAD-01      GRE-----------------------------------------------
A0A672LB88_BAD-01      GRE-----------------------------------------------
A0A673I6H5_BAD-01      GRE-----------------------------------------------
A0A671SBB4_BAD-01      GRE-----------------------------------------------
A0A672R7P6_BAD-01      GRE-----------------------------------------------
A0A3P8Y761_BAD-02      TEKTPNLIITEPRSSE----------------------------------
A0A3B5L9R9_BAD-01      GENNHHENHAS-RTE-----------------------------------
H3D8J8_BAD-01          SENNHHD-------------------------------------------
A0A6F9CQZ0_BAD-02      TEHSPNLTAPEPR-------------------------------------
A0A6F9CA11_BAD-02      TEHTSTIPPRSSE-------------------------------------
A0A1S3N9Q3_BAD-01      TEHTPTIPPRSSE-------------------------------------
A0A3Q2QC80_BAD-01      GENSHHENHAP-RTE-----------------------------------
A0A3Q3FKT9_BAD-02      SSL-----------------------------------------------
A0A3Q3FKT9_BAD-03      GENNHHENHTH-RNE-----------------------------------
A0A667ZNC6_BAD-01      GETSHHENHSN-RTE-----------------------------------
A0A3P9B2E4_BAD-01      GLN-----------------------------------------------
A0A668V3Q4_BAD-01      GENNHLENHNQ-RTE-----------------------------------
I3K7B6_BAD-01          GENNHLENHNQ-RTE-----------------------------------
A0A3Q3C680_BAD-01      GENNHLENHNQ-RTE-----------------------------------
A0A3P8QRJ7_BAD-01      GENNHLENHNQ-RTE-----------------------------------
A0A3Q4GGN3_BAD-01      GENNHLENHNQ-RTE-----------------------------------
A0A3B4GXJ6_BAD-01      GENNHLENHNQ-RTE-----------------------------------
A0A3Q2D5S0_BAD-01      GENSHHENHTQ-CTEQRGE-------------------------------
A0A3Q0QNQ2_BAD-01      GENSHHENHTQ-RTE-----------------------------------
A0A3P8WI83_BAD-01      GENNHHENHTH-RTE-----------------------------------
A0A3P8WI83_BAD-02      GENNHHENHTH-RTE-----------------------------------
A0A3P9HNZ2_BAD-01      GEYSHHESQ---RTE-----------------------------------
A0A3B3BQF7_BAD-01      GEYSHHESH---RTE-----------------------------------
A0A4W6EMZ7_BAD-02      GENNHHENHTH-RTE-----------------------------------
A0A672JQ68_BAD-01      GENNHHENHSHDRTE-----------------------------------
A0A2U9BAC9_BAD-01      GENNHHENHTQ-RNE-----------------------------------
A0A4W6EMZ7_BAD-01      GENNHHENHTH-RTE-----------------------------------
A0A3B4VFC5_BAD-01      GENNHHENHTH-RTE-----------------------------------
A0A3B4W9T1_BAD-01      GENNHHENHTH-RTE-----------------------------------
A0A3Q1K1C7_BAD-01      GENNHHESHTH-RTE-----------------------------------
A0A672YF93_BAD-01      GENSHHENHKN-RTE-----------------------------------
A0A3Q1GWH9_BAD-01      GENNHHESHTH-RNE-----------------------------------
A0A3Q1CPU7_BAD-01      GENNHHESHTH-RNE-----------------------------------
A0A3P8TWH6_BAD-01      GENNHHESHTH-RNE-----------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      SEASSS----RPAE------------------------------------
A0A5F8GA49_BAD-01      KGGA------GPSH------------------------------------
H3ANP3_BAD-03          QPRD------PPGQ------------------------------------
H3ANP3_BAD-04          QPRD------PPGQ------------------------------------
H3ANP3_BAD-01          QPRD------PPGQQGVSIRGPD---------------------------
H3ANP3_BAD-02          QPRD------PPGQQGVSIRGPD---------------------------
G3VRY3_BAD-01          KGS-V-----GPSH------------------------------------
G3VRY3_BAD-02          KGS-V-----GPSH------------------------------------
G3VRY3_BAD-03          KGS-V-----GPSH------------------------------------
A0A4X2KAA5_BAD-01      KGSAA-----GPSH------------------------------------
A0A672V9F8_BAD-01      GGGPRFR---GGGQ------------------------------------
A0A674GQ16_BAD-01      RGAPKCCREWGGGQ------------------------------------
A0A6I8NVP2_BAD-01      SAQ-----------------------------------------------
G3TP47_BAD-01          RGSS------APSQ------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          KGGS------TPSQ------------------------------------
Q61337_BAD-06          KGGS------TPSQ------------------------------------
Q61337_BAD-03          KGGS------TPSQ------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          KGGS------TPSQ------------------------------------
A0A287CT05_BAD-01      RRGS------APSQ------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
G5B6Q3_BAD-01          RGGS------APSQ------------------------------------
G5B6Q3_BAD-02          RGGS------APSQ------------------------------------
A0A2I3TBK7_BAD-01      RGSV------LSPLEGGLTPIPFRCV------------------------
A0A2R8Z674_BAD-02      RGSV------LSPLEGGLTQIPFRCV------------------------
A0A2I2YFH2_BAD-03      RGSV------LSPLEGRLTQIPFRCV------------------------
Q92934_BAD-03          RGSV------LSPLEGGLTQIPFRCV------------------------
A0A2K5M0A7_BAD-02      RGSV------LPLSVGGLTQIPFRCM------------------------
A0A2K5XJR2_BAD-02      RGSV------LPLSVGGLTQIPFRCM------------------------
A0A096MLD5_BAD-03      RGSV------LPLSVGGLTQIPFRCM------------------------
A0A2K6E7I4_BAD-02      RGSV------LPLSVGGLTQIPFRCM------------------------
A0A2K5PDB1_BAD-02      ---------------GGLTQIPFRCV------------------------
A0A2K5E6A6_BAD-02      ---------------GELTQIPFRCV------------------------
A0A2K6TG62_BAD-02      ---------------GGLTQIPFRCV------------------------
A0A2K5HKU7_BAD-02      QHSD------MAASSGG---------------------------------
A0A2K6N196_BAD-02      QHSD------MAASSGG---------------------------------
A0A2K6PUL3_BAD-02      QHSD------MAASSGG---------------------------------
A0A2K5M0A7_BAD-03      QHSV------MAASSGG---------------------------------
A0A2K5XJR2_BAD-03      QHSV------MAASSGG---------------------------------
A0A096MLD5_BAD-02      QHSV------MAASSGG---------------------------------
A0A2K6E7I4_BAD-03      QHSV------MAASSGG---------------------------------
A0A2I2YFH2_BAD-04      QHSA------MAASSGG---------------------------------
Q92934_BAD-04          QHSA------MAASSGG---------------------------------
A0A2I3TBK7_BAD-03      QHSA------MAASSGG---------------------------------
A0A2R8Z674_BAD-03      QHSA------MAASSGG---------------------------------
A0A2K5E6A6_BAD-03      QHSA------MAASSGG---------------------------------
A0A2K5PDB1_BAD-03      QHSA------MAASSGG---------------------------------
A0A2K6TG62_BAD-03      QHSD------MAASSGG---------------------------------
G1P8C5_BAD-01          RGGS------APSQ------------------------------------
A0A452ER54_BAD-02      RGGS------APSQ------------------------------------
W5P8G9_BAD-01          RGGS------APSQ------------------------------------
Q61337_BAD-07          SPGL------CLHL------------------------------------
O35147_BAD-01          KGGS------TPSQ------------------------------------
F7DN67_BAD-01          RGGS------APSQ------------------------------------
Q45KI9_BAD-01          RGGS------APSQ------------------------------------
A0A3Q7SWS0_BAD-01      RGGS------APSQ------------------------------------
H0WVR2_BAD-01          RGGS------APCQ------------------------------------
A0A2K6GWV0_BAD-01      RGGS------APSQ------------------------------------
H0V608_BAD-01          RGGS------APSQESV---------------------------------
A0A2K5PDB1_BAD-01      RGGS------APSQ------------------------------------
U3F2S3_BAD-01          RGGS------APSQ------------------------------------
A0A2K5E6A6_BAD-01      RGGS------APSQ------------------------------------
A0A2K6TG62_BAD-01      RGGS------APSQ------------------------------------
A0A2K5M0A7_BAD-01      RGSS------APSQ------------------------------------
A0A1D5QBW1_BAD-01      RGSS------APSQ------------------------------------
A0A2K6E7I4_BAD-01      RGSS------APSQ------------------------------------
A0A2K5XJR2_BAD-01      RGSS------APSQ------------------------------------
A0A096MLD5_BAD-04      RGSS------APSQ------------------------------------
A0A2K6N196_BAD-01      RGSS------APSQ------------------------------------
A0A2K6PUL3_BAD-01      RGSS------APSQ------------------------------------
A0A2K5HKU7_BAD-01      RGSS------APSQ------------------------------------
A0A0D9R491_BAD-01      RGSS------APSQ------------------------------------
A0A2K5VCA1_BAD-01      RGSS------APSQ------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      RGSS------APSQ------------------------------------
A0A2I2YFH2_BAD-01      RGSS------APSQ------------------------------------
A0A2I2YFH2_BAD-02      RGSS------APSQ------------------------------------
Q92934_BAD-01          RGSS------APSQ------------------------------------
Q92934_BAD-02          RGSS------APSQ------------------------------------
A0A2I3TBK7_BAD-02      RGSS------APSQ------------------------------------
A0A2R8Z674_BAD-01      RGSS------APSQ------------------------------------
A0A2J8TYJ3_BAD-01      RGSS------APSQ------------------------------------
A0A4X1VE31_BAD-01      S-------------------------------------------------
A0A4X1VE31_BAD-02      RGGP------APSQ------------------------------------
A0A287AEF3_BAD-01      RGGP------APSQ------------------------------------
A0A4X1VE31_BAD-03      RGGP------APSQ------------------------------------
A0A671ELU4_BAD-01      RGGS------ASSQ------------------------------------
A0A452ER54_BAD-01      RGGS------APSQ------------------------------------
G1MI17_BAD-01          RGGS------APSQ------------------------------------
A0A452RJM6_BAD-01      RGGS------APSQ------------------------------------
A0A384DJL2_BAD-01      RGGS------APSQ------------------------------------
M3YNE7_BAD-01          RGGS------APSQ------------------------------------
A0A667H8Z9_BAD-01      RGGS------APSQ------------------------------------
A0A673V6P8_BAD-01      RGGS------APSQ------------------------------------
A0A4W2C9A8_BAD-01      RGGS------APSQ------------------------------------
A0A4W2C9A8_BAD-01      RGGS------APSQ------------------------------------
F1MUT9_BAD-01          RGGS------APSQ------------------------------------
Q3SYZ0_BAD-01          RGGS------APSQ------------------------------------
A0A4U1FMC3_BAD-01      RGGP------APSQ------------------------------------
A0A2Y9EHU3_BAD-01      RGGP------APSQ------------------------------------
A0A6F9BAV3_BAD-01      GR--------------E---------------------------------
A0A3P8YI30_BAD-02      GR--------------D---------------------------------
A0A4W5R1T6_BAD-01      GR--------------E---------------------------------
A0A060W8P9_BAD-01      GR--------------E---------------------------------
B5X1T1_BAD-01          GR--------------E---------------------------------
A0A673ZHY7_BAD-01      GR--------------E---------------------------------
A0A671NP27_BAD-01      AE----------SRPAE---------------------------------
A0A672SAE4_BAD-01      AE----------SRPAE---------------------------------
A0A672SAE4_BAD-02      AE----------SRPAE---------------------------------
A0A671RUV0_BAD-01      AE----------SRPAE---------------------------------
A0A673HRQ3_BAD-01      AE----------SRPAE---------------------------------
A0A672RGH0_BAD-01      AE----------SRPAE---------------------------------
Q4V925_BAD-03          AE----------SRPAE---------------------------------
Q4V925_BAD-02          AE----------SRPAE---------------------------------
A7MCM4_BAD-01          AE----------SRPAE---------------------------------
Q4V925_BAD-01          AE----------SRPAE---------------------------------
Q4V925_BAD-04          AE----------SRPAE---------------------------------
A0A3B3QX41_BAD-01      AE-ISGSLSTADSRAAQ---------------------------------
A0A3Q3RXS8_BAD-01      GE---NNLHENHTPRTE---------------------------------
A0A3Q0QNQ2_BAD-02      GE---NSHHENHTQRTE---------------------------------
A0A3Q3WTY4_BAD-01      GE---NNHHDSHTHRNE---------------------------------
A0A3P8Y761_BAD-01      TE-KTPNLIITEPRSSE---------------------------------
A0A4W5JLL9_BAD-01      TE-HTPTI---PPRSSE---------------------------------
A0A3B5Q2N7_BAD-01      GE---NNHHENHASRTE---------------------------------
A0A087X8P8_BAD-01      GE---NNHHENHASRTE---------------------------------
A0A3B3UA11_BAD-01      GE---NNHHENHASRTE---------------------------------
A0A3B3YFR1_BAD-01      GE---NNHHENHASRTE---------------------------------
A0A3P9Q7C3_BAD-01      GE---NNHHENHASRTE---------------------------------
A0A3B3HDU2_BAD-01      GE---YSHHE--SHRTE---------------------------------
A0A3P9KSL7_BAD-02      GE---YSHHE--SHRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLF
A0A3P9KSL7_BAD-01      GE---YSHHE--SHRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRNSLF
A0A3B5BAL2_BAD-01      GE---NNHHENHTHRNE---------------------------------
A0A665TUH3_BAD-01      GE---NNHLE--SHRNE---------------------------------
A0A674MXC1_BAD-04      GE---NGHHDGHTHRTE---------------------------------
A0A674MXC1_BAD-01      GE---NGHHDGHTHRTE---------------------------------
A0A674MXC1_BAD-02      GE---NGHHDGHTHRTE---------------------------------
A0A674MXC1_BAD-03      GE---NGHHDGHTHRTE---------------------------------
A0A671TL42_BAD-01      GE---NNHHDNHTHRTE---------------------------------
A0A3Q3AEL8_BAD-02      GE---SSHHEKPTHRTE---------------------------------
A0A3Q3AEL8_BAD-01      GE---SSHHEKPTHRTE---------------------------------
A0A1A8AQV0_BAD-01      GE---NSHHDNPTQRTE---------------------------------
G3Q8B3_BAD-01          GE---NNHHE----------------------------------------
A0A3Q2Y0E4_BAD-01      GENNNNNHHDNHANRTE---------------------------------
A0A3Q3R5S3_BAD-01      GE---NTHHENAALAQEVERVVS---------------------------
                                                                         

Q61337_BAD-09          ------------------------------
Q2PG01_BAD-01          ------------------------------
A0A2I3H4B2_BAD-01      ------------------------------
Q92934_BAD-05          ------------------------------
Q92934_BAD-06          ------------------------------
A0A670JUY4_BAD-01      ------------------------------
A0A670YRG7_BAD-01      ------------------------------
Q6P7C5_BAD-01          ------------------------------
A0A3B1JLM2_BAD-01      ------------------------------
A0A4W4DXF5_BAD-01      ------------------------------
A0A452IFQ4_BAD-01      ------------------------------
A0A674I2R9_BAD-01      ------------------------------
C1C3S9_BAD-01          ------------------------------
A0A6I8PXS6_BAD-01      ------------------------------
A0A337SAW2_BAD-01      ------------------------------
A0A673J9C6_BAD-01      ------------------------------
A0A4W5JLL9_BAD-02      ------------------------------
A0A674DKC6_BAD-01      ------------------------------
A0A3P8YI30_BAD-01      ------------------------------
A0A3B4DUY7_BAD-01      ------------------------------
A0A4W4HE29_BAD-01      ------------------------------
A0A3B4CPH6_BAD-01      ------------------------------
A0A674AVP9_BAD-01      ------------------------------
A0A1S3L0Z2_BAD-01      ------------------------------
B5XEF1_BAD-01          ------------------------------
A0A4W5MZR2_BAD-01      ------------------------------
A0A060W8W7_BAD-01      ------------------------------
E7FBJ6_BAD-01          ------------------------------
A0A673J5Q9_BAD-01      ------------------------------
A0A671PX91_BAD-01      ------------------------------
A0A672LB88_BAD-01      ------------------------------
A0A673I6H5_BAD-01      ------------------------------
A0A671SBB4_BAD-01      ------------------------------
A0A672R7P6_BAD-01      ------------------------------
A0A3P8Y761_BAD-02      ------------------------------
A0A3B5L9R9_BAD-01      ------------------------------
H3D8J8_BAD-01          ------------------------------
A0A6F9CQZ0_BAD-02      ------------------------------
A0A6F9CA11_BAD-02      ------------------------------
A0A1S3N9Q3_BAD-01      ------------------------------
A0A3Q2QC80_BAD-01      ------------------------------
A0A3Q3FKT9_BAD-02      ------------------------------
A0A3Q3FKT9_BAD-03      ------------------------------
A0A667ZNC6_BAD-01      ------------------------------
A0A3P9B2E4_BAD-01      ------------------------------
A0A668V3Q4_BAD-01      ------------------------------
I3K7B6_BAD-01          ------------------------------
A0A3Q3C680_BAD-01      ------------------------------
A0A3P8QRJ7_BAD-01      ------------------------------
A0A3Q4GGN3_BAD-01      ------------------------------
A0A3B4GXJ6_BAD-01      ------------------------------
A0A3Q2D5S0_BAD-01      ------------------------------
A0A3Q0QNQ2_BAD-01      ------------------------------
A0A3P8WI83_BAD-01      ------------------------------
A0A3P8WI83_BAD-02      ------------------------------
A0A3P9HNZ2_BAD-01      ------------------------------
A0A3B3BQF7_BAD-01      ------------------------------
A0A4W6EMZ7_BAD-02      ------------------------------
A0A672JQ68_BAD-01      ------------------------------
A0A2U9BAC9_BAD-01      ------------------------------
A0A4W6EMZ7_BAD-01      ------------------------------
A0A3B4VFC5_BAD-01      ------------------------------
A0A3B4W9T1_BAD-01      ------------------------------
A0A3Q1K1C7_BAD-01      ------------------------------
A0A672YF93_BAD-01      ------------------------------
A0A3Q1GWH9_BAD-01      ------------------------------
A0A3Q1CPU7_BAD-01      ------------------------------
A0A3P8TWH6_BAD-01      ------------------------------
A0A3Q3FKT9_BAD-01      ------------------------------
A0A3B1IH05_BAD-01      ------------------------------
A0A5F8GA49_BAD-01      ------------------------------
H3ANP3_BAD-03          ------------------------------
H3ANP3_BAD-04          ------------------------------
H3ANP3_BAD-01          ------------------------------
H3ANP3_BAD-02          ------------------------------
G3VRY3_BAD-01          ------------------------------
G3VRY3_BAD-02          ------------------------------
G3VRY3_BAD-03          ------------------------------
A0A4X2KAA5_BAD-01      ------------------------------
A0A672V9F8_BAD-01      ------------------------------
A0A674GQ16_BAD-01      ------------------------------
A0A6I8NVP2_BAD-01      ------------------------------
G3TP47_BAD-01          ------------------------------
Q61337_BAD-05          ------------------------------
Q61337_BAD-04          ------------------------------
Q61337_BAD-06          ------------------------------
Q61337_BAD-03          ------------------------------
Q61337_BAD-02          ------------------------------
Q61337_BAD-01          ------------------------------
A0A287CT05_BAD-01      ------------------------------
A0A287CT05_BAD-02      ------------------------------
G5B6Q3_BAD-01          ------------------------------
G5B6Q3_BAD-02          ------------------------------
A0A2I3TBK7_BAD-01      ------------------------------
A0A2R8Z674_BAD-02      ------------------------------
A0A2I2YFH2_BAD-03      ------------------------------
Q92934_BAD-03          ------------------------------
A0A2K5M0A7_BAD-02      ------------------------------
A0A2K5XJR2_BAD-02      ------------------------------
A0A096MLD5_BAD-03      ------------------------------
A0A2K6E7I4_BAD-02      ------------------------------
A0A2K5PDB1_BAD-02      ------------------------------
A0A2K5E6A6_BAD-02      ------------------------------
A0A2K6TG62_BAD-02      ------------------------------
A0A2K5HKU7_BAD-02      ------------------------------
A0A2K6N196_BAD-02      ------------------------------
A0A2K6PUL3_BAD-02      ------------------------------
A0A2K5M0A7_BAD-03      ------------------------------
A0A2K5XJR2_BAD-03      ------------------------------
A0A096MLD5_BAD-02      ------------------------------
A0A2K6E7I4_BAD-03      ------------------------------
A0A2I2YFH2_BAD-04      ------------------------------
Q92934_BAD-04          ------------------------------
A0A2I3TBK7_BAD-03      ------------------------------
A0A2R8Z674_BAD-03      ------------------------------
A0A2K5E6A6_BAD-03      ------------------------------
A0A2K5PDB1_BAD-03      ------------------------------
A0A2K6TG62_BAD-03      ------------------------------
G1P8C5_BAD-01          ------------------------------
A0A452ER54_BAD-02      ------------------------------
W5P8G9_BAD-01          ------------------------------
Q61337_BAD-07          ------------------------------
O35147_BAD-01          ------------------------------
F7DN67_BAD-01          ------------------------------
Q45KI9_BAD-01          ------------------------------
A0A3Q7SWS0_BAD-01      ------------------------------
H0WVR2_BAD-01          ------------------------------
A0A2K6GWV0_BAD-01      ------------------------------
H0V608_BAD-01          ------------------------------
A0A2K5PDB1_BAD-01      ------------------------------
U3F2S3_BAD-01          ------------------------------
A0A2K5E6A6_BAD-01      ------------------------------
A0A2K6TG62_BAD-01      ------------------------------
A0A2K5M0A7_BAD-01      ------------------------------
A0A1D5QBW1_BAD-01      ------------------------------
A0A2K6E7I4_BAD-01      ------------------------------
A0A2K5XJR2_BAD-01      ------------------------------
A0A096MLD5_BAD-04      ------------------------------
A0A2K6N196_BAD-01      ------------------------------
A0A2K6PUL3_BAD-01      ------------------------------
A0A2K5HKU7_BAD-01      ------------------------------
A0A0D9R491_BAD-01      ------------------------------
A0A2K5VCA1_BAD-01      ------------------------------
B4DZQ9_BAD-01          ------------------------------
A0A096MLD5_BAD-01      ------------------------------
A0A2I2YFH2_BAD-01      ------------------------------
A0A2I2YFH2_BAD-02      ------------------------------
Q92934_BAD-01          ------------------------------
Q92934_BAD-02          ------------------------------
A0A2I3TBK7_BAD-02      ------------------------------
A0A2R8Z674_BAD-01      ------------------------------
A0A2J8TYJ3_BAD-01      ------------------------------
A0A4X1VE31_BAD-01      ------------------------------
A0A4X1VE31_BAD-02      ------------------------------
A0A287AEF3_BAD-01      ------------------------------
A0A4X1VE31_BAD-03      ------------------------------
A0A671ELU4_BAD-01      ------------------------------
A0A452ER54_BAD-01      ------------------------------
G1MI17_BAD-01          ------------------------------
A0A452RJM6_BAD-01      ------------------------------
A0A384DJL2_BAD-01      ------------------------------
M3YNE7_BAD-01          ------------------------------
A0A667H8Z9_BAD-01      ------------------------------
A0A673V6P8_BAD-01      ------------------------------
A0A4W2C9A8_BAD-01      ------------------------------
A0A4W2C9A8_BAD-01      ------------------------------
F1MUT9_BAD-01          ------------------------------
Q3SYZ0_BAD-01          ------------------------------
A0A4U1FMC3_BAD-01      ------------------------------
A0A2Y9EHU3_BAD-01      ------------------------------
A0A6F9BAV3_BAD-01      ------------------------------
A0A3P8YI30_BAD-02      ------------------------------
A0A4W5R1T6_BAD-01      ------------------------------
A0A060W8P9_BAD-01      ------------------------------
B5X1T1_BAD-01          ------------------------------
A0A673ZHY7_BAD-01      ------------------------------
A0A671NP27_BAD-01      ------------------------------
A0A672SAE4_BAD-01      ------------------------------
A0A672SAE4_BAD-02      ------------------------------
A0A671RUV0_BAD-01      ------------------------------
A0A673HRQ3_BAD-01      ------------------------------
A0A672RGH0_BAD-01      ------------------------------
Q4V925_BAD-03          ------------------------------
Q4V925_BAD-02          ------------------------------
A7MCM4_BAD-01          ------------------------------
Q4V925_BAD-01          ------------------------------
Q4V925_BAD-04          ------------------------------
A0A3B3QX41_BAD-01      ------------------------------
A0A3Q3RXS8_BAD-01      ------------------------------
A0A3Q0QNQ2_BAD-02      ------------------------------
A0A3Q3WTY4_BAD-01      ------------------------------
A0A3P8Y761_BAD-01      ------------------------------
A0A4W5JLL9_BAD-01      ------------------------------
A0A3B5Q2N7_BAD-01      ------------------------------
A0A087X8P8_BAD-01      ------------------------------
A0A3B3UA11_BAD-01      ------------------------------
A0A3B3YFR1_BAD-01      ------------------------------
A0A3P9Q7C3_BAD-01      ------------------------------
A0A3B3HDU2_BAD-01      ------------------------------
A0A3P9KSL7_BAD-02      QGWWFDLPVQDQRRQQLQR-----------
A0A3P9KSL7_BAD-01      QGWWFDLPVQDQRRQQLQARQNFLEPSIRT
A0A3B5BAL2_BAD-01      ------------------------------
A0A665TUH3_BAD-01      ------------------------------
A0A674MXC1_BAD-04      ------------------------------
A0A674MXC1_BAD-01      ------------------------------
A0A674MXC1_BAD-02      ------------------------------
A0A674MXC1_BAD-03      ------------------------------
A0A671TL42_BAD-01      ------------------------------
A0A3Q3AEL8_BAD-02      ------------------------------
A0A3Q3AEL8_BAD-01      ------------------------------
A0A1A8AQV0_BAD-01      ------------------------------
G3Q8B3_BAD-01          ------------------------------
A0A3Q2Y0E4_BAD-01      ------------------------------
A0A3Q3R5S3_BAD-01      ------------------------------
                                                     

© 1998-2021Legal notice