Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

211 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      ---------------------------------------MGTPENPLSAP
A0A673J9C6_BAD-01      --------------MKTYRSVGPMQLVSVLSISRRIR------------S
A0A4W5JLL9_BAD-02      -------------------MLSPSP-------------PLPFPTYPLSLS
A0A674DKC6_BAD-01      SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLP-LPLSLS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      THVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR-----------
A0A673J9C6_BAD-01      CSAAVSALAIFHNLATTVYAHDALLRTQRPPERERKRER-------GKIL
A0A4W5JLL9_BAD-02      ASPPVS----------------------------------------FPLS
A0A674DKC6_BAD-01      ASPSSSPLLCLSPSSLSCLSLSSLSSPLSPPSPLSLSLPLLLPSPLSPLS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTV--------------PVAQATRAGLPQY
A0A673J9C6_BAD-01      ELLLPCSVSCTVCELEVNCSCAATPHNTGACQDSSRNPNRA---------
A0A4W5JLL9_BAD-02      TSLFPSLSTSPLSLCPLSFISLY--------------PLSPHLFPLSL--
A0A674DKC6_BAD-01      SLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      WREAAGPG------------------------------------------
A0A673J9C6_BAD-01      -SESKHPD-----------TQITRKTVRRTP-------------------
A0A4W5JLL9_BAD-02      -HPSSPPS-----------HSFLVSPLSLTP-------------------
A0A674DKC6_BAD-01      PSPLSPPSPLSLPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFS
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      -----------------------------------------------MSP
A0A4W6EMZ7_BAD-02      ------------------------------------------------MY
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      ------------------------------------------------MK
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          ---------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGS
A0A3B1JLM2_BAD-01      ------------MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDT
A0A4W4DXF5_BAD-01      ------------MHNQYLLRLRKANFTRED--YKKVIKAKTLREEG--ET
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-01      --------------------------------MFYSFCHSPCDECFLTIC
A0A3B4DUY7_BAD-01      ---------------------MSNQYLQKLRRARFNCEEERYKKVIKTLT
A0A337SAW2_BAD-01      --------------------------------------------------
A0A673J9C6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      --------------------------------------------------
A0A674DKC6_BAD-01      LSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLTAFLFPL
A0A4W4HE29_BAD-01      -------------MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSY
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3Q2QC80_BAD-01      SSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLP-------------
A0A4W6EMZ7_BAD-02      RNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQF
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      CNNKCYHFIRL-----VFVKKQSVICAGYGTVNTFGPAYSRDSTENKISC
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      -------------------------------------------------M
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      ------------------------------------------------MN
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      ----------------------------------MSTAARAAAGTCDSTA
A0A5F8GA49_BAD-01      --------MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESE
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          ------------------GPPENPSPASTHAQGVRMSGAEHPEKK-----
A0A287CT05_BAD-02      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
A0A287CT05_BAD-01      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          -----------------MRTPENPSPAPTNAEGLRKL---ELGIRRLESA
Q61337_BAD-02          -----------------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSD
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          -----------------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSD
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          ---------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGS
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-01      -------------------------MGSSGGKKLWLARPSPSTEEPLPLP
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A4X1VE31_BAD-03      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      ---------------------------MGTPENPSAAPTTRKLSIRRRRR
G1MI17_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A4U1FMC3_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      ------------------------------------------MAIINTII
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A1A8AQV0_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      ------------------LEF------NN---------------------
A0A670YRG7_BAD-01      ------------------LELRRRIGSDQ---------------------
Q6P7C5_BAD-01          DAGGRRWRPAAQSMFQI-PEFEPSEQEDA--------STTDRGLGPSLTE
A0A3B1JLM2_BAD-01      LFRPLCWNSSGSTVFTM-EKTPPHSKEDD------ISPIDDHDESRWSEA
A0A4W4DXF5_BAD-01      PSNTSCWNPFRVTAFTM-EKA-PCGQRDD------ISALDDQDESRWSET
A0A452IFQ4_BAD-01      -------------MFRI-QEFPDEVFPGR--------GKEAPAPPESQRG
A0A674I2R9_BAD-01      -------------MFRI-QEFPDEVFPGR--------GKESPLPPESQRG
C1C3S9_BAD-01          -----MGDSPHKSMFSI-EEFPPTE-RGS--------AFSGTNPPGFGG-
A0A6I8PXS6_BAD-01      -----MADSSPSAVFKL-EEFDNEE-QGL--------PLPFVDPPRGAGV
A0A3P8YI30_BAD-01      NAFGQCLLRMDVFSLQA-FKM---DHTQDCVGDIPENINEKYDLDHLGTT
A0A3B4DUY7_BAD-01      GEKGTPFNPLCWNSLRT-TACAMEKHSEDGISTMDDQDESNWS-ETVKNG
A0A337SAW2_BAD-01      --QGPRDRAWAQSMFQI-PEFEPSEQEDS--------SPTDRGLGPSPTG
A0A673J9C6_BAD-01      --TDSRNRLIMAQMFSI-SDNESD-TETS--------EDCEDSDLTKNNS
A0A4W5JLL9_BAD-02      LPPSSSVDVSMAQMFTI-SDSESEPSEEV--------GETEKDQLAAGKG
A0A674DKC6_BAD-01      LTSSSSVDVSMAQMFTI-SDSESEPSEEV--------GETEKDQSSAGKG
A0A4W4HE29_BAD-01      REFTSAAGQLSEVVFTM-AQMFTISDTES--------DTSEGPGDTDQQG
A0A3B4CPH6_BAD-01      ----------MAHMFTLSDDSDTSEDLGD----------------ADQPE
A0A674AVP9_BAD-01      ---------------MD-HTHDCVDECES--------DHSGTTHNSEFQ-
A0A1S3L0Z2_BAD-01      ---------------MD-YTHDCVDECES--------DHSGTTRNSEFQ-
B5XEF1_BAD-01          ---------------MD-YTHDCVDECES--------DHSGTTRNSEFQ-
A0A4W5MZR2_BAD-01      ---------------MD-HTHDCVDECES--------DHSGTTHNSEFQ-
A0A060W8W7_BAD-01      ---------------MD-HIHDCVDECES--------DHSGTTHNSEFQ-
E7FBJ6_BAD-01          ----------MENTSHD-HQDDSSTLDEK--------ERSHLKGTIKNH-
A0A673J5Q9_BAD-01      ----------MDNTLHD-HQDDSSTWNDK--------KKGR-EETIKNQ-
A0A671PX91_BAD-01      ----------MDNTLHD-HQDDSSTWNDK--------KKGR-EETIKNQ-
A0A672LB88_BAD-01      ----------MDNTLHD-HQDDSSTWNDK--------KKGR-EETIKNQ-
A0A673I6H5_BAD-01      ----------MDKRLHG-HQYDSSTLNDK--------KKGR-EETINTH-
A0A671SBB4_BAD-01      ----------MDKRLHD-HQNDSSTLNDK--------KKGR-EETINTH-
A0A672R7P6_BAD-01      ----------MDKRLHD-HRNDSSTLNDR--------KKGR-EETINTR-
A0A3P8Y761_BAD-02      -MGCSTPYRNGISTSTILPHTTGTGDRLL--------PYGLFCLITIGTR
A0A3Q2QC80_BAD-01      -------DDTMAAKFTI-SDSDSEPPEEV--------EEEGNDQPADGK-
A0A4W6EMZ7_BAD-02      LLNLPSPDVTMAANFTI-SDSESEASEEV--------EEGEMNQSSTEQ-
A0A3Q3FKT9_BAD-02      ----------MAAKFTI-SDSESGSEEEV--------KEEENDQSSAVE-
A0A3Q3FKT9_BAD-03      LGVL---DVTMAAKFTI-SDSESGSEEEV--------KEEENDQSSAVE-
A0A3B5L9R9_BAD-01      ----------MDTKFTI-SDGESDPSEDV--------EERGDLQLMQEK-
A0A667ZNC6_BAD-01      -----------MASFTI-SDGESDPSEEV--------GESETDKSLNHQ-
A0A3P9B2E4_BAD-01      ----------MAANFKI-SDSDSEASEEV--------GEGENQQSAGQA-
A0A668V3Q4_BAD-01      ----------MAANFTI-SDSESETSEEV--------GEEENQQPAGQD-
I3K7B6_BAD-01          ----------MAANFTI-SDSESETSEEV--------GEEENQQPAGQD-
A0A3Q3C680_BAD-01      ----------MAANFKI-SDSDSEASEEV--------GEEENQQSAGQA-
A0A3P8QRJ7_BAD-01      ----------MAANFKI-SDSDSEASEEV--------GEGENQQSAGQA-
A0A3Q4GGN3_BAD-01      ----------MAANFKI-SDSDSETSEEV--------GEGENQQSARQV-
A0A3B4GXJ6_BAD-01      ----------MAANFKI-SDSDSEASEEV--------GEGENQQSAGQA-
A0A3Q2D5S0_BAD-01      AQSVETSDPIMAATFTI-SDSDTEPSEEV--------EETRNKEPRIRN-
A0A3Q0QNQ2_BAD-01      ----------FIHFLPF-IQGRGQQPSHL--------LQLIWGTPRHSQ-
A0A3P8WI83_BAD-02      VEVSIFPDVTMAAQFTI-SDSESEPEEEV--------EGGKIKHSLNDP-
A0A3P8WI83_BAD-01      ----------MAAQFTI-SDSESEPEEEV--------EGGKIKHSLNDP-
A0A3P9HNZ2_BAD-01      ----------MAAKFTI-SD-DSESSEEV--------EGGKLDLGAAGG-
A0A3B3BQF7_BAD-01      ----------MAAKFSI-SDNDSESSEEV--------EGGRLDLAASGGE
A0A672JQ68_BAD-01      ----------MAAKFSI-SDSESEPSEEV--------EEEETNE--TPA-
A0A2U9BAC9_BAD-01      ----------MAANFTI-SDSESEPSEEV--------EEGEVSQPWTGP-
A0A4W6EMZ7_BAD-01      ----------MAANFTI-SDSESEASEEV--------EEGEMNQSSTEQ-
A0A3B4VFC5_BAD-01      ----------MAANFTI-SDSESEPSEEV--------DEGEMSQSLTGQ-
A0A3B4W9T1_BAD-01      ----------MAANFTI-SDSESEPSEEV--------DEGEMSQSLTGQ-
A0A3Q1K1C7_BAD-01      ----------MAARFTI-SDSDSDPSEGM--------EEEGHNQSPPGQ-
A0A672YF93_BAD-01      ----------MAAKFTI-SDSESEPSEDL--------EEEQRRQPPTEQ-
A0A3Q1GWH9_BAD-01      ----------MAAKFSI-SDGDSEPEE----------VEGENNHSPATE-
A0A3Q1CPU7_BAD-01      ----------MAAKFTI-SDSESEPSEEV--------EEGENNHSPATQ-
A0A3P8TWH6_BAD-01      ----------MAAKFTI-SDSESEPSEEV--------EEGENNHSPATQ-
H3D8J8_BAD-01          ----------MAAKFSLCSDSDSEPSEEV--------EEGERGSFSTS--
A0A6F9CQZ0_BAD-02      -------------MFTI-SDCKSEPSE-V--------GETEKDKSAAGQ-
A0A6F9CA11_BAD-02      ----------MAQMFTI-SDSESEPSEDV--------GETETDQSAAGK-
A0A1S3N9Q3_BAD-01      ----------MAQIFTI-SDSE---SEEV--------GETENDQSSAGK-
A0A3Q3FKT9_BAD-01      -MTLTASDVTMAAKFTI-SDSESGSEE----------EVKEEENDQSSAV
A0A3B1IH05_BAD-01      VSQPSKLDFTMDHMFTI-SDESDASEELG--------DSDQPEVSKTAEP
A0A5F8GA49_BAD-01      TPSWPDDASRPVSMFQI-PEFEPGEQEDG----------------SERAP
H3ANP3_BAD-03          -------------MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPS-
H3ANP3_BAD-04          -------------MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPS-
H3ANP3_BAD-02          -------------MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPS-
H3ANP3_BAD-01          -------------MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPS-
A0A4X2KAA5_BAD-01      -----------MSMFQI-SEFEPSEQETP--------KEDGFAYAPGESR
A0A672V9F8_BAD-01      ---------MGGPCEVV-GCSPPVP--------------PSAAMSPAPPA
A0A674GQ16_BAD-01      ------MLRLDETPEDR-GSPPPSPWGGS--------PSPSQPGTPSPGQ
A0A6I8NVP2_BAD-01      -------------MFQI-PEFEPSERGDV--------CTP--GGDPSQAP
G3TP47_BAD-01          -KGRRRSSGGLQSMFQI-PEFEQSDREDS--------TPADRGLGPSPEG
A0A287CT05_BAD-02      GRRRGWHPAWTQSMFQI-PEFEPSEQEDS--------SSAEGGLGPSPAG
A0A287CT05_BAD-01      GRRRGWHPAWTQSMFQI-PEFEPSEQEDS--------SSAEGGLGPSPAG
G5B6Q3_BAD-02          -------------MFQI-PEFEPSEQEDS--------SSEERALGPTPTG
G5B6Q3_BAD-01          QS-----------MFQI-PEFEPSEQEDS--------SSEERALGPTPTG
Q61337_BAD-02          AGGRRWRPA-AQSMFQI-PEFEPSEQEDA--------SATDRGLGPSLTE
Q61337_BAD-05          -------------MFQI-PEFEPSEQEDA--------SATDRGLGPSLTE
Q61337_BAD-01          AGGRRWRPA-AQSMFQI-PEFEPSEQEDA--------SATDRGLGPSLTE
Q61337_BAD-06          -------------MFQI-PEFEPSEQEDA--------SATDRGLGPSLTE
Q61337_BAD-04          -------------MFQI-PEFEPSEQEDA--------SATDRGLGPSLTE
Q61337_BAD-03          -------------MFQI-PEFEPSEQEDA--------SATDRGLGPSLTE
A0A2I3TBK7_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2R8Z674_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2I2YFH2_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
Q92934_BAD-03          -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5M0A7_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSLAG
A0A2K5XJR2_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSLAG
A0A096MLD5_BAD-03      -------------MFQI-PEFEPSEQEDS--------RSAERGLGPSPAG
A0A2K6E7I4_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5PDB1_BAD-02      -------------MFQI-PEFEPSEQEGS--------SSAERGLNPSTAG
A0A2K5E6A6_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
A0A2K6TG62_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
A0A2K5HKU7_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K6N196_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K6PUL3_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5M0A7_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSLAG
A0A2K5XJR2_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSLAG
A0A096MLD5_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K6E7I4_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2I2YFH2_BAD-04      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
Q92934_BAD-04          -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2I3TBK7_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2R8Z674_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5E6A6_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
A0A2K5PDB1_BAD-03      -------------MFQI-PEFEPSEQEGS--------SSAERGLNPSTAG
A0A2K6TG62_BAD-03      -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
G1P8C5_BAD-01          --------PTAQSMFQI-PEFEHSEQEDS--------SPADRGLGPCPTG
A0A452ER54_BAD-02      ------YRAWAQSMFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
W5P8G9_BAD-01          --QGPRYRAWAQSMFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
Q61337_BAD-07          --------------XQI-PEFEPSEQEDA--------SATDRGLGPSLTE
O35147_BAD-01          DAGGRRWRPAAQSMFQI-PEFEPSEQEDA--------STTDRGLGPSLTE
F7DN67_BAD-01          -------------MFQI-PEFEQSEPEDS--------SPADRGLGPSPTG
Q45KI9_BAD-01          -------------MFQI-PEFEPSEQEDS--------SPANRGLGPSPTG
A0A3Q7SWS0_BAD-01      -------------MFQI-PEFEPSEQEDS--------SPANRGLGPSPTG
H0WVR2_BAD-01          -------------MFQI-PEFEPSEQEDS--------SSSDRGLGPSPSG
A0A2K6GWV0_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAGRGLGPSPSG
H0V608_BAD-01          -------------MFQI-PEFEPSEQEDS--------SSEERGLGPSPTG
A0A2K5PDB1_BAD-01      -------------MFQI-PEFEPSEQEGS--------SSAERGLNPSTAG
U3F2S3_BAD-01          -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
A0A2K5E6A6_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
A0A2K6TG62_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLSPSTAG
A0A2K5M0A7_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSLAG
A0A1D5QBW1_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K6E7I4_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5XJR2_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSLAG
A0A096MLD5_BAD-04      -------------MFQI-PEFEPSEQEDS--------RSAERGLGPSPAG
A0A2K6N196_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K6PUL3_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5HKU7_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A0D9R491_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2K5VCA1_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
B4DZQ9_BAD-01          -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A096MLD5_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2I2YFH2_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2I2YFH2_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
Q92934_BAD-01          -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
Q92934_BAD-02          -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2I3TBK7_BAD-02      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2R8Z674_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A2J8TYJ3_BAD-01      -------------MFQI-PEFEPSEQEDS--------SSAERGLGPSPAG
A0A4X1VE31_BAD-01      STGNRGPSLRAQSMFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A4X1VE31_BAD-02      -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A287AEF3_BAD-01      GRGRSRSGPASQSMFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A4X1VE31_BAD-03      GRGRSRQGYLSQSMFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A671ELU4_BAD-01      -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A452ER54_BAD-01      ESGGRQWAGPRGSMFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
G1MI17_BAD-01          -------------MFQI-PEFEPSEQEDS--------SPADRGLGPSPTG
A0A452RJM6_BAD-01      -------------MFQI-PEFEPSEQEDS--------SPADRGLGPSPTG
A0A384DJL2_BAD-01      -------------MFQI-PEFEPSEQEDS--------SPADRGLGPSPTG
M3YNE7_BAD-01          -------------MFQI-PEFEPSEQEDS--------SPADRGLGPSPTG
A0A667H8Z9_BAD-01      -------------MFQI-PEFEPSEQEDS--------SPTDRGLGPSPTG
A0A673V6P8_BAD-01      -------------MFQI-PEFEPSEQEDS--------SPTDRGLGPSPTG
A0A4W2C9A8_BAD-01      -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A4W2C9A8_BAD-01      -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
F1MUT9_BAD-01          -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
Q3SYZ0_BAD-01          -------------MFQI-PEFEQSEQEDS--------SRADRGLGPSPTG
A0A4U1FMC3_BAD-01      -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A2Y9EHU3_BAD-01      -------------MFQI-PEFEQSEQEDS--------SPADRGLGPSPTG
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P8YI30_BAD-02      --------MAFKMDHTQ-DCVGDIPENIN--------EKYDLDHLGTTHY
A0A4W5R1T6_BAD-01      HCGCPFSLQIFTMNHTH-DCVDDNPETMN--------EKDESDHSGTTHY
A0A060W8P9_BAD-01      ------------MNHTH-DCVDDNPETMN--------EQDESDHSGTTHY
B5X1T1_BAD-01          ------------MDHTH-DCVDDNPETMN--------EHDESDHSGTTHY
A0A673ZHY7_BAD-01      ------------MDHTH-DCVDDNPETMN--------EQDESDHSGTTHY
A0A671NP27_BAD-01      ----------MAQMFSI-SDNESDTETSE--------DCEDSDLTKNNSG
A0A672SAE4_BAD-01      ----------MAQMFSI-SDNESDTETSE--------DCEDSDLTKNNSG
A0A672SAE4_BAD-02      ----------MAQMFSI-SDNESDTETSE--------DCEDSDLTKNNSG
A0A671RUV0_BAD-01      ----------MAQMFSI-SDNESETETSE--------DCEESGQAKNNSG
A0A673HRQ3_BAD-01      ----------MAQMFSI-SDNESETETSE--------DCEESGQVKNNSG
A0A672RGH0_BAD-01      ----------MAQMFSI-SDNESETETSE--------DCEESGQVKNNSG
Q4V925_BAD-02          ----------MAHMFNI-SD-DSETETME--------DSEDSSLDKHKSG
Q4V925_BAD-03          ----------MAHMFNI-SD-DSETETME--------DSEDSSLDKHKSG
A7MCM4_BAD-01          ----------MAHMFNI-SD-DSETETME--------DSEASSLDKHKSG
Q4V925_BAD-04          ----------MAHMFNI-SD-DSETETME--------DSEDSSLDKHKSG
Q4V925_BAD-01          ----------MAHMFNI-SD-DSETETME--------DSEDSSLDKHKSG
A0A3B3QX41_BAD-01      -----MSGVTMAHMFTI-SG-NESDTSES--------DTPDVTANSQLGN
A0A3Q3RXS8_BAD-01      ----------MAAKFS--IS-ESESDSSE--------EVEGGKQKKSSAR
A0A3Q0QNQ2_BAD-02      ------------------MP-EPPRLVLF--------DVEEGQSPFREGS
A0A3Q3WTY4_BAD-01      ----------MATNFTI-SS-DSESELSE--------EIEEGENSQLQTE
A0A3P8Y761_BAD-01      ----------MENIFTI--S-DTESESSD--------V--EETKKEWIAG
A0A4W5JLL9_BAD-01      ----------MAQMFTI--S-DSESEPSE--------EVGETEKDQLAAG
A0A3B5Q2N7_BAD-01      ----------MDTKFTI--S-DGESDPSE--------DVEERGDLQLMQE
A0A087X8P8_BAD-01      ----------MDAKFTI--S-DSDSEPSE--------DVEERGNLQLMQV
A0A3B3UA11_BAD-01      ----------MDAKFTI--S-DSDSEPSE--------DVEERGNLQLMQV
A0A3B3YFR1_BAD-01      ----------MDAKFTI--S-DSDSEPSE--------DVEERGNLQLMQV
A0A3P9Q7C3_BAD-01      ----------MDAKFTI--S-DSDSEPSE--------DVEERGNLQLMQV
A0A3B3HDU2_BAD-01      ----------MAAKFTI----SDDSESSE--------EVEGGKLDLGAAA
A0A3P9KSL7_BAD-02      ----------MAAKFTI----SDDSESSE--------EVEGGKLDLGAAA
A0A3P9KSL7_BAD-01      ----------MAAKFTI----SDDSESSE--------EVEGGKLDLGAAA
A0A3B5BAL2_BAD-01      ----------MAAQFSI--S-GSESDP-E--------EVEEGENNHPPAE
A0A665TUH3_BAD-01      ----------MSAQFTI--S-DSESDPSE--------EVEEGDMSQSL--
A0A674MXC1_BAD-04      ----------MATRFSI-SS-DSDSDPSE--------EVDEGERNSSLSE
A0A674MXC1_BAD-01      ----------MATRFSI-SS-DSDSDPSE--------EVDEGERNSSLSE
A0A674MXC1_BAD-02      ----------MATRFSI-SS-DSDSDPSE--------EVDEGERNSSLSE
A0A674MXC1_BAD-03      ----------MATRFSI-SS-DSDSDPSE--------EVDEGERNSSLSE
A0A671TL42_BAD-01      ----------MAANFTI-SS-ESDSEPSE--------EVEEGEHSQSPAE
A0A3Q3AEL8_BAD-01      ----------MAAKFTI--S-DSESEPSD--------EVEEGKSKQPAAG
A0A3Q3AEL8_BAD-02      ----------MAAKFTI--S-DSESEPSD--------EVEEGKSKQPAAG
A0A1A8AQV0_BAD-01      ----------MAAHFTI--S-DSDSEPSE--------EVEEGEKKQPSAG
G3Q8B3_BAD-01          ----------MAAHFTI--S-DSESEPSD--------GVEEREDGQLSSG
A0A3Q2Y0E4_BAD-01      ----------MAANFSI--S-DSESEPSE--------EVEEGDDGQGAAE
A0A3Q3R5S3_BAD-01      ----------MAANFTI--S-DSESESSE--------EVEEGKHSQSSTS
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      ---------------------------------IRKD-------------
A0A670YRG7_BAD-01      ---------------------------------LDSE-------------
Q6P7C5_BAD-01          DQPG--------PYLAPGLLGSI---VQQQPGQAANN----------SH-
A0A3B1JLM2_BAD-01      VKSVDSPQTDSGPSMYRDTSSDELLEVGGRVR-LYSE----------SQ-
A0A4W4DXF5_BAD-01      IESDDSPRISNHHIMPNNTAT----EVGGRVR-LYSE----------SQ-
A0A452IFQ4_BAD-01      HTPG----------------------SKQPDT----P----------TA-
A0A674I2R9_BAD-01      HTPG----------------------SKQPDT----P----------TA-
C1C3S9_BAD-01          -DPG----------------------HKSSPNLRRIK----------GK-
A0A6I8PXS6_BAD-01      RQPV----------------------AKSSPSLRRYP----------GK-
A0A3P8YI30_BAD-01      HYPEFQFCNTSTNTSNRTLP-------GVRVR-LYSE----------SQ-
A0A3B4DUY7_BAD-01      DSPQLDSQHSMASNISPASPDELSE-VGCRVR-LYSE----------SQ-
A0A337SAW2_BAD-01      DRPR---GPGKHQRTTPG--LLGE--AGHQQGQPASS----------NH-
A0A673J9C6_BAD-01      -GSQ---QKTNHDLAVPD-RLKGEQLGRHR-NLSMND----------ED-
A0A4W5JLL9_BAD-02      -MTG---GPIGHALTVPEMRLAGE--GRLRMNSESQA----------QE-
A0A674DKC6_BAD-01      -MTG---GPIGHTLTVPEMRLAGE--GRLRMNSESQA----------QE-
A0A4W4HE29_BAD-01      DSKEAEPSQSEQHLHVPNTLRGE---WTARQR---------------NH-
A0A3B4CPH6_BAD-01      ASKRAELSQSGQHPLVPERFRESRQRNHSMNEDALQE----------SG-
A0A674AVP9_BAD-01      ---------LHVSTTMSNRPR-----PGERVR-LYSE----------SQ-
A0A1S3L0Z2_BAD-01      ---------LHVSTTMSNRPR-----PGERVR-LYSE----------SQ-
B5XEF1_BAD-01          ---------LHVSTTMSNRPR-----PGERVR-LYSE----------SQ-
A0A4W5MZR2_BAD-01      ---------LHVSTTMSTRPR-----PGERVR-LYSE----------SQ-
A0A060W8W7_BAD-01      ---------LHVSTTMSNRPR-----PGERVR-LYSE----------SQ-
E7FBJ6_BAD-01          ---------GQHQDRTSANIS-----PQGRVR-LYSE----------SQ-
A0A673J5Q9_BAD-01      ---------GQHQDQTLPNIS-----PQGRVR-LYSE----------SQ-
A0A671PX91_BAD-01      ---------GQHQDQTLPNIS-----PQGRVR-LYSE----------SQ-
A0A672LB88_BAD-01      ---------GQHQDQTLPNIS-----PQGRVR-LYSE----------SQ-
A0A673I6H5_BAD-01      ---------GQHQDQTSPNIS-----PQGRVR-LYSE----------SQ-
A0A671SBB4_BAD-01      ---------GQHQDQTLPNIS-----PQGRVR-FYSE----------SQ-
A0A672R7P6_BAD-01      ---------GQHQDQTLPNIS-----PQGRVR-LYSE----------SQ-
A0A3P8Y761_BAD-02      DGTGAYGLFWLRNTHIHPLILCSFFIGEGRIR-LNSE----------SQ-
A0A3Q2QC80_BAD-01      -----VEPLRQRHALTLPELR-S---GHGRIR-LNSE----------SH-
A0A4W6EMZ7_BAD-02      -----EQQIPQRNTVTLPELRLP---VPGRIR-LNSE----------SH-
A0A3Q3FKT9_BAD-02      -----EPHVPQRHSLTLPELRLA---GTGRIR-LNSE----------SH-
A0A3Q3FKT9_BAD-03      -----EPHVPQRHSLTLPELRLA---GTGRIR-LNSE----------SH-
A0A3B5L9R9_BAD-01      -----EKPLSQRHTLTLPELRST---K-----------------------
A0A667ZNC6_BAD-01      -----EQNHHLGHALTTPELRMS---ASGRVR-LNSE----------SH-
A0A3P9B2E4_BAD-01      -------QESKPQTLSLPVTKTT---AAGRLR-VNSE----------SH-
A0A668V3Q4_BAD-01      -------QESKPQTLALPVIKTT---GAGRLR-LNSE----------SH-
I3K7B6_BAD-01          -------QESKPQTLALPVIKTT---GAGRLR-LNSE----------SH-
A0A3Q3C680_BAD-01      -------QESKPQTLSLPVIKTT---AAGRLR-VNSE----------SH-
A0A3P8QRJ7_BAD-01      -------QESKPQTLSLPVTKTT---AAGRLR-VNSE----------SH-
A0A3Q4GGN3_BAD-01      -------QESKPQTLSLPVIKTT---AAGRLR-VNSE----------SH-
A0A3B4GXJ6_BAD-01      -------QESKPQTLSLPVIKTT---AAGRLR-VNSE----------SH-
A0A3Q2D5S0_BAD-01      --------------------SGK---THRRIR-LSSE----------SH-
A0A3Q0QNQ2_BAD-01      ---------AIGHDQNTSPMRHP---TARRIR-MNSE----------SH-
A0A3P8WI83_BAD-02      -----EQVVPHRHNLTLPELRVA---GSRRIR-LNSE----------SH-
A0A3P8WI83_BAD-01      -----EQVVPHRHNLTLPELRVA---GSRRIR-LNSE----------SH-
A0A3P9HNZ2_BAD-01      GGGGEGEHLHDRHSLTLPELRLT---SNGRTR-LNSE----------ST-
A0A3B3BQF7_BAD-01      GGGGGGGHLHDRHALTLPELRLT---SNGRTR-LNSE----------ST-
A0A672JQ68_BAD-01      -----DQRVRRRLDLSLNEFNLT---ATGRIR-LNSE----------SI-
A0A2U9BAC9_BAD-01      -----GEQVPPRHTLALPELRMA---ATGRIR-LNSE----------SN-
A0A4W6EMZ7_BAD-01      -----EQQIPQRNTVTLPELRLP---VPGRIR-LNSE----------SH-
A0A3B4VFC5_BAD-01      -----EQELSQRHTLTLPELRGA---ATGRTR-LNSE----------SH-
A0A3B4W9T1_BAD-01      -----EQELSQRHTLTLPELRGA---ATGRTR-LNSE----------SH-
A0A3Q1K1C7_BAD-01      -----EQQVFPRHTLTLPELR-----ASGRIR-LNSE----------SH-
A0A672YF93_BAD-01      -----EQQISYSHSLTLPELRMA---GAGRLR-LNSE----------SQ-
A0A3Q1GWH9_BAD-01      -----AMPVFARRNMALPELRTP---ASGRIR-LNSE----------SH-
A0A3Q1CPU7_BAD-01      -----AMPVFARRNMALPELRTP---ASGRLR-LNSE----------SH-
A0A3P8TWH6_BAD-01      -----AMPVFARRNMALPELRTP---ASGRLR-LNSE----------SH-
H3D8J8_BAD-01          ----------------------------GRIR-VNSE----------SQ-
A0A6F9CQZ0_BAD-02      ----GMTGGPLGHTLTVPEMRLA---GEGRLR-LNSE----------SQ-
A0A6F9CA11_BAD-02      ----GMTGGPLGHALT----------------------------------
A0A1S3N9Q3_BAD-01      ----GMTGGPIGHALTVPEMRLA---GEGRLR-MNSE----------SQ-
A0A3Q3FKT9_BAD-01      EEPH---VPQRHSLTLPELRLA----GTGRIR-LNSE----------SH-
A0A3B1IH05_BAD-01      SRSGQHITVPEKLRVEPRQRNFS---MNEEAL-QESG-------------
A0A5F8GA49_BAD-01      GQPG---GPGRRSSAAPGA----------------------------QR-
H3ANP3_BAD-03          EKTA---GLKKHSRTAPNLQNPG---PHQSHP-PSHT----------GV-
H3ANP3_BAD-04          EKTA---GLKKHSRTAPNLQNPG---PHQSHP-PSHT----------VF-
H3ANP3_BAD-02          EKTA---GLKKHSRTAPNLQNPG---PHQSHP-PSH--------------
H3ANP3_BAD-01          EKTA---GLKKHSRTAPNLQNPG---PHQSHP-PSH--------------
A0A4X2KAA5_BAD-01      GLGK---HSATAPSLAPVRP--G---PRPAPGAHHHE----------GA-
A0A672V9F8_BAD-01      GGVP---PPAPPRQVRPAPP--P---PSPLWGCPRPP----------CF-
A0A674GQ16_BAD-01      RLPP---TQNPPPGGTPKPPGGT---PKAIFGGPLTPLPPQRRGPGCCR-
A0A6I8NVP2_BAD-01      AGPG---GLGRHTHTSPDL---A---SHLPGRRPPPA----------AHL
G3TP47_BAD-01          YWPS---GPSDRHRVAPGFLRDS---SHQQGQ-PTSS----------GH-
A0A287CT05_BAD-02      DRP----GCG----LAPGLPRDT---GHQQWQ-ATSS----------SN-
A0A287CT05_BAD-01      DRP----GCG----LAPGLPRDT---GHQQWQ-ATSS----------SN-
G5B6Q3_BAD-02          DRL----GPS----SPGGFLGDI---SHQQRQ-LISS----------RH-
G5B6Q3_BAD-01          DRL----GPS----SPGGFLGDI---SHQQRQ-LISS----------RH-
Q61337_BAD-02          DQP----GPY----LAPGLLGSN---IHQQGR-AATN----------SH-
Q61337_BAD-05          DQP----GPY----LAPGLLGSN---IHQQGR-AATN----------SH-
Q61337_BAD-01          DQP----GPY----LAPGLLGSN---IHQQGR-AATN----------SH-
Q61337_BAD-06          DQP----GPY----LAPGLLGSN---IHQQGR-AATN----------SH-
Q61337_BAD-04          DQP----GPY----LAPGLLGSN---IHQQGR-AATN----------SH-
Q61337_BAD-03          DQP----GPY----LAPGLLGSN---IHQQGR-AATN----------SH-
A0A2I3TBK7_BAD-01      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2R8Z674_BAD-02      DGPS---GSSKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2I2YFH2_BAD-03      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
Q92934_BAD-03          DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5M0A7_BAD-02      DRPS---DCGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5XJR2_BAD-02      DRPS---DCGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A096MLD5_BAD-03      DKPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K6E7I4_BAD-02      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5PDB1_BAD-02      DSPP---GSGKHRRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K5E6A6_BAD-02      DRPP---GSGKHPRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K6TG62_BAD-02      DSPP---GSGKHRRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K5HKU7_BAD-02      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-ATSS----------SH-
A0A2K6N196_BAD-02      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K6PUL3_BAD-02      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5M0A7_BAD-03      DRPS---DCGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5XJR2_BAD-03      DRPS---DCGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A096MLD5_BAD-02      DKPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K6E7I4_BAD-03      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2I2YFH2_BAD-04      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
Q92934_BAD-04          DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2I3TBK7_BAD-03      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2R8Z674_BAD-03      DGPS---GSSKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5E6A6_BAD-03      DRPP---GSGKHPRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K5PDB1_BAD-03      DSPP---GSGKHRRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K6TG62_BAD-03      DSPP---GSGKHRRQAPGLPGDA---SHQQGQ-PTSS----------SH-
G1P8C5_BAD-01          DQPP---GLNKHWSTVPGLLGEA---GHQQGQ-PASS----------SH-
A0A452ER54_BAD-02      DRPP---GLSKHWLTAPGLLGEA---GHQQGQ-PAGS----------SH-
W5P8G9_BAD-01          DRPP---GLSKHWLTAPGLLGEA---GHQQGQ-PAGS----------SH-
Q61337_BAD-07          DQPG--------PYLAPGLLGSN---IHQQGR-AATN----------SH-
O35147_BAD-01          DQPG--------PYLAPGLLGSI---VQQQPGQAANN----------SH-
F7DN67_BAD-01          DWPS---DPVRHQRTAPGLLGEA---GHQQGQ-PASS----------SH-
Q45KI9_BAD-01          DRPP---SPGKHQQTAPGLLGEA---GHQQGQ-PASR----------KH-
A0A3Q7SWS0_BAD-01      DRP-------------PGLLGEA---GHQQGQ-PASR----------KH-
H0WVR2_BAD-01          DQPL---GPGKNRCTTPSLLGDA---SHLQGQ-PASN----------TH-
A0A2K6GWV0_BAD-01      DRPS---GPGKHPCTAPSFLGDA---SHQQGQ-PSSS----------SH-
H0V608_BAD-01          DELG---SS-----PAGGFLGDT---SHQQRQLRSSR----------SH-
A0A2K5PDB1_BAD-01      DSPP---GSGKHRRQAPGLPGDA---SHQQGQ-PTSS----------SH-
U3F2S3_BAD-01          DRPP---GSGKHRRQAPGLPGDA---SHQQGQ-STSS----------SH-
A0A2K5E6A6_BAD-01      DRPP---GSGKHPRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K6TG62_BAD-01      DSPP---GSGKHRRQAPGLPGDA---SHQQGQ-PTSS----------SH-
A0A2K5M0A7_BAD-01      DRPS---DCGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A1D5QBW1_BAD-01      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K6E7I4_BAD-01      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5XJR2_BAD-01      DRPS---DCGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A096MLD5_BAD-04      DKPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K6N196_BAD-01      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K6PUL3_BAD-01      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5HKU7_BAD-01      DRPS---DSGKHHRQAPGLLWDA---SHQQEQ-ATSS----------SH-
A0A0D9R491_BAD-01      NRPS---DSGKHHHQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2K5VCA1_BAD-01      NRPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
B4DZQ9_BAD-01          DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A096MLD5_BAD-01      DKPS---DSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2I2YFH2_BAD-02      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2I2YFH2_BAD-01      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
Q92934_BAD-01          DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
Q92934_BAD-02          DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2I3TBK7_BAD-02      DGPS---GSGKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2R8Z674_BAD-01      DGPS---GSSKHHRQAPGLLWDA---SHQQEQ-PTSS----------SH-
A0A2J8TYJ3_BAD-01      DRPS---GSSKHHRQAPGLLRDA---SHQQEQ-PTSS----------SH-
A0A4X1VE31_BAD-01      DRPP---GPSKPWRTAPGHLGEA---GHQQGQ-PASS----------SH-
A0A4X1VE31_BAD-02      DRPP---GPSKPWRTAPGHLGEA---GHQQGQ-PASS----------SH-
A0A287AEF3_BAD-01      TDP-------QPWRTAPGHLGEA---GHQQGQ-PASS----------SH-
A0A4X1VE31_BAD-03      DRPP---GPSKPWRTAPGHLGEA---GHQQGQ-PASS----------SH-
A0A671ELU4_BAD-01      DQPP---GPGKHLCTAPGLLGEA---GHQQGQ-PASS----------SH-
A0A452ER54_BAD-01      DRPP---GL------TPGLLGEA---GHQQGQ-PAGS----------SH-
G1MI17_BAD-01          DQPP---GPGKHRQTAPGLLGEA---AHPQGQ-PASS----------NH-
A0A452RJM6_BAD-01      DQPP---GPGKHRQTAPGLLGEA---AQPQGQ-PASS----------NH-
A0A384DJL2_BAD-01      DQPP---GPGKHRQTAPGLLGEA---AHPQGQ-PASS----------NH-
M3YNE7_BAD-01          DQPP---GLGKHLQTAPGLLGEA---GHQQGQ-PASS----------SH-
A0A667H8Z9_BAD-01      DRPR---GPGKHQRTAPGLLGEA---GHQQGQ-PASS----------NH-
A0A673V6P8_BAD-01      DRPS---GLGKHQRTAPGLLGEA---GPQQGQ-PASS----------SR-
A0A4W2C9A8_BAD-01      DRPP---GLSKHWLTAPGLLGEA---GHQQGQ-PAGS----------SH-
A0A4W2C9A8_BAD-01      DRPP---GLSKHWLTAPGLLGEA---GHQQGQ-PAGS----------SH-
F1MUT9_BAD-01          DRPP---GLSKHWLTAPGLLGEA---GHQQGQ-PAGS----------SH-
Q3SYZ0_BAD-01          DRPP---GLSKHWLTAPGLLGEA---GHQQGQ-PAGS----------SH-
A0A4U1FMC3_BAD-01      DRPP---GPSKHRQTAPGLLGEA---GHQQGQ-PASS----------SH-
A0A2Y9EHU3_BAD-01      DKPP---GPSKHRQTAPGLLGEA---GHQQGQ-PASS----------SH-
A0A6F9BAV3_BAD-01      -----------------MSTRPR---PGGRVR-LYSE----------SQ-
A0A3P8YI30_BAD-02      PEFQ------FCNTSTNTSNRTL---PGVRVR-LYSE----------SQ-
A0A4W5R1T6_BAD-01      PEFQ------LHTVSTTTSTRPR---PGGRVR-LYSE----------SQ-
A0A060W8P9_BAD-01      PEFQ------LHNVSTTTSIRPR---PGGRAR-LYSE----------SQ-
B5X1T1_BAD-01          PEFQ------RHYVSTRTGIRPR---PGGRVR-LYSE----------SQ-
A0A673ZHY7_BAD-01      PEFQ------LHYVSTRTSIRPR---PGERVR-LYSE----------SQ-
A0A671NP27_BAD-01      SPQK-----TNHDLAVPD-------------R-LKGE----------QL-
A0A672SAE4_BAD-01      SPQK-----TNHDLAVPD-------------R-LKGE----------QL-
A0A672SAE4_BAD-02      SPQK-----TNHDLAVPD-------------R-LKGE----------QL-
A0A671RUV0_BAD-01      SPQR-----KQH-LAVPD-------------R-LKGE----------QL-
A0A673HRQ3_BAD-01      SPQR-----KQH-LAVPD-------------R-LKGE----------QL-
A0A672RGH0_BAD-01      SPQR-----TQH-LAVPG-------------R-LKGE----------QL-
Q4V925_BAD-02          SAQK-----KQH-LTVPD-------------R-LKGE----------QL-
Q4V925_BAD-03          SAQK-----KQH-LTVPD-------------R-LKGE----------QL-
A7MCM4_BAD-01          SAQK-----KQH-LTVPD-------------R-LKGE----------QL-
Q4V925_BAD-04          SAQK-----KQH-LTVPD-------------R-LKGE----------QL-
Q4V925_BAD-01          SAQK-----KQH-LTVPD-------------R-LKGE----------QL-
A0A3B3QX41_BAD-01      NLKN-------------TKNPGE---AGGRVR-MRSE----------SQ-
A0A3Q3RXS8_BAD-01      QEQQ--V-SQRHALALPELRTT----------------------------
A0A3Q0QNQ2_BAD-02      FLLL--VSVISFFWSLPKAFSR----------------------------
A0A3Q3WTY4_BAD-01      QEQQ--V-FQRHTLTLPELRMA----------------------------
A0A3P8Y761_BAD-01      QGKT-GS-RLGLSLNLP---------GEGRIR-LNSE----------SQ-
A0A4W5JLL9_BAD-01      KGMT-GG-PIGHALTVPEMRLA----GEGRLR-MNSE----------SQ-
A0A3B5Q2N7_BAD-01      KEKP--L-SQRHTLTLPELRST-----TGRVR-LNSE----------SI-
A0A087X8P8_BAD-01      KERP--L-SQRHTLTLPELRST-----TGRVR-LNSE----------SI-
A0A3B3UA11_BAD-01      KERP--L-SQRHTLTLPELRST-----TGRVR-LNSE----------SI-
A0A3B3YFR1_BAD-01      KERP--L-SQRHTLTLPELRST-----TGRVR-LNSE----------SI-
A0A3P9Q7C3_BAD-01      KERP--L-SQRHTLTLPELRST-----TGRVR-LNSE----------SI-
A0A3B3HDU2_BAD-01      GGEGEHL-HDRHSLTLPELRLT----SNGRTR-LNSE----------ST-
A0A3P9KSL7_BAD-02      GGEGEHL-HDRHSLTLPELRLT----SNGRTR-LNSE----------ST-
A0A3P9KSL7_BAD-01      GGEGEHL-HDRHSLTLPELRLT----SNGRTR-LNSE----------ST-
A0A3B5BAL2_BAD-01      QPMH--V-FERRNLALPELRTP----AAGRIR-LNSE----------SH-
A0A665TUH3_BAD-01      -EQE--V-FQRHNLTLPEIRTA----GAGRTR-LNSE----------SH-
A0A674MXC1_BAD-04      QERQ--V-LQRHTLTLPELRLT----GTSRTR-VSSE----------SQ-
A0A674MXC1_BAD-01      QERQ--V-LQRHTLTLPELRLT----GTSRTR-VSSE----------SQ-
A0A674MXC1_BAD-02      QERQ--V-LQRHTLTLPELRLT----GTSRTR-VSSE----------SQ-
A0A674MXC1_BAD-03      QERQ--V-LQRHTLTLPELRLT----GTSRTR-VSSE----------SQ-
A0A671TL42_BAD-01      EGQQ--V-SQRHALTLPELRMA----G--RIR-LNSE----------SH-
A0A3Q3AEL8_BAD-01      PEDG-----VRQRLTLPELRHS----KNGRLR-VNSE----------SL-
A0A3Q3AEL8_BAD-02      PEDG-----VRQRLTLPELRHS----KNGRLR-VNSE----------SL-
A0A1A8AQV0_BAD-01      QEES-----VRPHPNLPELRLP----LNGRIR-LNSE----------SH-
G3Q8B3_BAD-01          QEQQ--R-LQRHTLTLPELRLSG---RKSQRI-VEKE-------------
A0A3Q2Y0E4_BAD-01      KEQEQCL-RQGLRLTLPELPMEA---MSGRIR-LNSE----------SH-
A0A3Q3R5S3_BAD-01      QEQQ--V-PPCHSLTLPELRMAA---TS-RNR-VSSE----------SN-
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      ------------------------VYN-INRWEDNENQ------------
A0A4W4DXF5_BAD-01      ------------------------AYT-VSHWEDTESQ------------
A0A452IFQ4_BAD-01      ----------------------------EVRSRIGSDT------------
A0A674I2R9_BAD-01      ----------------------------EVRSRIGSDP------------
C1C3S9_BAD-01          ----------------------------ETRQRTESAS------------
A0A6I8PXS6_BAD-01      ----------------------------ESRLRTESAS------------
A0A3P8YI30_BAD-01      ------------------------VCS-QVGRQDNTEF------------
A0A3B4DUY7_BAD-01      ------------------------VYT-VSRWQDNED-------------
A0A337SAW2_BAD-01      ---------------------HGGAGAVETRSRHSSYP------------
A0A673J9C6_BAD-01      ---------------------LLETGA-----------------------
A0A4W5JLL9_BAD-02      ---------------------LQGRGP-----------------------
A0A674DKC6_BAD-01      ---------------------LQGRGP-----------------------
A0A4W4HE29_BAD-01      -------------------------------SMNEAEL------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      ------------------------VCSQVGKREDTEFQ------------
A0A1S3L0Z2_BAD-01      ------------------------VCSQVGKREDTEFQ------------
B5XEF1_BAD-01          ------------------------VRSQVGKREDTEFQ------------
A0A4W5MZR2_BAD-01      ------------------------VCSQVGKRENTEFQ------------
A0A060W8W7_BAD-01      ------------------------VCSQVGKREDTEFQ------------
E7FBJ6_BAD-01          ------------------------VYT-VSRWQDTETQ------------
A0A673J5Q9_BAD-01      ------------------------VYT-VSRWQEAEPQ------------
A0A671PX91_BAD-01      ------------------------VYT-VSRWQEAEPQ------------
A0A672LB88_BAD-01      ------------------------VYT-VSRWQEAEPQ------------
A0A673I6H5_BAD-01      ------------------------VYM-VSRWQEAVPQ------------
A0A671SBB4_BAD-01      ------------------------VYM-VSRWQEAEPQ------------
A0A672R7P6_BAD-01      ------------------------VYM-VSRWQEAEPQ------------
A0A3P8Y761_BAD-02      ------------------------VFA-TSGGERSGEL------------
A0A3Q2QC80_BAD-01      ------------------------AST-ISRE---EEL------------
A0A4W6EMZ7_BAD-02      ------------------------AST-ASRD---EGL------------
A0A3Q3FKT9_BAD-02      ------------------------AYT-VSRD---EEL------------
A0A3Q3FKT9_BAD-03      ------------------------AYT-VSRD---EEL------------
A0A3B5L9R9_BAD-01      -----------------------------------VEL------------
A0A667ZNC6_BAD-01      ------------------------VST-VSKD---EEL------------
A0A3P9B2E4_BAD-01      ------------------------TSS-IARD---EEL------------
A0A668V3Q4_BAD-01      ------------------------TSS-VARD---EDL------------
I3K7B6_BAD-01          ------------------------TSS-VARD---EDL------------
A0A3Q3C680_BAD-01      ------------------------TSS-IARD---EEL------------
A0A3P8QRJ7_BAD-01      ------------------------TSS-IARD---EEL------------
A0A3Q4GGN3_BAD-01      ------------------------TSS-IARD---EEL------------
A0A3B4GXJ6_BAD-01      ------------------------TSS-IARD---EEL------------
A0A3Q2D5S0_BAD-01      ------------------------A---FTRE---EE-------------
A0A3Q0QNQ2_BAD-01      ------------------------TSS-VSRD---EEL------------
A0A3P8WI83_BAD-02      ------------------------AST-ISRE---EAF------------
A0A3P8WI83_BAD-01      ------------------------AST-ISRE---EAF------------
A0A3P9HNZ2_BAD-01      ------------------------AST-YSRD---EDL------------
A0A3B3BQF7_BAD-01      ------------------------VST-YSRD---EDL------------
A0A672JQ68_BAD-01      ------------------------AST-VSRD---EEL------------
A0A2U9BAC9_BAD-01      ------------------------AST-LSRD---EEL------------
A0A4W6EMZ7_BAD-01      ------------------------AST-ASRD---EGL------------
A0A3B4VFC5_BAD-01      ------------------------TST-VSRD---EEF------------
A0A3B4W9T1_BAD-01      ------------------------TST-VSRD---EEF------------
A0A3Q1K1C7_BAD-01      ------------------------AST-VYRD---EEL------------
A0A672YF93_BAD-01      ------------------------VSN-VTRD---EEL------------
A0A3Q1GWH9_BAD-01      ------------------------AST-LSRD---EEL------------
A0A3Q1CPU7_BAD-01      ------------------------AST-LSRD---EEL------------
A0A3P8TWH6_BAD-01      ------------------------AST-LSRD---EEL------------
H3D8J8_BAD-01          ------------------------ASA-VSRD---EEL------------
A0A6F9CQZ0_BAD-02      ------------------------AFS-TSRGKRNGEL------------
A0A6F9CA11_BAD-02      ------------------------A----------QEL------------
A0A1S3N9Q3_BAD-01      ------------------------A----------QEL------------
A0A3Q3FKT9_BAD-01      --------------------------A-YTVSRDEEL-------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------HE--------GAG-DRRPRLISYPPLREGPAVEVGP
H3ANP3_BAD-03          --------------YG-WVKLRKRNNM-EILGRPSSES------------
H3ANP3_BAD-04          --------------WG-FT-----DNM-EILGRPSSES------------
H3ANP3_BAD-02          ------------------T-----DNM-EILGRPSSES------------
H3ANP3_BAD-01          ------------------T-----DNM-EILGRPSSES------------
A0A4X2KAA5_BAD-01      -----------------GA-----GAG-DRRPRLISYP------------
A0A672V9F8_BAD-01      -----------------VG-----GGV-QARARLGSEG------------
A0A674GQ16_BAD-01      -----------------SG-----GGA-GG----GGDP------------
A0A6I8NVP2_BAD-01      SEAPPFSWLPPRLPPATGP-----RAK-EPSGRLNSEP------------
G3TP47_BAD-01          --------------HG-GA-----AAV-ETRSRHSSYP------------
A0A287CT05_BAD-02      --------------HG-GA-----GAT-ETRSRHSSYP------------
A0A287CT05_BAD-01      --------------HG-GA-----GAT-ETRSRHSSYP------------
G5B6Q3_BAD-02          --------------HG-GT-----GAT-ETRSRHSSYP------------
G5B6Q3_BAD-01          --------------HG-GT-----GAT-ETRSRHSSYP------------
Q61337_BAD-02          --------------HG-GA-----GAM-ETRSRHSSYP------------
Q61337_BAD-05          --------------HG-GA-----GAM-ETRSRHSSYP------------
Q61337_BAD-01          --------------HG-GA-----GAM-ETRSRHSSYP------------
Q61337_BAD-06          --------------HG-GA-----GAM-ETRSRHSSYP------------
Q61337_BAD-04          --------------HG-GA-----GAM-ETRSRHSSYP------------
Q61337_BAD-03          --------------HG-GA-----GAM-ETRSRHSSYP------------
A0A2I3TBK7_BAD-01      --------------HG---------------EGT--SS------------
A0A2R8Z674_BAD-02      --------------HG---------------EGT--SS------------
A0A2I2YFH2_BAD-03      --------------HG---------------EGT--SS------------
Q92934_BAD-03          --------------HG---------------EGT--SS------------
A0A2K5M0A7_BAD-02      --------------HG---------------GT---SS------------
A0A2K5XJR2_BAD-02      --------------HG---------------GT---SS------------
A0A096MLD5_BAD-03      --------------HG---------------GT---SS------------
A0A2K6E7I4_BAD-02      --------------HG---------------GT---SS------------
A0A2K5PDB1_BAD-02      --------------HG---------------GT---SS------------
A0A2K5E6A6_BAD-02      --------------HG---------------GT---SS------------
A0A2K6TG62_BAD-02      --------------HG---------------GT---SS------------
A0A2K5HKU7_BAD-02      --------------HG---------------GRAWYSP------------
A0A2K6N196_BAD-02      --------------HG---------------GRAWYYP------------
A0A2K6PUL3_BAD-02      --------------HG---------------GRAWYYP------------
A0A2K5M0A7_BAD-03      --------------HG---------------GGAWYSP------------
A0A2K5XJR2_BAD-03      --------------HG---------------GGAWYSP------------
A0A096MLD5_BAD-02      --------------HG---------------GRAWYSP------------
A0A2K6E7I4_BAD-03      --------------HG---------------GRAWYSP------------
A0A2I2YFH2_BAD-04      --------------HG---------------GRTSYSP------------
Q92934_BAD-04          --------------HG---------------GRTSYSP------------
A0A2I3TBK7_BAD-03      --------------HG---------------GRTSYSP------------
A0A2R8Z674_BAD-03      --------------HG---------------GRTSYSP------------
A0A2K5E6A6_BAD-03      --------------HG---------------GE--YST------------
A0A2K5PDB1_BAD-03      --------------HG----------------------------------
A0A2K6TG62_BAD-03      --------------HG----------------------------------
G1P8C5_BAD-01          --------------HD-GA-----GSV-EPRSRHSSYP------------
A0A452ER54_BAD-02      --------------HG-GT-----GAV-ETRSRHSSYP------------
W5P8G9_BAD-01          --------------HG-GT-----GAV-ETRSRHSSYP------------
Q61337_BAD-07          --------------HG-GA-----GAM-ETRSRHSSYP------------
O35147_BAD-01          --------------HG-GA-----GTM-ETRSRHSSYP------------
F7DN67_BAD-01          --------------HG-GA-----GAV-ETRSRHSSYP------------
Q45KI9_BAD-01          --------------HG-GA-----GA--ETRSRHSSFP------------
A0A3Q7SWS0_BAD-01      --------------HG-GA-----GA--ETRSRHSSFP------------
H0WVR2_BAD-01          --------------HGAGP-----GAV-ETRSRHSSYP------------
A0A2K6GWV0_BAD-01      --------------HG-GA-----GSV-ETRSRHSSYP------------
H0V608_BAD-01          --------------HG-GT-----VAM-ETRSRHRSYP------------
A0A2K5PDB1_BAD-01      --------------HG-GA-----GAV-ETRSRHRSYP------------
U3F2S3_BAD-01          --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K5E6A6_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K6TG62_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K5M0A7_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A1D5QBW1_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K6E7I4_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K5XJR2_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A096MLD5_BAD-04      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K6N196_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K6PUL3_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K5HKU7_BAD-01      --------------HG-GA-----GAV-ETRSRHSSHP------------
A0A0D9R491_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2K5VCA1_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
B4DZQ9_BAD-01          --------------HG-GA-----GAV-EIRSRHSSYP------------
A0A096MLD5_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A2I2YFH2_BAD-02      --------------HG-GA-----GAV-EIRSRHSSYP------------
A0A2I2YFH2_BAD-01      --------------HG-GA-----GAV-EIRSRHSSYP------------
Q92934_BAD-01          --------------HG-GA-----GAV-EIRSRHSSYP------------
Q92934_BAD-02          --------------HG-GA-----GAV-EIRSRHSSYP------------
A0A2I3TBK7_BAD-02      --------------HG-GA-----GAV-EIRSRHSSYP------------
A0A2R8Z674_BAD-01      --------------HG-GA-----GAV-EIRSRHSSYP------------
A0A2J8TYJ3_BAD-01      --------------HG-GA-----GAV-EIRSRHSSYP------------
A0A4X1VE31_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A4X1VE31_BAD-02      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A287AEF3_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A4X1VE31_BAD-03      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A671ELU4_BAD-01      --------------HG-GA-----GSV-EPRSRHSSYP------------
A0A452ER54_BAD-01      --------------HG-GT-----GAV-ETRSRHSSYP------------
G1MI17_BAD-01          --------------HG-GA-----GAV-EPRSRHSSYP------------
A0A452RJM6_BAD-01      --------------HG-GA-----GAV-EPRSRHSSYP------------
A0A384DJL2_BAD-01      --------------HG-GA-----GAV-EPRSRHSSYP------------
M3YNE7_BAD-01          --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A667H8Z9_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A673V6P8_BAD-01      --------------HG-GA-----GAV-ETRSRHSSYP------------
A0A4W2C9A8_BAD-01      --------------HG-GT-----GAV-ETRSRHSSYR------------
A0A4W2C9A8_BAD-01      --------------HG-GT-----GAV-ETRSRHSSYR------------
F1MUT9_BAD-01          --------------HG-GT-----GAV-ETRSRHSSYR------------
Q3SYZ0_BAD-01          --------------HG-GT-----GAV-ETRSRHSSYR------------
A0A4U1FMC3_BAD-01      --------------HG-GT-----GAV-ETRSRHSSYS------------
A0A2Y9EHU3_BAD-01      --------------HG-GT-----GAV-DTRSRHSSYS------------
A0A6F9BAV3_BAD-01      ------------------------VCS-QVGKREDTEF------------
A0A3P8YI30_BAD-02      ------------------------VCS-QVGRQDNTEF------------
A0A4W5R1T6_BAD-01      ------------------------VFS-HVGRRDDTEF------------
A0A060W8P9_BAD-01      ------------------------VCS-QVGRRDDTEF------------
B5X1T1_BAD-01          ------------------------VCS-QVGRRDNTEF------------
A0A673ZHY7_BAD-01      ------------------------VCS-QVGRREDTEF------------
A0A671NP27_BAD-01      ------------------------GRH-RNLSMNDENL------------
A0A672SAE4_BAD-01      ------------------------GRH-RNLSMNDEDL------------
A0A672SAE4_BAD-02      ------------------------GRH-RNLSMNDEDL------------
A0A671RUV0_BAD-01      ------------------------GRH-RNLSMNDEDL------------
A0A673HRQ3_BAD-01      ------------------------GRH-RNLSMNDEDL------------
A0A672RGH0_BAD-01      ------------------------GRH-RNLSMNDEDL------------
Q4V925_BAD-02          ------------------------GRQ-RNLSMNEEDL------------
Q4V925_BAD-03          ------------------------GRQ-RNLSMNEEDL------------
A7MCM4_BAD-01          ------------------------GRQ-RNLSMNEEDL------------
Q4V925_BAD-04          ------------------------GRQ-RNLSMNEEDL------------
Q4V925_BAD-01          ------------------------GRQ-RNLSMNEEDL------------
A0A3B3QX41_BAD-01      --------------------------V-SSIRSEDLDF------------
A0A3Q3RXS8_BAD-01      --------------------------A-SNRIRLSSES------------
A0A3Q0QNQ2_BAD-02      ----------------------------------DEEL------------
A0A3Q3WTY4_BAD-01      ----------------------------------GRTL------------
A0A3P8Y761_BAD-01      ------------------------VFA-TSGGERSGEL------------
A0A4W5JLL9_BAD-01      ----------------------------------AQEL------------
A0A3B5Q2N7_BAD-01      --------------------------A-STISR-EVEL------------
A0A087X8P8_BAD-01      --------------------------A-STISR-EEEL------------
A0A3B3UA11_BAD-01      --------------------------A-STISR-EEEL------------
A0A3B3YFR1_BAD-01      --------------------------A-STISR-EEEL------------
A0A3P9Q7C3_BAD-01      --------------------------A-STISR-EEEL------------
A0A3B3HDU2_BAD-01      --------------------------A-STYSR-DEDL------------
A0A3P9KSL7_BAD-02      --------------------------A-STYSR-DEDL------------
A0A3P9KSL7_BAD-01      --------------------------A-STYSR-DEDL------------
A0A3B5BAL2_BAD-01      --------------------------A-TTVSR-DEEL------------
A0A665TUH3_BAD-01      --------------------------T-STGSR-DEDF------------
A0A674MXC1_BAD-04      --------------------------A-STFSR-EEEL------------
A0A674MXC1_BAD-01      --------------------------A-STFSR-EEEL------------
A0A674MXC1_BAD-02      --------------------------A-STFSR-EEEL------------
A0A674MXC1_BAD-03      --------------------------A-STFSR-EEEL------------
A0A671TL42_BAD-01      --------------------------A-STVSR-DVEL------------
A0A3Q3AEL8_BAD-01      --------------------------S-STSSRGEEEL------------
A0A3Q3AEL8_BAD-02      --------------------------S-STSSRGEEEL------------
A0A1A8AQV0_BAD-01      --------------------------V-SNVSRDEDLL------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------A-LAVSR-EEEF------------
A0A3Q3R5S3_BAD-01      --------------------------A-STVQ------------------
                                                                         

Q61337_BAD-09          --------------------------------------------XAAQRY
Q2PG01_BAD-01          -------------MEE------------EPSPFRGRSRSAPPNLWAAQRY
A0A2I3H4B2_BAD-01      -------------MGE------------EPSPFRGRSRSAPPNLWAAQRY
Q92934_BAD-05          -------------MGE------------EPSPFRGRSRSAPPNLWAAQRY
Q92934_BAD-06          -------------MGE------------EPSPFRGRSRSAPPNLWAAQRY
A0A670JUY4_BAD-01      -------------WTL------------ALGTFRARSRSAPPILWAAQRY
A0A670YRG7_BAD-01      -------------TSD------------EVGAFRARSRSAPPILWAAQRY
Q6P7C5_BAD-01          ----------------------------HGGRFLT---------------
A0A3B1JLM2_BAD-01      -DGASAED-G---GVG------------DGAPFRGRSQSAPAALWKAKKY
A0A4W4DXF5_BAD-01      -DGVSAEEGG---GAC------------EGAPFRGRSQSAPAALWKAKKY
A0A452IFQ4_BAD-01      -PSLEPEVQD---EPG--------------GAFRARSRSAPPILWAAMRY
A0A674I2R9_BAD-01      -PSLEPEVQD---EPG--------------GAFRARSRSAPPILWAAMRY
C1C3S9_BAD-01          -EASETDSVG---EL---------------QHFRSRSRSAPSSLMVAARY
A0A6I8PXS6_BAD-01      -ESSETDKVG---EL---------------HPFRSRSRSAPSS-MIATKY
A0A3P8YI30_BAD-01      -QVAMTPTEE---SGG------------DAAPFRGRSQSAPPALWAAKKY
A0A3B4DUY7_BAD-01      ---GLLAEDG---GAG------------DGAPFRGRSQSAPAALWKAKKY
A0A337SAW2_BAD-01      -AGTEEDEGT---EEE------------EPSPFRGRSRSAPPNLWAALRY
A0A673J9C6_BAD-01      ------ADEG---DLV------------GGDPFRPRSRSAPPALWAAKKY
A0A4W5JLL9_BAD-02      ------GVEG---MPT------------DGASFRVRSQSAPPALWAAKKY
A0A674DKC6_BAD-01      ------GVEG---VPT------------DGASFRGRSQSAPPALWAAKRY
A0A4W4HE29_BAD-01      -------------QDS------------GAESFRRRSRSAPPILWAAKKY
A0A3B4CPH6_BAD-01      -AVRHGDGAA------------------DGDSFRRRCRSAPPALWAAKKY
A0A674AVP9_BAD-01      -DVMTPTEEG---G-G------------DGASFRGRSQSAPPALWAAKKY
A0A1S3L0Z2_BAD-01      -DVMTPTEEG---G-G------------DGASFRGRSQSAPPALWAAKKY
B5XEF1_BAD-01          -DVMTPTEEG---G-G------------DGASFRGRSQSAPPALWAAKKY
A0A4W5MZR2_BAD-01      -DVMTPTEEG---G-G------------DGASFRGRSQSAPPALWAAKKY
A0A060W8W7_BAD-01      -DVMTPTEDG---G-G------------DGASFRGRSQSAPPALWAAKKY
E7FBJ6_BAD-01          -DGASVEEN------G------------DGLPFRGRSQSAPAALWKAKKY
A0A673J5Q9_BAD-01      -DGALAEENG---GTG------------DGLPFRGRSQSAPAVLWKAKKY
A0A671PX91_BAD-01      -DGALAEENG---GTG------------DGLPFRGRSQSAPAALWKAKKY
A0A672LB88_BAD-01      -DGALVEENG---GTG------------DGLPFRGRSQSAPAALWKAKKY
A0A673I6H5_BAD-01      -DGASAEENG---GTG------------DGLPFRGRSQSAPAALWKAKKY
A0A671SBB4_BAD-01      -DGASAEENG---GTG------------DGLPFRGRSQSAPAALWKAKKY
A0A672R7P6_BAD-01      -DGASAEENG---GTG------------DGLPFRGRSQSAPAALWKAKKY
A0A3P8Y761_BAD-02      -QGLGQGLNC---VAT------------EGLPFRVRSQSAPPALWAAKRY
A0A3Q2QC80_BAD-01      -QGRAEEEAG---TPT------------EGLPFRNRSNSAPPALWAAKKY
A0A4W6EMZ7_BAD-02      -QVRGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3Q3FKT9_BAD-02      -QARGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3Q3FKT9_BAD-03      -QARGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3B5L9R9_BAD-01      -QARGEEEVG---TPT------------EGFPFRGRSLSAPPSLWAAKKY
A0A667ZNC6_BAD-01      -LARGEGEDG------------------DGAPFRGRSQSAPPALWAAKKY
A0A3P9B2E4_BAD-01      -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A668V3Q4_BAD-01      -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
I3K7B6_BAD-01          -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3Q3C680_BAD-01      -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3P8QRJ7_BAD-01      -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3Q4GGN3_BAD-01      -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3B4GXJ6_BAD-01      -MARGEDEVC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3Q2D5S0_BAD-01      --ARGEEEVG---TPT------------EGYPFRGRSNSAPPALWAAKKY
A0A3Q0QNQ2_BAD-01      -VVRGEDEIC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3P8WI83_BAD-02      -QSWGEEEAG---TPT------------EGAPFRGRSRSAPPALWAAKKY
A0A3P8WI83_BAD-01      -QSWGEEEAG---TPT------------EGAPFRGRSRSAPPALWAAKKY
A0A3P9HNZ2_BAD-01      -AR--EDEAG---TPT------------DGLAFRGRSKSAPPALWAAKKY
A0A3B3BQF7_BAD-01      -PR--EDEAG---TPT------------DGLAFRGRSKSAPPALWAAKKY
A0A672JQ68_BAD-01      -QARAEEEVG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A2U9BAC9_BAD-01      -LTRWDEEAG---TPT------------DGAPFRGRSKSAPPALWAAMKY
A0A4W6EMZ7_BAD-01      -QVRGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3B4VFC5_BAD-01      -QARGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3B4W9T1_BAD-01      -QARGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3Q1K1C7_BAD-01      -QAKADEEAG---TPT------------DGAPFRARSKSAPPALWAAKKY
A0A672YF93_BAD-01      -QMRGEDEAS---TPT------------EGAPFRARSKSAPPALWAAKKY
A0A3Q1GWH9_BAD-01      -QAKGEEEAG---TPT------------EGAPFRARSKSAPPALWAAKKY
A0A3Q1CPU7_BAD-01      -QARGEEEAG---TPT------------DGAPFRARSKSAPPALWAAKKY
A0A3P8TWH6_BAD-01      -QARGEEEAG---TPT------------DGAPFRARSKSAPPALWAAKKY
H3D8J8_BAD-01          -QGNGDDEAG---TPT------------DGAPFRGRSRSAPPALWAAKKY
A0A6F9CQZ0_BAD-02      -QGRGPGVDG---IPT------------DGAPFRVRSQSAPPALWAAKRY
A0A6F9CA11_BAD-02      -QGSGPGVDG---VPT------------DGASFRVRSQSAPPALWAAKKY
A0A1S3N9Q3_BAD-01      -QGRGPGVEG---MPT------------DGASFRGRSQSAPPALWAAKRY
A0A3Q3FKT9_BAD-01      -QARGEEEAG---TPT------------EGAPFRGRSKSAPPALWAAKKY
A0A3B1IH05_BAD-01      -AGRHEDGAR------------------DGDSFRRRSRSAPPSLWAAKKY
A0A5F8GA49_BAD-01      EAGAQAERAE---AEE------------DRGLFRSRSSSAPPILWAARRY
H3ANP3_BAD-03          -QISDSESLD------------------ELGPFRTRSRSAPPNFWAARKY
H3ANP3_BAD-04          -QISDSESLD------------------ELGPFRTRSRSAPPNFWAARKY
H3ANP3_BAD-02          -QISDSESLD------------------ELGPFRTRSRSAPPNFWAARKY
H3ANP3_BAD-01          -QISDSESLD------------------ELGPFRTRSRSAPPNFWAARKY
A0A4X2KAA5_BAD-01      -PLREGPGEA---SPEAEAEADFFEGEEERSLFRSRSSSAPPILWAARRY
A0A672V9F8_BAD-01      -ERG--PGEP---PPGV----------------RGRSRSAPPALWAARRF
A0A674GQ16_BAD-01      -QIGAPPGDP---PPA-----------------RGRSRSAPPVLWAAQRY
A0A6I8NVP2_BAD-01      -PDSEAEEH---------------------SPFRGRSHSAPPILWVAQRY
G3TP47_BAD-01          -AGSDEAEGL---EED------------P-SPFRGRSLSAPPNLWAAQRY
A0A287CT05_BAD-02      -ADTDLDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A287CT05_BAD-01      -ADTDLDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
G5B6Q3_BAD-02          -TGMEEEAGM---KEE------------P-SPFRGRSRSAPPNLWAAQRY
G5B6Q3_BAD-01          -TGMEEEAGM---KEE------------P-SPFRGRSRSAPPNLWAAQRY
Q61337_BAD-02          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
Q61337_BAD-05          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
Q61337_BAD-01          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
Q61337_BAD-06          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
Q61337_BAD-04          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
Q61337_BAD-03          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
A0A2I3TBK7_BAD-01      -PEERGHSNP---DAA------------KLQLDASLPVLVGSELGQG---
A0A2R8Z674_BAD-02      -PEERGHSNA---DAA------------KLQLDASLPVLVGSELGQG---
A0A2I2YFH2_BAD-03      -PEERRHSNA---DAA------------KLQLDASLPVLVGSELGQG---
Q92934_BAD-03          -PEERGHSNA---DAA------------KLQLDASLPVLVGSELGQG---
A0A2K5M0A7_BAD-02      -PEERGHSDA---DAA------------KLQLDASLPVLVGSELGQG---
A0A2K5XJR2_BAD-02      -PEERGHSDA---DAA------------KLQLDASLPVLVGSELGQG---
A0A096MLD5_BAD-03      -PEERGHSDA---DAA------------KLQLDASLPVLVGSELGQG---
A0A2K6E7I4_BAD-02      -PEERGHSDA---DAA------------KLQLDASLPVLVGSELGQG---
A0A2K5PDB1_BAD-02      -PEERGHSNA---DAA------------KRQLDASHPVLVGSELGQG---
A0A2K5E6A6_BAD-02      -PEERGHSNA---DAA------------KLQLDASHPVLVGSELGQG---
A0A2K6TG62_BAD-02      -PEERGHSNA---DAA------------KLQLDASHPVLVGSELGQG---
A0A2K5HKU7_BAD-02      -S-ESEDSEN---PSA------------RMLTEASAGMSAPATDSEAQHA
A0A2K6N196_BAD-02      -A-ESEDSEN---PSA------------RMLAEASAGMSAPATDSEAQLA
A0A2K6PUL3_BAD-02      -A-ESEDSEN---PSA------------RMLAEASAGMSAPATDSEAQLA
A0A2K5M0A7_BAD-03      -SWESEDSEN---PSA------------RMLAEASARMSAPATDSEAQHA
A0A2K5XJR2_BAD-03      -SWESEDSEN---PSA------------RMLAEASARMSAPATDSEAQLA
A0A096MLD5_BAD-02      -SWESEDSEN---PSA------------RMLAEASAPMSAPATDSEAQHA
A0A2K6E7I4_BAD-03      -SWESEDSEN---PSA------------RMLAEASARMSAPATDSEAQHA
A0A2I2YFH2_BAD-04      -SWESEDSEN---PSA------------GMLAEASAGMSAPAADSEAQHA
Q92934_BAD-04          -SWESEDSEN---PSA------------GMLAEASAGMSAPAADSEAQHA
A0A2I3TBK7_BAD-03      -SWESEDSEN---PSA------------GMLAEASAGMSAPAADSEAQHA
A0A2R8Z674_BAD-03      -SWESEDSEN---PSA------------GMLAEASAGMSAPAADSEAQHA
A0A2K5E6A6_BAD-03      -CASASSSEN---PSA------------RMLSKASAGMSAPATDS-----
A0A2K5PDB1_BAD-03      --------EN---PSA------------RMLSKTSAGMSSPATDSEAQHT
A0A2K6TG62_BAD-03      --------EN---PSA------------KMLSKASAGMSAPATDSEAQHT
G1P8C5_BAD-01          -TGTEEDDDT---EEG------------EPSPFRGRSRSAPPNLWAAQRY
A0A452ER54_BAD-02      -AGPEDDEGT---EEE------------DLGPFRGRSRSAPPNLWAAQRY
W5P8G9_BAD-01          -AGPEDDEGT---EEE------------DLGPFRGRSRSAPPNLWAAQRY
Q61337_BAD-07          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
O35147_BAD-01          -AGTEEDEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
F7DN67_BAD-01          -EGTEDEGME---GEE------------P-GPFRGRSRSAPPNLWAARRY
Q45KI9_BAD-01          -AGTDEDEGM---EEE------------ELSPFRGRSSSAPPNLCAARRY
A0A3Q7SWS0_BAD-01      -AGTDEDEGM---EEE------------ELSPFRGRSSSAPPNLCAALRY
H0WVR2_BAD-01          -AGTEEDEGI----EE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K6GWV0_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
H0V608_BAD-01          -AGTEEEEGM---EEE------------L-SPFRGRSRSAPPNLWAAQRY
A0A2K5PDB1_BAD-01      -AGTEEDEGM---EEE------------P-STFRGRSRSAPPNLWAAQRY
U3F2S3_BAD-01          -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K5E6A6_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K6TG62_BAD-01      -AGTEGDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K5M0A7_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A1D5QBW1_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K6E7I4_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K5XJR2_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A096MLD5_BAD-04      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K6N196_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K6PUL3_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K5HKU7_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A0D9R491_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2K5VCA1_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
B4DZQ9_BAD-01          -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A096MLD5_BAD-01      -AGTEEDEGM---EEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2I2YFH2_BAD-02      -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2I2YFH2_BAD-01      -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
Q92934_BAD-01          -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
Q92934_BAD-02          -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2I3TBK7_BAD-02      -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2R8Z674_BAD-01      -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A2J8TYJ3_BAD-01      -AGTEDDEGM---GEE------------P-SPFRGRSRSAPPNLWAAQRY
A0A4X1VE31_BAD-01      -EGTEEDEGT---EDE------------ELSPFRGRSLSAPPILWAAQRY
A0A4X1VE31_BAD-02      -EGTEEDEGT---EDE------------ELSPFRGRSLSAPPILWAAQRY
A0A287AEF3_BAD-01      -EGTEEDEGT---EDE------------ELSPFRGRSLSAPPILWAAQRY
A0A4X1VE31_BAD-03      -EGTEEDEGT---EDE------------ELSPFRGRSLSAPPILWAAQRY
A0A671ELU4_BAD-01      -AGTEEDEEM---EEE------------EPSPFRGRSRSAPPNLWAAQRY
A0A452ER54_BAD-01      -AGPEDDEGT---EEE------------DLGPFRGRSRSAPPNLWAAQRY
G1MI17_BAD-01          -AGTEEDEGL---EEE------------ELSPFRGRSSSAPPNLCAALRY
A0A452RJM6_BAD-01      -AGTEEDEGL---EEE------------ELSPFRGRSSSAPPNLCAALRY
A0A384DJL2_BAD-01      -AGTEEDEGL---EEE------------ELSPFRGRSSSAPPNLCAALRY
M3YNE7_BAD-01          -AGTEEDEGM---EEE------------ELSPFRGRSRSAPPNLCAALRY
A0A667H8Z9_BAD-01      -AGTEEDEGT---EEE------------EPSPFRGRSRSAPPNLWAALRY
A0A673V6P8_BAD-01      -AGTEEDEGT---EEE------------EPSPFRGRSRSAPPNLCAALRY
A0A4W2C9A8_BAD-01      -AGPEDNEET---EEE------------DLGPFRGRSRSAPPNLWAAQRY
A0A4W2C9A8_BAD-01      -AGPEDNEET---EEE------------DLGPFRGRSRSAPPNLWAAQRY
F1MUT9_BAD-01          -AGPEDNEET---EEE------------DLGPFRGRSRSAPPNLWAAQRY
Q3SYZ0_BAD-01          -AGPEDNEET---EEE------------DLGPFRGRSRSAPPNLWAAQRY
A0A4U1FMC3_BAD-01      -AGTEDEEGT---EEE------------EPSPFRGRSRSAPPNLWAARRY
A0A2Y9EHU3_BAD-01      -AGTEDDEGT---EEE------------EPSPFRGRSRSAPPNLWAAQRY
A0A6F9BAV3_BAD-01      -QDVMTPTEE---GGG------------DGASFRGRSQSAPPALWAAKKY
A0A3P8YI30_BAD-02      -QVAMTPTEE---SGG------------DAAPFRGRSQSAPPALWAAKKY
A0A4W5R1T6_BAD-01      -QDAMTPTEE---GGG------------DGAPFRSRSQSAPPALWAAKKY
A0A060W8P9_BAD-01      -QDAITPTEE---GGG------------DGAPFRSRSQSAPPTLWAAKKY
B5X1T1_BAD-01          -QDVMTPTEE---GGG------------DGAPFRSRSQSAPPTLWAAKKY
A0A673ZHY7_BAD-01      -QDVMTPTEE---GGG------------DGAPFRSRSQSAPPTLWAAKKY
A0A671NP27_BAD-01      -LETGAADEG---DLV------------GSDPFRPRSRSAPPALWAAKKY
A0A672SAE4_BAD-01      -LETGAADEG---DLV------------GGDPFRPRSRSAPPALWAAKKY
A0A672SAE4_BAD-02      -LETGAADEG---DLV------------GGDPFRPRSRSAPPALWAAKKY
A0A671RUV0_BAD-01      -LETGAADEG---DLV------------GGDPFRPRSRSAPPALWAAKKY
A0A673HRQ3_BAD-01      -LETGAADEG---DLV------------GGDPFRPRSRSAPPALWAAKKY
A0A672RGH0_BAD-01      -LETGAADEG---DLV------------GGDPFRPRSRSAPPALWAAKKY
Q4V925_BAD-02          -LETGVAEDP---HML-------------GDPFRPRSRSAPPALWAAKKY
Q4V925_BAD-03          -LETGVAEDP---HML-------------GDPFRPRSRSAPPALWAAKKY
A7MCM4_BAD-01          -LETGVAEDP---HML-------------GDPFRPRSRSAPPALWAAKKY
Q4V925_BAD-04          -LETGVAEDP---HML-------------GDPFRPRSRSAPPALWAAKKY
Q4V925_BAD-01          -LETGVAEDP---HML-------------GDPFRPRSRSAPPALWAAKKY
A0A3B3QX41_BAD-01      -GEGGASEEGGGVCPG------------DGTPFRGRSRSAPPALWAAQRY
A0A3Q3RXS8_BAD-01      -QSRVDEEAG---TPT------------DGAPFRGRSKSAPPALWAAKKY
A0A3Q0QNQ2_BAD-02      -VVRGEDEIC---TPT------------EGDPFRRRSKSAPPALWAAKKY
A0A3Q3WTY4_BAD-01      -QVKGEDEAG---TPT------------DGAPFRGRSKSAPPSLWAAKKY
A0A3P8Y761_BAD-01      -QGLGQGLNC---VAT------------EGLPFRVRSQSAPPALWAAKRY
A0A4W5JLL9_BAD-01      -QGRGPGVEG---MPT------------DGASFRVRSQSAPPALWAAKKY
A0A3B5Q2N7_BAD-01      -QARGEEEVG---TPT------------EGFPFRGRSLSAPPSLWAAKKY
A0A087X8P8_BAD-01      -QARGEEEVG---TPT------------EGFPFRGRSNSAPPSLWAAKKY
A0A3B3UA11_BAD-01      -QARGEEEVG---TPT------------EGFPFRGRSNSAPPSLWAAKKY
A0A3B3YFR1_BAD-01      -QARGEEEVG---TPT------------EGFPFRGRSNSAPPSLWAAKKY
A0A3P9Q7C3_BAD-01      -QARGEEEVG---TPT------------EGFPFRVRSNSAPPSLWAAKKY
A0A3B3HDU2_BAD-01      -AR--EDEAG---TPT------------DGLAFRGRSKSAPPALWAAKKY
A0A3P9KSL7_BAD-02      -AR--EDEAG---TPT------------DGLAFRGRSKSAPPALWAAKKY
A0A3P9KSL7_BAD-01      -AR--EDEAG---TPT------------DGLAFRGRSKSAPPALWAAKKY
A0A3B5BAL2_BAD-01      -QARGEEEAG---TPT------------DGAPFRGRSKSAPPALWAAKKY
A0A665TUH3_BAD-01      -LARGDDEAG---TPT------------DGAPFRGRSKSAPPALWAAKKY
A0A674MXC1_BAD-04      -QGNGEDEAG---TPT------------EGAPFRGRSRSAPPALWAAQRY
A0A674MXC1_BAD-01      -QGNGEDEAG---TPT------------EGAPFRGRSRSAPPALWAAQRY
A0A674MXC1_BAD-02      -QGNGEDEAG---TPT------------EGAPFRGRSRSAPPALWAAQRY
A0A674MXC1_BAD-03      -QGNGEDEAG---TPT------------EGAPFRGRSRSAPPALWAAQRY
A0A671TL42_BAD-01      -QARGEDEAG---TPT------------DGAPFRGRSKSAPPALWAAKKY
A0A3Q3AEL8_BAD-01      -PARADDEPG---TPT------------EGYPFRGRSKSAPPALWAAKKY
A0A3Q3AEL8_BAD-02      -PARADDEPG---TPT------------EGYPFRGRSKSAPPALWAAKKY
A0A1A8AQV0_BAD-01      -ARVAEEEPG---TPT------------EGFPFRGRSKSAPPALWAAKKY
G3Q8B3_BAD-01          -EELWLDETG---TPT------------EGAPFRVRSKSAPPALWAAKKY
A0A3Q2Y0E4_BAD-01      -QARVDEEVG---TPT------------DGAPFRGRSKSAPPVLWAAKKY
A0A3Q3R5S3_BAD-01      -DAKSDEEAG---TPT------------DGAPFRGRSKSAPPALWAAKKY
                                                                         

Q61337_BAD-09          GR-ELRRMSDEFEGSFKF-------------------------------H
Q2PG01_BAD-01          GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2I3H4B2_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
Q92934_BAD-05          GR-ELRRMSDEFVDSFKK-------------------------------G
Q92934_BAD-06          GR-ELRRMSDEFVDSFKK-------------------------------G
A0A670JUY4_BAD-01      GR-ELRRMSDEFHGEL-Q-------------------------------K
A0A670YRG7_BAD-01      GR-ELRRMSDEFHG------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GD
A0A4W4DXF5_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A452IFQ4_BAD-01      GR-ELRRMSDEFDVALQV--------------------------------
A0A674I2R9_BAD-01      GR-ELRRMSDEFDVALQV--------------------------------
C1C3S9_BAD-01          GR-ELRRMSDEFDQIFTS--------------------------------
A0A6I8PXS6_BAD-01      GR-ELRRMSDEFEKSFTG--------------------------------
A0A3P8YI30_BAD-01      GC-QLRRMSDEFDTWLDK------------------------------GE
A0A3B4DUY7_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GD
A0A337SAW2_BAD-01      GR-ELRRMSDEFQGSFKG--------------------------------
A0A673J9C6_BAD-01      GR-QLRRMSDEFDILLDK------------------------------G-
A0A4W5JLL9_BAD-02      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A674DKC6_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A4W4HE29_BAD-01      GR-QLRKMSDEFDTLLDK-------------------------------G
A0A3B4CPH6_BAD-01      GR-QLRKMSDEFDTLLDK-------------------------------G
A0A674AVP9_BAD-01      GC-QLRRMSDEFDTWLDK------------------------------GV
A0A1S3L0Z2_BAD-01      GC-QLRRMSDEFDTWLDK------------------------------GV
B5XEF1_BAD-01          GC-QLRRMSDEFDTWLDK------------------------------GV
A0A4W5MZR2_BAD-01      GC-QLRRMSDEFDTWLDK------------------------------GE
A0A060W8W7_BAD-01      GC-QLRRMSDEFDTWLDK------------------------------GE
E7FBJ6_BAD-01          GR-QLRRMSDEFDTWLDK------------------------------GV
A0A673J5Q9_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A671PX91_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A672LB88_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A673I6H5_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A671SBB4_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A672R7P6_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A3P8Y761_BAD-02      GR-QLRRMSDEFDTWLDK------------------------------GQ
A0A3Q2QC80_BAD-01      GR-QLRRMSDEFGSLLDK------------------------------GE
A0A4W6EMZ7_BAD-02      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A3Q3FKT9_BAD-02      GR-QLRRMSDEFDILLDK------------------------------GV
A0A3Q3FKT9_BAD-03      GR-QLRRMSDEFDILLDK------------------------------GE
A0A3B5L9R9_BAD-01      GR-QLRRMSDEFVNLLDK------------------------------GE
A0A667ZNC6_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3P9B2E4_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------G-
A0A668V3Q4_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
I3K7B6_BAD-01          GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A3Q3C680_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3P8QRJ7_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q4GGN3_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3B4GXJ6_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q2D5S0_BAD-01      GR-QLRRMSDEFVTLLDK------------------------------GE
A0A3Q0QNQ2_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------G-
A0A3P8WI83_BAD-02      GR-QLRRMSDEFDSLLDK------------------------------G-
A0A3P8WI83_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------G-
A0A3P9HNZ2_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3B3BQF7_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A672JQ68_BAD-01      GQ-RLRRMSDEFDSLLDK------------------------------GE
A0A2U9BAC9_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A4W6EMZ7_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A3B4VFC5_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A3B4W9T1_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A3Q1K1C7_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A672YF93_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q1GWH9_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q1CPU7_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3P8TWH6_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
H3D8J8_BAD-01          GR-QLRRMSDEFDSLLDK------------------------------GG
A0A6F9CQZ0_BAD-02      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A6F9CA11_BAD-02      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A1S3N9Q3_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A3Q3FKT9_BAD-01      GR-QLRRMSDEFDILLDK----------GVRIKGGGGGSRGGCGLVVESV
A0A3B1IH05_BAD-01      GR-QLRKMSDEFDKGLEQ-------------------------------G
A0A5F8GA49_BAD-01      GS-ELRRMSDEFDCSF-K-------------------------------G
H3ANP3_BAD-03          GQ-ELRRMSDEFDMSF-L-------------------------------G
H3ANP3_BAD-04          GQ-ELRRMSDEFDMSF-L-------------------------------G
H3ANP3_BAD-02          GQ-ELRRMSDEFDMSF-L-------------------------------G
H3ANP3_BAD-01          GQ-ELRRMSDEFDMSF-L-------------------------------G
A0A4X2KAA5_BAD-01      GS-ELRRMSDEFDCTF-K-------------------------------G
A0A672V9F8_BAD-01      GR-QLRRMSDEFQQQV-G-------------------------------V
A0A674GQ16_BAD-01      GR-RLRRMSDEFQLQ----------------------------------V
A0A6I8NVP2_BAD-01      GR-ELRRMSDEFDCTF-Q-------------------------------G
G3TP47_BAD-01          GR-ELRRMSDEFQGYF-K-------------------------------G
A0A287CT05_BAD-02      GR-ELRRMSDEFEGSF-K--------------------------------
A0A287CT05_BAD-01      GR-ELRRMSDEFEGSF-K-------------------------------G
G5B6Q3_BAD-02          GR-ELRRMSDEFVDSF-K-------------------------------G
G5B6Q3_BAD-01          GR-ELRRMSDEFVDSF-K-------------------------------G
Q61337_BAD-02          GR-ELRRMSDEFEGSF-K-------------------------------G
Q61337_BAD-05          GR-ELRRMSDEFEGSF-K-------------------------------V
Q61337_BAD-01          GR-ELRRMSDEFEGSF-K-------------------------------G
Q61337_BAD-06          GR-ELRRMSDEFEGSF-K-------------------------------G
Q61337_BAD-04          GR-ELRRMSDEFEGSF-K-------------------------------G
Q61337_BAD-03          GR-ELRRMSDEFEGSF-K-------------------------------G
A0A2I3TBK7_BAD-01      ---KLRPLPVTFAPHP-E-------------------------------T
A0A2R8Z674_BAD-02      ---KLRPLPVTFAPHP-E-------------------------------T
A0A2I2YFH2_BAD-03      ---KLRPLPVTFAAHP-E-------------------------------T
Q92934_BAD-03          ---KLRPLPVTFAPHP-E-------------------------------T
A0A2K5M0A7_BAD-02      ---KLRPLPVTFAPRP-E-------------------------------T
A0A2K5XJR2_BAD-02      ---KLRPLPVTFAPRP-E-------------------------------T
A0A096MLD5_BAD-03      ---KLRPLPVTFAPRP-E-------------------------------T
A0A2K6E7I4_BAD-02      ---KLRTLPVTFAPRP-E-------------------------------T
A0A2K5PDB1_BAD-02      ---RIRSLPVTFAPHP-K-------------------------------T
A0A2K5E6A6_BAD-02      ---RLRSLPVTFAPHP-E-------------------------------T
A0A2K6TG62_BAD-02      ---RLRSLPVTFAPHP-E-------------------------------T
A0A2K5HKU7_BAD-02      ENVKLEALGL-WRPGV-A-------------------------------T
A0A2K6N196_BAD-02      ENVKLEALGL-WRPGV-A-------------------------------T
A0A2K6PUL3_BAD-02      ENVKLEALGL-WRPGV-A-------------------------------T
A0A2K5M0A7_BAD-03      ENVKLKALGL-WRPGV-A-------------------------------T
A0A2K5XJR2_BAD-03      ENVKLKALGL-WRPGV-A-------------------------------T
A0A096MLD5_BAD-02      ENVKLKALGL-WRRGV-A-------------------------------T
A0A2K6E7I4_BAD-03      ENVKLKALGL-WRPAV-A-------------------------------T
A0A2I2YFH2_BAD-04      ENVKLEALGL-WRSGV-A-------------------------------T
Q92934_BAD-04          ENVKLEALGL-WRSGV-A-------------------------------T
A0A2I3TBK7_BAD-03      ENVKLEALGL-WRSGV-A-------------------------------T
A0A2R8Z674_BAD-03      ENVKLEALGL-WRSGV-A-------------------------------T
A0A2K5E6A6_BAD-03      ENVKLE-VPC-W---V-A-------------------------------T
A0A2K5PDB1_BAD-03      ENVKLEALGL-WRPGV-A-------------------------------T
A0A2K6TG62_BAD-03      ENVKLEALEP-WRHGV-A-------------------------------T
G1P8C5_BAD-01          GR-ELRRMSDEFQGSFKK-------------------------------G
A0A452ER54_BAD-02      GR-ELRRMSDEFHVSF-K-------------------------------G
W5P8G9_BAD-01          GR-ELRRMSDEFHVSF-K-------------------------------G
Q61337_BAD-07          GR-ELRRMSDEFEGSFKS--------------------------------
O35147_BAD-01          GR-ELRRMSDEFEGSF-K-------------------------------G
F7DN67_BAD-01          GR-ELRRMSDEFQVSF-Q-------------------------------A
Q45KI9_BAD-01          GR-ELRRMSDEFQGSF-K-------------------------------G
A0A3Q7SWS0_BAD-01      GR-ELRRMSDEFQGSF-K-------------------------------G
H0WVR2_BAD-01          GR-ELRRMSDEFEDSFKK-------------------------------G
A0A2K6GWV0_BAD-01      GR-ELRRMSDEFEDSFKK-------------------------------G
H0V608_BAD-01          GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K5PDB1_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
U3F2S3_BAD-01          GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K5E6A6_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K6TG62_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K5M0A7_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A1D5QBW1_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K6E7I4_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K5XJR2_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A096MLD5_BAD-04      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K6N196_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K6PUL3_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K5HKU7_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A0D9R491_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
A0A2K5VCA1_BAD-01      GR-ELRRMSDEFVDSF-K-------------------------------G
B4DZQ9_BAD-01          GR-ELRRMSDEFVDSFKK-------------------------------G
A0A096MLD5_BAD-01      GR-ELRRMSDEFVDSFKK-------------------------------G
A0A2I2YFH2_BAD-02      GR-ELRRMSDEFVDSFKK-------------------------------G
A0A2I2YFH2_BAD-01      GR-ELRRMSDEFVDSFKK-------------------------------G
Q92934_BAD-01          GR-ELRRMSDEFVDSFKK-------------------------------G
Q92934_BAD-02          GR-ELRRMSDEFVDSFKK-------------------------------G
A0A2I3TBK7_BAD-02      GR-ELRRMSDEFVDSFKK-------------------------------G
A0A2R8Z674_BAD-01      GR-ELRRMSDEFVDSFKK-------------------------------G
A0A2J8TYJ3_BAD-01      GR-ELRRMSDEFVDSFKK-------------------------------G
A0A4X1VE31_BAD-01      GR-ELRRMSDEFQGSF-KVSARVGLYPRVSSQWAVPFESQGLSGSEVQAP
A0A4X1VE31_BAD-02      GR-ELRRMSDEFQGSFKK-------------------------------G
A0A287AEF3_BAD-01      GR-ELRRMSDEFQGSFKK-------------------------------G
A0A4X1VE31_BAD-03      GR-ELRRMSDEFQGSF-K-------------------------------G
A0A671ELU4_BAD-01      GR-ELRRMSDEFEGSF-K-------------------------------G
A0A452ER54_BAD-01      GR-ELRRMSDEFHVSF-K-------------------------------G
G1MI17_BAD-01          GR-ELRRMSDEFQGSF-K-------------------------------G
A0A452RJM6_BAD-01      GR-ELRRMSDEFQGSF-K-------------------------------G
A0A384DJL2_BAD-01      GR-ELRRMSDEFQGSF-K-------------------------------G
M3YNE7_BAD-01          GR-ELRRMSDEFQGSF-K-------------------------------G
A0A667H8Z9_BAD-01      GR-ELRRMSDEFQGSF-K-------------------------------G
A0A673V6P8_BAD-01      GR-ELRRMSDEFQGSF-K-------------------------------G
A0A4W2C9A8_BAD-01      GR-ELRRMSDEFHVSF-K-------------------------------G
A0A4W2C9A8_BAD-01      GR-ELRRMSDEFHVSF-K-------------------------------G
F1MUT9_BAD-01          GR-ELRRMSDEFHVSF-K-------------------------------G
Q3SYZ0_BAD-01          GR-ELRRMSDEFHVSF-K-------------------------------G
A0A4U1FMC3_BAD-01      GR-ELRRMSDEFHGSF-K-------------------------------G
A0A2Y9EHU3_BAD-01      GR-ELRRMSDEFHGSF-K-------------------------------G
A0A6F9BAV3_BAD-01      GC-QLRRMSDEFDTWLDK------------------------------GE
A0A3P8YI30_BAD-02      GC-QLRRMSDEFDTWLDK------------------------------GE
A0A4W5R1T6_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A060W8P9_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
B5X1T1_BAD-01          GR-QLRRMSDEFDTWLDK------------------------------GE
A0A673ZHY7_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A671NP27_BAD-01      GR-QLRRMSDEFDILLDK------------------------------G-
A0A672SAE4_BAD-01      GR-QLRRMSDEFDILLDK------------------------------G-
A0A672SAE4_BAD-02      GR-QLRRMSDEFDILLDK------------------------------G-
A0A671RUV0_BAD-01      GQ-QLRRMSDEFDILLDK------------------------------G-
A0A673HRQ3_BAD-01      GQ-QLRRMSDEFDILLDK------------------------------G-
A0A672RGH0_BAD-01      GQ-QLRRMSDEFDILLDK------------------------------G-
Q4V925_BAD-02          GQ-QLRRMSDEF----DK------------------------------G-
Q4V925_BAD-03          GQ-QLRRMSDEF----DK------------------------------G-
A7MCM4_BAD-01          GQ-QLRRMSDEF----DK------------------------------GQ
Q4V925_BAD-04          GQ-QLRRMSDEF----DK------------------------------GQ
Q4V925_BAD-01          GQ-QLRRMSDEF----DK------------------------------GQ
A0A3B3QX41_BAD-01      GR-QLRRMSDEFDTLLDK------------------------------G-
A0A3Q3RXS8_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q0QNQ2_BAD-02      GQ-QLRRMSDEFDSLLDK------------------------------GM
A0A3Q3WTY4_BAD-01      GQ-RLRRMSDEF----DR------------------------------QE
A0A3P8Y761_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GQ
A0A4W5JLL9_BAD-01      GR-QLRRMSDEFDTWLDK------------------------------GE
A0A3B5Q2N7_BAD-01      GR-QLRRMSDEFVNLLDK------------------------------GE
A0A087X8P8_BAD-01      GR-QLRRMSDEFVNLLDK------------------------------GE
A0A3B3UA11_BAD-01      GR-QLRRMSDEFVNLLDK------------------------------GE
A0A3B3YFR1_BAD-01      GR-QLRRMSDEFVNLLDK------------------------------GE
A0A3P9Q7C3_BAD-01      GR-QLRRMSDEFVNLLDK------------------------------GE
A0A3B3HDU2_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3P9KSL7_BAD-02      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3P9KSL7_BAD-01      GQ-QLRRMSDEFDSLLDK------------------------------GE
A0A3B5BAL2_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A665TUH3_BAD-01      GQ-KLRRMSDEFDSLLDK------------------------------GE
A0A674MXC1_BAD-04      GR-QLRRMSDEFDSLLDK------------------------------GG
A0A674MXC1_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GG
A0A674MXC1_BAD-02      GR-QLRRMSDEFDSLLDK------------------------------GG
A0A674MXC1_BAD-03      GR-QLRRMSDEFDSLLDK------------------------------GG
A0A671TL42_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q3AEL8_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q3AEL8_BAD-02      GR-QLRRMSDEFDSLLDK------------------------------GE
A0A1A8AQV0_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
G3Q8B3_BAD-01          GR-QLRRMSDEFDSLLDK------------------------------GE
A0A3Q2Y0E4_BAD-01      GR-QLRRMSDEFDSLMDK------------------------------GE
A0A3Q3R5S3_BAD-01      GR-QLRRMSDEFDSLLDK------------------------------GE
                                                                         

Q61337_BAD-09          LGSRHTHH---------------PVSLTAQCRA-----------SW----
Q2PG01_BAD-01          LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2I3H4B2_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
Q92934_BAD-05          LPRPKSAG---------------TATQM-RQSS-----------SW----
Q92934_BAD-06          LPRPKSAG------------------------------------------
A0A670JUY4_BAD-01      LPRPKSAG---------------TATQM-RRTL-----------GW----
A0A670YRG7_BAD-01      LPRPKSAG---------------TCSHMDRPPP-----------SW----
Q6P7C5_BAD-01          -----------------------SIIFL-SHVP-----------------
A0A3B1JLM2_BAD-01      LRRTTGPG-------------------R-HTNR-----------GW----
A0A4W4DXF5_BAD-01      IRRVSSPG---------------KLSQK-QTNQ-----------GW----
A0A452IFQ4_BAD-01      LPRPKSAG---------------TTSQL-HRGN-----------SW----
A0A674I2R9_BAD-01      LPRPKSAG---------------TTSQL-HRGN-----------SW----
C1C3S9_BAD-01          IPRPKSAS---------------AATEM-TVSK-----------SF----
A0A6I8PXS6_BAD-01      LPRPKSAS---------------AAGQM-TGNR-----------SI----
A0A3P8YI30_BAD-01      PKRGIIPG---------------RAKQV-YR-------------GW----
A0A3B4DUY7_BAD-01      TRRASSPG-----------------KQT-NR-------------GW----
A0A337SAW2_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A673J9C6_BAD-01      MKRVKSAG---------------TTRQM-QQSP-----------SW----
A0A4W5JLL9_BAD-02      MRRVKSAG---------------AAKQM-TKSP-----------SW----
A0A674DKC6_BAD-01      MRRVKSAG---------------AAKQM-TKSP-----------SW----
A0A4W4HE29_BAD-01      MKRARSAG---------------AARQM-HTSP-----------SW----
A0A3B4CPH6_BAD-01      MKRVRSAG---------------AARQM-HASP-----------SW----
A0A674AVP9_BAD-01      PKRGIIPR----------------GGKQ-KVSR-----------GW----
A0A1S3L0Z2_BAD-01      PKRGIIPR----------------GGKQ-KVSR-----------GW----
B5XEF1_BAD-01          PKRGIIPR----------------GGKQ-KVSR-----------GW----
A0A4W5MZR2_BAD-01      PKRGISPG----------------GGKQ-KVSR-----------GW----
A0A060W8W7_BAD-01      PKRGISPG----------------GGKQ-KVSR-----------GW----
E7FBJ6_BAD-01          SKTP--------------------NSQK-QTYR-----------GW----
A0A673J5Q9_BAD-01      VKRA--------------------NSQK-QTYR-----------GW----
A0A671PX91_BAD-01      VKRA--------------------NSQK-QTYR-----------GW----
A0A672LB88_BAD-01      VKRA--------------------NSQK-QTYR-----------GW----
A0A673I6H5_BAD-01      VKRA--------------------NSQK-QTYR-----------GW----
A0A671SBB4_BAD-01      VKRA--------------------NSQK-QTYR-----------GW----
A0A672R7P6_BAD-01      VKRA--------------------NSQK-QTYR-----------GW----
A0A3P8Y761_BAD-02      MKRVKSAG---------------AAKQM-TTSP-----------SW----
A0A3Q2QC80_BAD-01      LRKVSSAG---------------TNRPI-HHSR-----------SW----
A0A4W6EMZ7_BAD-02      MRRVKSAT---------------TTRQM-HHSK-----------SW----
A0A3Q3FKT9_BAD-02      RIKGGGGGSRGGCGLVVESVVSQPKSQE-FNTQ-----------LLQPHV
A0A3Q3FKT9_BAD-03      MKKVRSPG---------------PAKQM-HHSK-----------SW----
A0A3B5L9R9_BAD-01      MRNVSSDG---------------SNRPI-HHSR-----------SW----
A0A667ZNC6_BAD-01      MKRVRSAG---------------TAKQM-QHSK-----------SW----
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      MK----------------------LKKL-HHSK-----------TW----
I3K7B6_BAD-01          MK----------------------LKKL-HHSK-----------TW----
A0A3Q3C680_BAD-01      MK----------------------VKKL-HHSK-----------TW----
A0A3P8QRJ7_BAD-01      MK----------------------VKKL-HHSK-----------TW----
A0A3Q4GGN3_BAD-01      MK----------------------LKKL-HHSK-----------TW----
A0A3B4GXJ6_BAD-01      MK----------------------VKKL-HHSK-----------TW----
A0A3Q2D5S0_BAD-01      LRKVSSTG---------------TNRPI-RHSK-----------SW----
A0A3Q0QNQ2_BAD-01      MKKAKNAG---------------TTRKM-HHSK-----------TW----
A0A3P8WI83_BAD-02      MRKVKSAG---------------TARQM-HHSK-----------SW----
A0A3P8WI83_BAD-01      MRKVKSAG---------------TARQM-HHSK-----------SW----
A0A3P9HNZ2_BAD-01      MRKVRSTG---------------AAKQM-LHST-----------SW----
A0A3B3BQF7_BAD-01      MRKVRSAG---------------ATKQM-HHST-----------SW----
A0A672JQ68_BAD-01      MKKLRNPG---------------QARQI-HHSR-----------SW----
A0A2U9BAC9_BAD-01      MRKVKSAG---------------TARQM-HHSQ-----------SW----
A0A4W6EMZ7_BAD-01      MRRVKSAT---------------TTRQM-HHSK-----------SW----
A0A3B4VFC5_BAD-01      MRKVKSAG---------------TAKQM-HHSK-----------SW----
A0A3B4W9T1_BAD-01      MRKVKSAG---------------TAKQM-HHSK-----------SW----
A0A3Q1K1C7_BAD-01      MRKVRSAG---------------TARQM-HHSK-----------SW----
A0A672YF93_BAD-01      MKRVRSAG---------------TARQM-HHSK-----------TW----
A0A3Q1GWH9_BAD-01      MKRVRSAG---------------TARQM-HHSK-----------SW----
A0A3Q1CPU7_BAD-01      MKRVRSAG---------------TARQM-HHSK-----------SW----
A0A3P8TWH6_BAD-01      MKRVRSAG---------------TARQM-HHSK-----------SW----
H3D8J8_BAD-01          MRKTSSAG---------------SARQM-HHSR-----------SW----
A0A6F9CQZ0_BAD-02      MKQLKSVG---------------AAKQM-TQSP-----------SW----
A0A6F9CA11_BAD-02      MRRVKSAG---------------AAKQM-TKSP-----------SW----
A0A1S3N9Q3_BAD-01      MRRVKSAG---------------AAKQM-TKSP-----------SW----
A0A3Q3FKT9_BAD-01      VSQPKSQE---------------FNTQL-LQPHVRCVLGSLNVYKW----
A0A3B1IH05_BAD-01      MKRVRSAG---------------AARQM-QNSP-----------SW----
A0A5F8GA49_BAD-01      LPRPKSAG---------------TASQM-RRSH-----------GW----
H3ANP3_BAD-03          LPRPKSAG---------------AAGEM-VDES-----------WW----
H3ANP3_BAD-04          LPRPKSAG---------------AAGEM-VDES-----------WW----
H3ANP3_BAD-02          LPRPKSAG---------------AAGEM-VDES-----------WW----
H3ANP3_BAD-01          LPRPKSAG---------------AAGEM-VDES-----------WW----
A0A4X2KAA5_BAD-01      LPRPKSAG---------------TASQM-RRSH-----------GW----
A0A672V9F8_BAD-01      LPRASSAG---------------GA-------G-----------GW----
A0A674GQ16_BAD-01      LPRPRSVG---------------GAPP---GGG-----------GW----
A0A6I8NVP2_BAD-01      LPRPKSAG---------------TAAQL-QRPS-----------GW----
G3TP47_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      LPRPRSAG---------------TASQM-RQSS-----------SW----
G5B6Q3_BAD-02          LPRPKSAG---------------TATKL-WQSS-----------SW----
G5B6Q3_BAD-01          LPRPKSAG---------------TATKL-WQSS-----------SW----
Q61337_BAD-02          -------------------------EEL-TYSL-----------SP----
Q61337_BAD-05          SASVRCDG---------------T--------------------------
Q61337_BAD-01          LPRPKSAG---------------TATQM-RQSA-----------GW----
Q61337_BAD-06          LPRPKSAG---------------TATQM-RQSA-----------GW----
Q61337_BAD-04          LPRPKSAG---------------TATQM-RQSA-----------GW----
Q61337_BAD-03          LPRPKSAG---------------TATQM-RQSA-----------GW----
A0A2I3TBK7_BAD-01      PPVPTALG---------------SHLEY-GR-------------------
A0A2R8Z674_BAD-02      PPVPTALG---------------SHLEY-GR-------------------
A0A2I2YFH2_BAD-03      PPVPTALG---------------SHLEY-GR-------------------
Q92934_BAD-03          PPVPTALG---------------SHLEY-GR-------------------
A0A2K5M0A7_BAD-02      PPALTVLV---------------GHLGY-GR-------------------
A0A2K5XJR2_BAD-02      PPALTVLV---------------GHLGY-GR-------------------
A0A096MLD5_BAD-03      PPALTVLV---------------GHLGY-GR-------------------
A0A2K6E7I4_BAD-02      PPALTVLV---------------GHLGY-GR-------------------
A0A2K5PDB1_BAD-02      PPALIALS---------------GHLGY-GR-------------------
A0A2K5E6A6_BAD-02      PPVPIALG---------------GHLGY-GR-------------------
A0A2K6TG62_BAD-02      LPAPIALG---------------GHLGH-GR-------------------
A0A2K5HKU7_BAD-02      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A2K6N196_BAD-02      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A2K6PUL3_BAD-02      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A2K5M0A7_BAD-03      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A2K5XJR2_BAD-03      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A096MLD5_BAD-02      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A2K6E7I4_BAD-03      APTPRGRR---------------RTKGW-RRSP-----------AP----
A0A2I2YFH2_BAD-04      APTPRGRR---------------TTKGW-GRSP-----------AP----
Q92934_BAD-04          APTPRGRR---------------TTKGW-GRSP-----------AP----
A0A2I3TBK7_BAD-03      APTPRGRR---------------TTKGW-GRSP-----------AP----
A0A2R8Z674_BAD-03      APTPRGRR---------------TTKGW-GRSP-----------AP----
A0A2K5E6A6_BAD-03      APTPQGRR---------------RTKGW-RRSP-----------AP----
A0A2K5PDB1_BAD-03      DRTPQGRR---------------RTKGW-RRSP-----------AP----
A0A2K6TG62_BAD-03      ARTPQGRR---------------GTKGW-RRSP-----------AL----
G1P8C5_BAD-01          LPRPKSAG---------------TATQM-WQKS-----------SW----
A0A452ER54_BAD-02      LPRPKSAG---------------TATQM-RQSP-----------SW----
W5P8G9_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
Q61337_BAD-07          -----MLG---------------LAVLI-RPLS-----------VS----
O35147_BAD-01          LPRPKSAG---------------TATQM-RQSA-----------SW----
F7DN67_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
Q45KI9_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A3Q7SWS0_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
H0WVR2_BAD-01          LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K6GWV0_BAD-01      LPRPKSAG---------------TATQI-RQSS-----------SW----
H0V608_BAD-01          LPRPKSAG---------------TATKL-WQNS-----------NW----
A0A2K5PDB1_BAD-01      LPRPKSAG---------------TATQM-RQSA-----------SW----
U3F2S3_BAD-01          LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K5E6A6_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K6TG62_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K5M0A7_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A1D5QBW1_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K6E7I4_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K5XJR2_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A096MLD5_BAD-04      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K6N196_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K6PUL3_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K5HKU7_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A0D9R491_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2K5VCA1_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
B4DZQ9_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------RR----
A0A096MLD5_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2I2YFH2_BAD-02      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2I2YFH2_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
Q92934_BAD-01          LPRPKSAG---------------TATQM-RQSS-----------SW----
Q92934_BAD-02          LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2I3TBK7_BAD-02      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2R8Z674_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A2J8TYJ3_BAD-01      LPRPKSAG---------------TATQM-RQSS-----------SW----
A0A4X1VE31_BAD-01      LQKAKTPG---------------FPKSL-KREA-----------GW----
A0A4X1VE31_BAD-02      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A287AEF3_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A4X1VE31_BAD-03      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A671ELU4_BAD-01      LPRPKSAG---------------TATQM-RQNS-----------SW----
A0A452ER54_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
G1MI17_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A452RJM6_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A384DJL2_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
M3YNE7_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A667H8Z9_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A673V6P8_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A4W2C9A8_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A4W2C9A8_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
F1MUT9_BAD-01          LPRPKSAG---------------TATQM-RQSP-----------SW----
Q3SYZ0_BAD-01          LPRPKSAG---------------TATEM-RQSP-----------SW----
A0A4U1FMC3_BAD-01      LPRPNSAG---------------TATQM-RQSP-----------SW----
A0A2Y9EHU3_BAD-01      LPRPKSAG---------------TATQM-RQSP-----------SW----
A0A6F9BAV3_BAD-01      PKRGISPG---------------GCKQ--KVSR-----------GW----
A0A3P8YI30_BAD-02      PKRGIIPG---------------RAKQ---VYR-----------GW----
A0A4W5R1T6_BAD-01      PKRGISPG---------------GIKQ--EVSR-----------GW----
A0A060W8P9_BAD-01      PKRGISPG---------------GVKQ--EVSR-----------GW----
B5X1T1_BAD-01          PKRGISPG---------------GVKQ--EVSR-----------GW----
A0A673ZHY7_BAD-01      PKRGISPG---------------GVKQ--EVSR-----------GW----
A0A671NP27_BAD-01      MKRVKSAG---------------TTRQM-QQSP-----------SW----
A0A672SAE4_BAD-01      MKRVKSAG---------------TTRQM-QQSP-----------SW----
A0A672SAE4_BAD-02      MKRVKSAG---------------TTRQM-QQSP-----------SW----
A0A671RUV0_BAD-01      MKRVKSAG---------------TTRQM-RQSP-----------SW----
A0A673HRQ3_BAD-01      MKRVKSAG---------------TTRQM-RQSP-----------SW----
A0A672RGH0_BAD-01      MKRVKSAG---------------TTRQM-RQSP-----------SW----
Q4V925_BAD-02          MKRVKSAG---------------TARQM-SQSP-----------SW----
Q4V925_BAD-03          MKRVKSAG---------------TARQM-SQSP-----------SW----
A7MCM4_BAD-01          MKRVKSAG---------------TARQM-SQSP-----------SW----
Q4V925_BAD-04          MKRVKSAG---------------TARQM-SQSP-----------SW----
Q4V925_BAD-01          MKRVKSAG---------------TARQM-SQSP-----------SW----
A0A3B3QX41_BAD-01      MKRVRSAG---------------AARQM-QASP-----------SW----
A0A3Q3RXS8_BAD-01      MR-VRNAG---------------KAQKM-HHSK-----------TW----
A0A3Q0QNQ2_BAD-02      KK-AKNAG---------------TTRKM-HHSK-----------TW----
A0A3Q3WTY4_BAD-01      WK-TRSAG---------------TATQM-HQSR-----------SW----
A0A3P8Y761_BAD-01      MKRVKSAG---------------AAKQM-TTSP-----------SW----
A0A4W5JLL9_BAD-01      MRRVKSAG---------------AAKQM-TKSP-----------SW----
A0A3B5Q2N7_BAD-01      MRNVSSDG---------------SNRPI-HHSR-----------SW----
A0A087X8P8_BAD-01      MRKVSSTG---------------SNRPI-HHSR-----------SW----
A0A3B3UA11_BAD-01      MRKVSSTG---------------SNRPI-HHSR-----------SW----
A0A3B3YFR1_BAD-01      MRKVSSTG---------------SNRPI-HHSR-----------SW----
A0A3P9Q7C3_BAD-01      MRKVSSAG---------------SNGPI-HHSR-----------SW----
A0A3B3HDU2_BAD-01      MRKVRSTG---------------AAKQM-LHST-----------SW----
A0A3P9KSL7_BAD-02      MRKVRSTG---------------AAKQM-LHST-----------SW----
A0A3P9KSL7_BAD-01      MRKVRSTG---------------AAKQM-LHST-----------SW----
A0A3B5BAL2_BAD-01      MKRVRSAG---------------TAKQM-HHSK-----------SW----
A0A665TUH3_BAD-01      MRKVKSVG---------------SAKQM-HHSK-----------SW----
A0A674MXC1_BAD-04      MRKTNSTG---------------STKPM-HHSR-----------SW----
A0A674MXC1_BAD-01      MRKTNSTG---------------STKPM-HHSR-----------SW----
A0A674MXC1_BAD-02      MRKTNSTG---------------STKPM-HHSR-----------SW----
A0A674MXC1_BAD-03      MRKTNSTG---------------STKPM-HHSR-----------SW----
A0A671TL42_BAD-01      MRKVKSAG---------------TPKQM-HHSR-----------SW----
A0A3Q3AEL8_BAD-01      MRKVKSAG---------------TTKQI-HHSR-----------SW----
A0A3Q3AEL8_BAD-02      MRKVKSAG---------------TTKQI-HHSR-----------SW----
A0A1A8AQV0_BAD-01      MRKVRSAG---------------STKPM-HHSR-----------SW----
G3Q8B3_BAD-01          MRRVKSAG---------------TTKQM-QHSK-----------SW----
A0A3Q2Y0E4_BAD-01      LKFKSAGG---------------TSRAI-HHSK-----------TW----
A0A3Q3R5S3_BAD-01      MKRVRSAG---------------AASQM-HHSK-----------SW----
                                                                         

Q61337_BAD-09          ----------------------WWGP-----------------------D
Q2PG01_BAD-01          -----------TRVF-----QSWWDR-----------------------N
A0A2I3H4B2_BAD-01      -----------TRVF-----QSWWDR-----------------------N
Q92934_BAD-05          -----------TR-------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      -----------KEVL-----QSWWRR-----------------------N
A0A670YRG7_BAD-01      -----------KDTL-----RSWWLY-----------------------S
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      -----------FSFL--------WGT-----------------------K
A0A4W4DXF5_BAD-01      -----------FSFL--------WCS-----------------------K
A0A452IFQ4_BAD-01      -----------KETL-----QAWLGH-----------------------R
A0A674I2R9_BAD-01      -----------KETL-----QAWLGH-----------------------R
C1C3S9_BAD-01          -----------GETF-----FNFFRR-----------------------K
A0A6I8PXS6_BAD-01      -----------RDLI-----MGLFSR-----------------------R
A0A3P8YI30_BAD-01      -----------FSFL--------WSP-----------------------K
A0A3B4DUY7_BAD-01      -----------FSFL--------WGS-----------------------K
A0A337SAW2_BAD-01      -----------TRFI--------QSW-----------------------W
A0A673J9C6_BAD-01      -----------FAFL--------WSH-----------------------K
A0A4W5JLL9_BAD-02      -----------WAYL--------FSH-----------------------K
A0A674DKC6_BAD-01      -----------WAYL--------FSH-----------------------K
A0A4W4HE29_BAD-01      -----------FAFL--------WSH-----------------------K
A0A3B4CPH6_BAD-01      -----------FTFL--------WSH-----------------------K
A0A674AVP9_BAD-01      -----------FSFL--------WSP-----------------------K
A0A1S3L0Z2_BAD-01      -----------FSFL--------WSP-----------------------K
B5XEF1_BAD-01          -----------FSFL--------WSP-----------------------K
A0A4W5MZR2_BAD-01      -----------FSFL--------WSP-----------------------K
A0A060W8W7_BAD-01      -----------FSFL--------WSP-----------------------K
E7FBJ6_BAD-01          -----------FSFL--------WSP-----------------------K
A0A673J5Q9_BAD-01      -----------FSFL--------WSP-----------------------K
A0A671PX91_BAD-01      -----------FSFL--------WSP-----------------------K
A0A672LB88_BAD-01      -----------FSFL--------WSS-----------------------K
A0A673I6H5_BAD-01      -----------FSFL--------WSS-----------------------K
A0A671SBB4_BAD-01      -----------FSFL--------LSS-----------------------K
A0A672R7P6_BAD-01      -----------FSFL--------WSS-----------------------K
A0A3P8Y761_BAD-02      -----------WAFL--------FSH-----------------------K
A0A3Q2QC80_BAD-01      -----------WNYL--------FSH-----------------------Q
A0A4W6EMZ7_BAD-02      -----------WSYL--------FSH-----------------------Q
A0A3Q3FKT9_BAD-02      RCVLGSLNVYKWDYL--------ILI-----------------------I
A0A3Q3FKT9_BAD-03      -----------WSYL--------FSH-----------------------Q
A0A3B5L9R9_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A667ZNC6_BAD-01      -----------WNYL--------FSH-----------------------Q
A0A3P9B2E4_BAD-01      -----------------------VRM-----------------------G
A0A668V3Q4_BAD-01      -----------WSYL--------FSH-----------------------Q
I3K7B6_BAD-01          -----------WSYL--------FSH-----------------------Q
A0A3Q3C680_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3P8QRJ7_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q4GGN3_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3B4GXJ6_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q2D5S0_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q0QNQ2_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3P8WI83_BAD-02      -----------WSYL--------FSH-----------------------Q
A0A3P8WI83_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3P9HNZ2_BAD-01      -----------WNYL--------FSH-----------------------P
A0A3B3BQF7_BAD-01      -----------WNYL--------FSH-----------------------P
A0A672JQ68_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A2U9BAC9_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A4W6EMZ7_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3B4VFC5_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3B4W9T1_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q1K1C7_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A672YF93_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q1GWH9_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q1CPU7_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3P8TWH6_BAD-01      -----------WSYL--------FSH-----------------------Q
H3D8J8_BAD-01          -----------WSYL--------FSH-----------------------Q
A0A6F9CQZ0_BAD-02      -----------WAYL--------FSH-----------------------Q
A0A6F9CA11_BAD-02      -----------WAYL--------FSH-----------------------Q
A0A1S3N9Q3_BAD-01      -----------WAYL--------FSH-----------------------K
A0A3Q3FKT9_BAD-01      -----------DYLILIITLHSSL--------------------------
A0A3B1IH05_BAD-01      -----------FAFL--------WSH-----------------------K
A0A5F8GA49_BAD-01      -----------TRTV-----QSWFGR-----------------------N
H3ANP3_BAD-03          -----------KKLI-----RSLKGR------------------------
H3ANP3_BAD-04          -----------KKLI-----RSLKGR------------------------
H3ANP3_BAD-02          -----------KKLI-----RSLKGR------------------------
H3ANP3_BAD-01          -----------KKLI-----RSLKGR------------------------
A0A4X2KAA5_BAD-01      -----------ARTF-----QSWLSR-----------------------S
A0A672V9F8_BAD-01      -----------REVL-----RSWWGAPPPPRPRPAATPPLTAPPRVPPPR
A0A674GQ16_BAD-01      -----------RETL-----RAWWGS-RRPRPAPPAPPPDRPPPQ--KPH
A0A6I8NVP2_BAD-01      -----------TRVL-----RSWWNR-----------------------S
G3TP47_BAD-01          -----------TRII-----QAWWDR-----------------------N
A0A287CT05_BAD-02      -----------VTFS-----QSPFLR-----------------------A
A0A287CT05_BAD-01      -----------TRFI-----QSWWDR-----------------------N
G5B6Q3_BAD-02          -----------TRAI-----QSWWDR-----------------------N
G5B6Q3_BAD-01          -----------TRAI-----QSWWDR-----------------------N
Q61337_BAD-02          -----------FRCV-----Q-----------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          -----------TRII-----QSWWDR-----------------------N
Q61337_BAD-06          -----------TRII-----QSWWDR-----------------------N
Q61337_BAD-04          -----------TRII-----QSWWDR-----------------------N
Q61337_BAD-03          -----------TRII-----QSWWDR-----------------------N
A0A2I3TBK7_BAD-01      --------------------KYFPQA-----------------------Y
A0A2R8Z674_BAD-02      --------------------KYFPQA-----------------------Y
A0A2I2YFH2_BAD-03      --------------------KYFPQA-----------------------Y
Q92934_BAD-03          --------------------KYFPQA-----------------------Y
A0A2K5M0A7_BAD-02      --------------------KCFPQA-----------------------L
A0A2K5XJR2_BAD-02      --------------------KCFPQA-----------------------S
A0A096MLD5_BAD-03      --------------------KCFPQA-----------------------L
A0A2K6E7I4_BAD-02      --------------------KCFPQA-----------------------L
A0A2K5PDB1_BAD-02      --------------------KCFLQ-------------------------
A0A2K5E6A6_BAD-02      --------------------KCFLQ-------------------------
A0A2K6TG62_BAD-02      --------------------KCFLQ-------------------------
A0A2K5HKU7_BAD-02      -----------FGAA-----RAPRPL-----------------------T
A0A2K6N196_BAD-02      -----------FGAA-----RAPRPL-----------------------T
A0A2K6PUL3_BAD-02      -----------FGAA-----RAPRPL-----------------------T
A0A2K5M0A7_BAD-03      -----------FGAA-----RAPRPP-----------------------T
A0A2K5XJR2_BAD-03      -----------FGAA-----RAPRPP-----------------------T
A0A096MLD5_BAD-02      -----------FGAA-----RAPRPP-----------------------T
A0A2K6E7I4_BAD-03      -----------FGAA-----RAPRPP-----------------------T
A0A2I2YFH2_BAD-04      -----------FGAA-----RARRPP-----------------------T
Q92934_BAD-04          -----------FGAA-----RARRPP-----------------------T
A0A2I3TBK7_BAD-03      -----------FGAA-----RARRPP-----------------------T
A0A2R8Z674_BAD-03      -----------FGAA-----RARRPP-----------------------T
A0A2K5E6A6_BAD-03      -----------FGAV-----RAQHPP-----------------------T
A0A2K5PDB1_BAD-03      -----------FGAV-----RARHPP-----------------------T
A0A2K6TG62_BAD-03      -----------FGAV-----RARHPP-----------------------T
G1P8C5_BAD-01          -----------TRFF-----QSWWDR-----------------------N
A0A452ER54_BAD-02      -----------TRFL-----QSWLSR-----------------------N
W5P8G9_BAD-01          -----------TRFL-----QSWLSR-----------------------N
Q61337_BAD-07          -----------SDLLGFPPSSSFVQD-----------------------P
O35147_BAD-01          -----------TRII-----QSWWDR-----------------------N
F7DN67_BAD-01          -----------TRAI-----QSWWDR-----------------------N
Q45KI9_BAD-01          -----------TRVI-----QSWWDR-----------------------N
A0A3Q7SWS0_BAD-01      -----------TRVI-----QSWWDR-----------------------N
H0WVR2_BAD-01          -----------TRVI-----QSWWDR-----------------------N
A0A2K6GWV0_BAD-01      -----------TRVI-----QSWWDR-----------------------N
H0V608_BAD-01          -----------TRAI-----QSWWDR-----------------------N
A0A2K5PDB1_BAD-01      -----------TRVI-----QSWWDR-----------------------N
U3F2S3_BAD-01          -----------TRVI-----QSWWDR-----------------------N
A0A2K5E6A6_BAD-01      -----------TQVI-----QSWWDR-----------------------N
A0A2K6TG62_BAD-01      -----------TRVI-----QSWWDR-----------------------N
A0A2K5M0A7_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A1D5QBW1_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2K6E7I4_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2K5XJR2_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A096MLD5_BAD-04      -----------TRVF-----QSWWDR-----------------------N
A0A2K6N196_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2K6PUL3_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2K5HKU7_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A0D9R491_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2K5VCA1_BAD-01      -----------TRVF-----QSWWDR-----------------------N
B4DZQ9_BAD-01          -----------LR-------------------------------------
A0A096MLD5_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2I2YFH2_BAD-02      -----------TRVF-----QSWWDR-----------------------N
A0A2I2YFH2_BAD-01      -----------TRVF-----QSWWDR-----------------------N
Q92934_BAD-01          -----------TRVF-----QSWWDR-----------------------N
Q92934_BAD-02          -----------TRVF-----QSWWDR-----------------------N
A0A2I3TBK7_BAD-02      -----------TRVF-----QSWWDR-----------------------N
A0A2R8Z674_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A2J8TYJ3_BAD-01      -----------TRVF-----QSWWDR-----------------------N
A0A4X1VE31_BAD-01      -------------------------------------------------H
A0A4X1VE31_BAD-02      -----------KRFL-----QSWWYR-----------------------N
A0A287AEF3_BAD-01      -----------KRFL-----QSWWYR-----------------------N
A0A4X1VE31_BAD-03      -----------KRFL-----QSWWYR-----------------------N
A0A671ELU4_BAD-01      -----------TRIF-----QSLW--------------------------
A0A452ER54_BAD-01      -----------TRFL-----QSWLSR-----------------------N
G1MI17_BAD-01          -----------TRVI-----QSWWDR-----------------------N
A0A452RJM6_BAD-01      -----------TRVI-----QSWWDR-----------------------N
A0A384DJL2_BAD-01      -----------TRVI-----QSWWDR-----------------------N
M3YNE7_BAD-01          -----------TRVI-----QSWWDR-----------------------N
A0A667H8Z9_BAD-01      -----------TRFI-----QSWWDR-----------------------N
A0A673V6P8_BAD-01      -----------TRFI-----QSWWDR-----------------------N
A0A4W2C9A8_BAD-01      -----------TRFL-----QSWLSR-----------------------N
A0A4W2C9A8_BAD-01      -----------TRFL-----QSWLSR-----------------------N
F1MUT9_BAD-01          -----------TRFL-----QSWLSR-----------------------N
Q3SYZ0_BAD-01          -----------TRFL-----QSWLSR-----------------------N
A0A4U1FMC3_BAD-01      -----------TRFL-----QSWWNR-----------------------N
A0A2Y9EHU3_BAD-01      -----------TRFL-----QSWWNR-----------------------N
A0A6F9BAV3_BAD-01      -----------FSFL--------WSP-----------------------K
A0A3P8YI30_BAD-02      -----------FSFL--------WSP-----------------------K
A0A4W5R1T6_BAD-01      -----------FSFL--------WSP-----------------------K
A0A060W8P9_BAD-01      -----------FSFL--------WSP-----------------------N
B5X1T1_BAD-01          -----------FSFL--------WSP-----------------------K
A0A673ZHY7_BAD-01      -----------FSFL--------WSP-----------------------K
A0A671NP27_BAD-01      -----------FAFL--------WSH-----------------------K
A0A672SAE4_BAD-01      -----------FAFL--------WSH-----------------------K
A0A672SAE4_BAD-02      -----------FAFL--------WSH-----------------------K
A0A671RUV0_BAD-01      -----------LAFL--------WSH-----------------------K
A0A673HRQ3_BAD-01      -----------LAFL--------WSH-----------------------K
A0A672RGH0_BAD-01      -----------LAFL--------WSH-----------------------K
Q4V925_BAD-02          -----------LAFL--------WSH-----------------------K
Q4V925_BAD-03          -----------LAFL--------WSH-----------------------K
A7MCM4_BAD-01          -----------LAFL--------WSH-----------------------K
Q4V925_BAD-04          -----------LAFL--------WSH-----------------------K
Q4V925_BAD-01          -----------LAFL--------WSH-----------------------K
A0A3B3QX41_BAD-01      -----------FAFL--------WSH-----------------------K
A0A3Q3RXS8_BAD-01      -----------WSYL--------FSY-----------------------Q
A0A3Q0QNQ2_BAD-02      -----------WSYL--------FSH-----------------------Q
A0A3Q3WTY4_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3P8Y761_BAD-01      -----------WAFL--------FSH-----------------------K
A0A4W5JLL9_BAD-01      -----------WAYL--------FSH-----------------------K
A0A3B5Q2N7_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A087X8P8_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3B3UA11_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3B3YFR1_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3P9Q7C3_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3B3HDU2_BAD-01      -----------WNYL--------FSH-----------------------P
A0A3P9KSL7_BAD-02      -----------WNYL--------FSH-----------------------P
A0A3P9KSL7_BAD-01      -----------WNYL--------FSH-----------------------P
A0A3B5BAL2_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A665TUH3_BAD-01      -----------WNYL--------FSH-----------------------Q
A0A674MXC1_BAD-04      -----------WSYL--------FSH-----------------------Q
A0A674MXC1_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A674MXC1_BAD-02      -----------WSYL--------FSH-----------------------Q
A0A674MXC1_BAD-03      -----------WSYL--------FSH-----------------------Q
A0A671TL42_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q3AEL8_BAD-01      -----------WNYL--------FSH-----------------------Q
A0A3Q3AEL8_BAD-02      -----------WNYL--------FSH-----------------------Q
A0A1A8AQV0_BAD-01      -----------WNYL--------FSH-----------------------Q
G3Q8B3_BAD-01          -----------WSSL--------FSH-----------------------Q
A0A3Q2Y0E4_BAD-01      -----------WSYL--------FSH-----------------------Q
A0A3Q3R5S3_BAD-01      -----------WSYL--------FSH-----------------------Q
                                                                         

Q61337_BAD-09          SGCQNEAHSFLLLP------------------------------------
Q2PG01_BAD-01          LGR---------GSSAPSQ-------------------------------
A0A2I3H4B2_BAD-01      LGR---------GSSAPSQ-------------------------------
Q92934_BAD-05          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
A0A670JUY4_BAD-01      SPG---------NGPRSPP-------------------------------
A0A670YRG7_BAD-01      GSDIMALSRFSPSAPSTLN-------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      EEEGRE--------------------------------------------
A0A4W4DXF5_BAD-01      EEEGRK--------------------------------------------
A0A452IFQ4_BAD-01      PARDALPRSSK---------------------------------------
A0A674I2R9_BAD-01      PARDAPPRSSK---------------------------------------
C1C3S9_BAD-01          NKDRSQSENDKH--------------------------------------
A0A6I8PXS6_BAD-01      KSKGRDESGDEE--------------------------------------
A0A3P8YI30_BAD-01      EAEGRD--------------------------------------------
A0A3B4DUY7_BAD-01      EEEGRE--------------------------------------------
A0A337SAW2_BAD-01      DRNLGRGGSAPSQ-------------------------------------
A0A673J9C6_BAD-01      ESDAESRP------AE----------------------------------
A0A4W5JLL9_BAD-02      ETETEHTPTIPPRSSE----------------------------------
A0A674DKC6_BAD-01      ETETEHTPTIPPRSSE----------------------------------
A0A4W4HE29_BAD-01      ESDTETSSSVTAPDTRPAE-------------------------------
A0A3B4CPH6_BAD-01      ESDSEASSSLTAPDTRPAE-------------------------------
A0A674AVP9_BAD-01      EAEGRE--------------------------------------------
A0A1S3L0Z2_BAD-01      EAEGRE--------------------------------------------
B5XEF1_BAD-01          EAEGRE--------------------------------------------
A0A4W5MZR2_BAD-01      EAEGRE--------------------------------------------
A0A060W8W7_BAD-01      EAEGRE--------------------------------------------
E7FBJ6_BAD-01          EEEGRE--------------------------------------------
A0A673J5Q9_BAD-01      EEEGRE--------------------------------------------
A0A671PX91_BAD-01      EEEGRE--------------------------------------------
A0A672LB88_BAD-01      EEEGRE--------------------------------------------
A0A673I6H5_BAD-01      EEEGRE--------------------------------------------
A0A671SBB4_BAD-01      EEEGRE--------------------------------------------
A0A672R7P6_BAD-01      DEEGRE--------------------------------------------
A0A3P8Y761_BAD-02      ETETEKTPNLIITEPRSSE-------------------------------
A0A3Q2QC80_BAD-01      ETEGENSHHENHAP-RTE--------------------------------
A0A4W6EMZ7_BAD-02      ETEGENNHHENHTH-RTE--------------------------------
A0A3Q3FKT9_BAD-02      TLHSSL--------------------------------------------
A0A3Q3FKT9_BAD-03      ETEGENNHHENHTH-RNE--------------------------------
A0A3B5L9R9_BAD-01      ETEGENNHHENHAS-RTE--------------------------------
A0A667ZNC6_BAD-01      ETEGETSHHENHSN-RTE--------------------------------
A0A3P9B2E4_BAD-01      VSQGLN--------------------------------------------
A0A668V3Q4_BAD-01      ETEGENNHLENHNQ-RTE--------------------------------
I3K7B6_BAD-01          ETEGENNHLENHNQ-RTE--------------------------------
A0A3Q3C680_BAD-01      ETEGENNHLENHNQ-RTE--------------------------------
A0A3P8QRJ7_BAD-01      ETEGENNHLENHNQ-RTE--------------------------------
A0A3Q4GGN3_BAD-01      ETEGENNHLENHNQ-RTE--------------------------------
A0A3B4GXJ6_BAD-01      ETEGENNHLENHNQ-RTE--------------------------------
A0A3Q2D5S0_BAD-01      EMEGENSHHENHTQ-CTEQRGE----------------------------
A0A3Q0QNQ2_BAD-01      ESDGENSHHENHTQ-RTE--------------------------------
A0A3P8WI83_BAD-02      ELEGENNHHENHTH-RTE--------------------------------
A0A3P8WI83_BAD-01      ELEGENNHHENHTH-RTE--------------------------------
A0A3P9HNZ2_BAD-01      EAEGEYSHHESQ---RTE--------------------------------
A0A3B3BQF7_BAD-01      EAEGEYSHHESH---RTE--------------------------------
A0A672JQ68_BAD-01      ETEGENNHHENHSHDRTE--------------------------------
A0A2U9BAC9_BAD-01      EMEGENNHHENHTQ-RNE--------------------------------
A0A4W6EMZ7_BAD-01      ETEGENNHHENHTH-RTE--------------------------------
A0A3B4VFC5_BAD-01      ETEGENNHHENHTH-RTE--------------------------------
A0A3B4W9T1_BAD-01      ETEGENNHHENHTH-RTE--------------------------------
A0A3Q1K1C7_BAD-01      ETEGENNHHESHTH-RTE--------------------------------
A0A672YF93_BAD-01      EMEGENSHHENHKN-RTE--------------------------------
A0A3Q1GWH9_BAD-01      EMEGENNHHESHTH-RNE--------------------------------
A0A3Q1CPU7_BAD-01      EMEGENNHHESHTH-RNE--------------------------------
A0A3P8TWH6_BAD-01      EMEGENNHHESHTH-RNE--------------------------------
H3D8J8_BAD-01          ETESENNHHD----------------------------------------
A0A6F9CQZ0_BAD-02      ETETEHSPNLTAP--EPR--------------------------------
A0A6F9CA11_BAD-02      ETETEHTSTIPPR--SSE--------------------------------
A0A1S3N9Q3_BAD-01      ETETEHTPTIPPR--SSE--------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      ESDSEASSSRPAE-------------------------------------
A0A5F8GA49_BAD-01      LGKGGAGPSH----------------------------------------
H3ANP3_BAD-03          -GQPRDPPGQ----------------------------------------
H3ANP3_BAD-04          -GQPRDPPGQ----------------------------------------
H3ANP3_BAD-02          -GQPRDPPGQQGVSIRGPD-------------------------------
H3ANP3_BAD-01          -GQPRDPPGQQGVSIRGPD-------------------------------
A0A4X2KAA5_BAD-01      LGKGSAA-----GPSH----------------------------------
A0A672V9F8_BAD-01      FGGGGPRFR---GGGQ----------------------------------
A0A674GQ16_BAD-01      LGRGAPKCCREWGGGQ----------------------------------
A0A6I8NVP2_BAD-01      SSSAQ---------------------------------------------
G3TP47_BAD-01          LGRGSSAPSQ----------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      LGRRGSAPSQ----------------------------------------
G5B6Q3_BAD-02          LGRGGSAPSQ----------------------------------------
G5B6Q3_BAD-01          LGRGGSAPSQ----------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-01          LGKGGSTPSQ----------------------------------------
Q61337_BAD-06          LGKGGSTPSQ----------------------------------------
Q61337_BAD-04          LGKGGSTPSQ----------------------------------------
Q61337_BAD-03          LGKGGSTPSQ----------------------------------------
A0A2I3TBK7_BAD-01      AKRGSVLSPLEGGLTPIPFRCV----------------------------
A0A2R8Z674_BAD-02      AKRGSVLSPLEGGLTQIPFRCV----------------------------
A0A2I2YFH2_BAD-03      AKRGSVLSPLEGRLTQIPFRCV----------------------------
Q92934_BAD-03          AKRGSVLSPLEGGLTQIPFRCV----------------------------
A0A2K5M0A7_BAD-02      CKRGSVLPLSVGGLTQIPFRCM----------------------------
A0A2K5XJR2_BAD-02      CKRGSVLPLSVGGLTQIPFRCM----------------------------
A0A096MLD5_BAD-03      CKRGSVLPLSVGGLTQIPFRCM----------------------------
A0A2K6E7I4_BAD-02      CKRGSVLPLSVGGLTQIPFRCM----------------------------
A0A2K5PDB1_BAD-02      -----------GGLTQIPFRCV----------------------------
A0A2K5E6A6_BAD-02      -----------GELTQIPFRCV----------------------------
A0A2K6TG62_BAD-02      -----------GGLTQIPFRCV----------------------------
A0A2K5HKU7_BAD-02      SGQHSDMAASSGG-------------------------------------
A0A2K6N196_BAD-02      SGQHSDMAASSGG-------------------------------------
A0A2K6PUL3_BAD-02      SGQHSDMAASSGG-------------------------------------
A0A2K5M0A7_BAD-03      SGQHSVMAASSGG-------------------------------------
A0A2K5XJR2_BAD-03      SGQHSVMAASSGG-------------------------------------
A0A096MLD5_BAD-02      SGQHSVMAASSGG-------------------------------------
A0A2K6E7I4_BAD-03      SGQHSVMAASSGG-------------------------------------
A0A2I2YFH2_BAD-04      SGQHSAMAASSGG-------------------------------------
Q92934_BAD-04          SGQHSAMAASSGG-------------------------------------
A0A2I3TBK7_BAD-03      SGQHSAMAASSGG-------------------------------------
A0A2R8Z674_BAD-03      SGQHSAMAASSGG-------------------------------------
A0A2K5E6A6_BAD-03      SGQHSAMAASSGG-------------------------------------
A0A2K5PDB1_BAD-03      SGQHSAMAASSGG-------------------------------------
A0A2K6TG62_BAD-03      SGQHSDMAASSGG-------------------------------------
G1P8C5_BAD-01          SGRGGSAPSQ----------------------------------------
A0A452ER54_BAD-02      LGRGGSAPSQ----------------------------------------
W5P8G9_BAD-01          LGRGGSAPSQ----------------------------------------
Q61337_BAD-07          VPSPGLCLHL----------------------------------------
O35147_BAD-01          LGKGGSTPSQ----------------------------------------
F7DN67_BAD-01          LGRGGSAPSQ----------------------------------------
Q45KI9_BAD-01          LGRGGSAPSQ----------------------------------------
A0A3Q7SWS0_BAD-01      LGRGGSAPSQ----------------------------------------
H0WVR2_BAD-01          VGRGGSAPCQ----------------------------------------
A0A2K6GWV0_BAD-01      VGRGGSAPSQ----------------------------------------
H0V608_BAD-01          LGRGGSAPSQESV-------------------------------------
A0A2K5PDB1_BAD-01      LGRGGSAPSQ----------------------------------------
U3F2S3_BAD-01          LGRGGSAPSQ----------------------------------------
A0A2K5E6A6_BAD-01      LGRGGSAPSQ----------------------------------------
A0A2K6TG62_BAD-01      LGRGGSAPSQ----------------------------------------
A0A2K5M0A7_BAD-01      LGRGSSAPSQ----------------------------------------
A0A1D5QBW1_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2K6E7I4_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2K5XJR2_BAD-01      LGRGSSAPSQ----------------------------------------
A0A096MLD5_BAD-04      LGRGSSAPSQ----------------------------------------
A0A2K6N196_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2K6PUL3_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2K5HKU7_BAD-01      LGRGSSAPSQ----------------------------------------
A0A0D9R491_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2K5VCA1_BAD-01      LGRGSSAPSQ----------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2I2YFH2_BAD-02      LGRGSSAPSQ----------------------------------------
A0A2I2YFH2_BAD-01      LGRGSSAPSQ----------------------------------------
Q92934_BAD-01          LGRGSSAPSQ----------------------------------------
Q92934_BAD-02          LGRGSSAPSQ----------------------------------------
A0A2I3TBK7_BAD-02      LGRGSSAPSQ----------------------------------------
A0A2R8Z674_BAD-01      LGRGSSAPSQ----------------------------------------
A0A2J8TYJ3_BAD-01      LGRGSSAPSQ----------------------------------------
A0A4X1VE31_BAD-01      LGS-----------------------------------------------
A0A4X1VE31_BAD-02      SGRGGPAPSQ----------------------------------------
A0A287AEF3_BAD-01      SGRGGPAPSQ----------------------------------------
A0A4X1VE31_BAD-03      SGRGGPAPSQ----------------------------------------
A0A671ELU4_BAD-01      --RGGSASSQ----------------------------------------
A0A452ER54_BAD-01      LGRGGSAPSQ----------------------------------------
G1MI17_BAD-01          LGRGGSAPSQ----------------------------------------
A0A452RJM6_BAD-01      LGRGGSAPSQ----------------------------------------
A0A384DJL2_BAD-01      LGRGGSAPSQ----------------------------------------
M3YNE7_BAD-01          LGRGGSAPSQ----------------------------------------
A0A667H8Z9_BAD-01      LGRGGSAPSQ----------------------------------------
A0A673V6P8_BAD-01      LGRGGSAPSQ----------------------------------------
A0A4W2C9A8_BAD-01      LGRGGSAPSQ----------------------------------------
A0A4W2C9A8_BAD-01      LGRGGSAPSQ----------------------------------------
F1MUT9_BAD-01          LGRGGSAPSQ----------------------------------------
Q3SYZ0_BAD-01          LGRGGSAPSQ----------------------------------------
A0A4U1FMC3_BAD-01      LGRGGPAPSQ----------------------------------------
A0A2Y9EHU3_BAD-01      LGRGGPAPSQ----------------------------------------
A0A6F9BAV3_BAD-01      EAEGR--------------E------------------------------
A0A3P8YI30_BAD-02      EAEGR--------------D------------------------------
A0A4W5R1T6_BAD-01      ESEGR--------------E------------------------------
A0A060W8P9_BAD-01      EAEGR--------------E------------------------------
B5X1T1_BAD-01          KAEGR--------------E------------------------------
A0A673ZHY7_BAD-01      KAEGR--------------E------------------------------
A0A671NP27_BAD-01      ESDAE----------SRPAE------------------------------
A0A672SAE4_BAD-01      ESDAE----------SRPAE------------------------------
A0A672SAE4_BAD-02      ESDAE----------SRPAE------------------------------
A0A671RUV0_BAD-01      ESDAE----------SRPAE------------------------------
A0A673HRQ3_BAD-01      ESDAE----------SRPAE------------------------------
A0A672RGH0_BAD-01      ESDAE----------SRPAE------------------------------
Q4V925_BAD-02          ESDAE----------SRPAE------------------------------
Q4V925_BAD-03          ESDAE----------SRPAE------------------------------
A7MCM4_BAD-01          ESDAE----------SRPAE------------------------------
Q4V925_BAD-04          ESDAE----------SRPAE------------------------------
Q4V925_BAD-01          ESDAE----------SRPAE------------------------------
A0A3B3QX41_BAD-01      ESDAE-ISGSLSTADSRAAQ------------------------------
A0A3Q3RXS8_BAD-01      ETDGE---NNLHENHTPRTE------------------------------
A0A3Q0QNQ2_BAD-02      ESDGE---NSHHENHTQRTE------------------------------
A0A3Q3WTY4_BAD-01      ETDGE---NNHHDSHTHRNE------------------------------
A0A3P8Y761_BAD-01      ETETE-KTPNLIITEPRSSE------------------------------
A0A4W5JLL9_BAD-01      ETETE-HTPTI---PPRSSE------------------------------
A0A3B5Q2N7_BAD-01      ETEGE---NNHHENHASRTE------------------------------
A0A087X8P8_BAD-01      ETEGE---NNHHENHASRTE------------------------------
A0A3B3UA11_BAD-01      ETEGE---NNHHENHASRTE------------------------------
A0A3B3YFR1_BAD-01      ETEGE---NNHHENHASRTE------------------------------
A0A3P9Q7C3_BAD-01      ETEGE---NNHHENHASRTE------------------------------
A0A3B3HDU2_BAD-01      EAEGE---YSHHE--SHRTE------------------------------
A0A3P9KSL7_BAD-02      EAEGE---YSHHE--SHRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRN
A0A3P9KSL7_BAD-01      EAEGE---YSHHE--SHRTENRDLLGWLRCSSDITVSHVTAGFQLPFTRN
A0A3B5BAL2_BAD-01      ELEGE---NNHHENHTHRNE------------------------------
A0A665TUH3_BAD-01      ETEGE---NNHLE--SHRNE------------------------------
A0A674MXC1_BAD-04      ETEGE---NGHHDGHTHRTE------------------------------
A0A674MXC1_BAD-01      ETEGE---NGHHDGHTHRTE------------------------------
A0A674MXC1_BAD-02      ETEGE---NGHHDGHTHRTE------------------------------
A0A674MXC1_BAD-03      ETEGE---NGHHDGHTHRTE------------------------------
A0A671TL42_BAD-01      EMEGE---NNHHDNHTHRTE------------------------------
A0A3Q3AEL8_BAD-01      ETDGE---SSHHEKPTHRTE------------------------------
A0A3Q3AEL8_BAD-02      ETDGE---SSHHEKPTHRTE------------------------------
A0A1A8AQV0_BAD-01      ESDGE---NSHHDNPTQRTE------------------------------
G3Q8B3_BAD-01          EMEGE---NNHHE-------------------------------------
A0A3Q2Y0E4_BAD-01      ETEGENNNNNHHDNHANRTE------------------------------
A0A3Q3R5S3_BAD-01      ETEGE---NTHHENAALAQEVERVVS------------------------
                                                                         

Q61337_BAD-09          ---------------------------------
Q2PG01_BAD-01          ---------------------------------
A0A2I3H4B2_BAD-01      ---------------------------------
Q92934_BAD-05          ---------------------------------
Q92934_BAD-06          ---------------------------------
A0A670JUY4_BAD-01      ---------------------------------
A0A670YRG7_BAD-01      ---------------------------------
Q6P7C5_BAD-01          ---------------------------------
A0A3B1JLM2_BAD-01      ---------------------------------
A0A4W4DXF5_BAD-01      ---------------------------------
A0A452IFQ4_BAD-01      ---------------------------------
A0A674I2R9_BAD-01      ---------------------------------
C1C3S9_BAD-01          ---------------------------------
A0A6I8PXS6_BAD-01      ---------------------------------
A0A3P8YI30_BAD-01      ---------------------------------
A0A3B4DUY7_BAD-01      ---------------------------------
A0A337SAW2_BAD-01      ---------------------------------
A0A673J9C6_BAD-01      ---------------------------------
A0A4W5JLL9_BAD-02      ---------------------------------
A0A674DKC6_BAD-01      ---------------------------------
A0A4W4HE29_BAD-01      ---------------------------------
A0A3B4CPH6_BAD-01      ---------------------------------
A0A674AVP9_BAD-01      ---------------------------------
A0A1S3L0Z2_BAD-01      ---------------------------------
B5XEF1_BAD-01          ---------------------------------
A0A4W5MZR2_BAD-01      ---------------------------------
A0A060W8W7_BAD-01      ---------------------------------
E7FBJ6_BAD-01          ---------------------------------
A0A673J5Q9_BAD-01      ---------------------------------
A0A671PX91_BAD-01      ---------------------------------
A0A672LB88_BAD-01      ---------------------------------
A0A673I6H5_BAD-01      ---------------------------------
A0A671SBB4_BAD-01      ---------------------------------
A0A672R7P6_BAD-01      ---------------------------------
A0A3P8Y761_BAD-02      ---------------------------------
A0A3Q2QC80_BAD-01      ---------------------------------
A0A4W6EMZ7_BAD-02      ---------------------------------
A0A3Q3FKT9_BAD-02      ---------------------------------
A0A3Q3FKT9_BAD-03      ---------------------------------
A0A3B5L9R9_BAD-01      ---------------------------------
A0A667ZNC6_BAD-01      ---------------------------------
A0A3P9B2E4_BAD-01      ---------------------------------
A0A668V3Q4_BAD-01      ---------------------------------
I3K7B6_BAD-01          ---------------------------------
A0A3Q3C680_BAD-01      ---------------------------------
A0A3P8QRJ7_BAD-01      ---------------------------------
A0A3Q4GGN3_BAD-01      ---------------------------------
A0A3B4GXJ6_BAD-01      ---------------------------------
A0A3Q2D5S0_BAD-01      ---------------------------------
A0A3Q0QNQ2_BAD-01      ---------------------------------
A0A3P8WI83_BAD-02      ---------------------------------
A0A3P8WI83_BAD-01      ---------------------------------
A0A3P9HNZ2_BAD-01      ---------------------------------
A0A3B3BQF7_BAD-01      ---------------------------------
A0A672JQ68_BAD-01      ---------------------------------
A0A2U9BAC9_BAD-01      ---------------------------------
A0A4W6EMZ7_BAD-01      ---------------------------------
A0A3B4VFC5_BAD-01      ---------------------------------
A0A3B4W9T1_BAD-01      ---------------------------------
A0A3Q1K1C7_BAD-01      ---------------------------------
A0A672YF93_BAD-01      ---------------------------------
A0A3Q1GWH9_BAD-01      ---------------------------------
A0A3Q1CPU7_BAD-01      ---------------------------------
A0A3P8TWH6_BAD-01      ---------------------------------
H3D8J8_BAD-01          ---------------------------------
A0A6F9CQZ0_BAD-02      ---------------------------------
A0A6F9CA11_BAD-02      ---------------------------------
A0A1S3N9Q3_BAD-01      ---------------------------------
A0A3Q3FKT9_BAD-01      ---------------------------------
A0A3B1IH05_BAD-01      ---------------------------------
A0A5F8GA49_BAD-01      ---------------------------------
H3ANP3_BAD-03          ---------------------------------
H3ANP3_BAD-04          ---------------------------------
H3ANP3_BAD-02          ---------------------------------
H3ANP3_BAD-01          ---------------------------------
A0A4X2KAA5_BAD-01      ---------------------------------
A0A672V9F8_BAD-01      ---------------------------------
A0A674GQ16_BAD-01      ---------------------------------
A0A6I8NVP2_BAD-01      ---------------------------------
G3TP47_BAD-01          ---------------------------------
A0A287CT05_BAD-02      ---------------------------------
A0A287CT05_BAD-01      ---------------------------------
G5B6Q3_BAD-02          ---------------------------------
G5B6Q3_BAD-01          ---------------------------------
Q61337_BAD-02          ---------------------------------
Q61337_BAD-05          ---------------------------------
Q61337_BAD-01          ---------------------------------
Q61337_BAD-06          ---------------------------------
Q61337_BAD-04          ---------------------------------
Q61337_BAD-03          ---------------------------------
A0A2I3TBK7_BAD-01      ---------------------------------
A0A2R8Z674_BAD-02      ---------------------------------
A0A2I2YFH2_BAD-03      ---------------------------------
Q92934_BAD-03          ---------------------------------
A0A2K5M0A7_BAD-02      ---------------------------------
A0A2K5XJR2_BAD-02      ---------------------------------
A0A096MLD5_BAD-03      ---------------------------------
A0A2K6E7I4_BAD-02      ---------------------------------
A0A2K5PDB1_BAD-02      ---------------------------------
A0A2K5E6A6_BAD-02      ---------------------------------
A0A2K6TG62_BAD-02      ---------------------------------
A0A2K5HKU7_BAD-02      ---------------------------------
A0A2K6N196_BAD-02      ---------------------------------
A0A2K6PUL3_BAD-02      ---------------------------------
A0A2K5M0A7_BAD-03      ---------------------------------
A0A2K5XJR2_BAD-03      ---------------------------------
A0A096MLD5_BAD-02      ---------------------------------
A0A2K6E7I4_BAD-03      ---------------------------------
A0A2I2YFH2_BAD-04      ---------------------------------
Q92934_BAD-04          ---------------------------------
A0A2I3TBK7_BAD-03      ---------------------------------
A0A2R8Z674_BAD-03      ---------------------------------
A0A2K5E6A6_BAD-03      ---------------------------------
A0A2K5PDB1_BAD-03      ---------------------------------
A0A2K6TG62_BAD-03      ---------------------------------
G1P8C5_BAD-01          ---------------------------------
A0A452ER54_BAD-02      ---------------------------------
W5P8G9_BAD-01          ---------------------------------
Q61337_BAD-07          ---------------------------------
O35147_BAD-01          ---------------------------------
F7DN67_BAD-01          ---------------------------------
Q45KI9_BAD-01          ---------------------------------
A0A3Q7SWS0_BAD-01      ---------------------------------
H0WVR2_BAD-01          ---------------------------------
A0A2K6GWV0_BAD-01      ---------------------------------
H0V608_BAD-01          ---------------------------------
A0A2K5PDB1_BAD-01      ---------------------------------
U3F2S3_BAD-01          ---------------------------------
A0A2K5E6A6_BAD-01      ---------------------------------
A0A2K6TG62_BAD-01      ---------------------------------
A0A2K5M0A7_BAD-01      ---------------------------------
A0A1D5QBW1_BAD-01      ---------------------------------
A0A2K6E7I4_BAD-01      ---------------------------------
A0A2K5XJR2_BAD-01      ---------------------------------
A0A096MLD5_BAD-04      ---------------------------------
A0A2K6N196_BAD-01      ---------------------------------
A0A2K6PUL3_BAD-01      ---------------------------------
A0A2K5HKU7_BAD-01      ---------------------------------
A0A0D9R491_BAD-01      ---------------------------------
A0A2K5VCA1_BAD-01      ---------------------------------
B4DZQ9_BAD-01          ---------------------------------
A0A096MLD5_BAD-01      ---------------------------------
A0A2I2YFH2_BAD-02      ---------------------------------
A0A2I2YFH2_BAD-01      ---------------------------------
Q92934_BAD-01          ---------------------------------
Q92934_BAD-02          ---------------------------------
A0A2I3TBK7_BAD-02      ---------------------------------
A0A2R8Z674_BAD-01      ---------------------------------
A0A2J8TYJ3_BAD-01      ---------------------------------
A0A4X1VE31_BAD-01      ---------------------------------
A0A4X1VE31_BAD-02      ---------------------------------
A0A287AEF3_BAD-01      ---------------------------------
A0A4X1VE31_BAD-03      ---------------------------------
A0A671ELU4_BAD-01      ---------------------------------
A0A452ER54_BAD-01      ---------------------------------
G1MI17_BAD-01          ---------------------------------
A0A452RJM6_BAD-01      ---------------------------------
A0A384DJL2_BAD-01      ---------------------------------
M3YNE7_BAD-01          ---------------------------------
A0A667H8Z9_BAD-01      ---------------------------------
A0A673V6P8_BAD-01      ---------------------------------
A0A4W2C9A8_BAD-01      ---------------------------------
A0A4W2C9A8_BAD-01      ---------------------------------
F1MUT9_BAD-01          ---------------------------------
Q3SYZ0_BAD-01          ---------------------------------
A0A4U1FMC3_BAD-01      ---------------------------------
A0A2Y9EHU3_BAD-01      ---------------------------------
A0A6F9BAV3_BAD-01      ---------------------------------
A0A3P8YI30_BAD-02      ---------------------------------
A0A4W5R1T6_BAD-01      ---------------------------------
A0A060W8P9_BAD-01      ---------------------------------
B5X1T1_BAD-01          ---------------------------------
A0A673ZHY7_BAD-01      ---------------------------------
A0A671NP27_BAD-01      ---------------------------------
A0A672SAE4_BAD-01      ---------------------------------
A0A672SAE4_BAD-02      ---------------------------------
A0A671RUV0_BAD-01      ---------------------------------
A0A673HRQ3_BAD-01      ---------------------------------
A0A672RGH0_BAD-01      ---------------------------------
Q4V925_BAD-02          ---------------------------------
Q4V925_BAD-03          ---------------------------------
A7MCM4_BAD-01          ---------------------------------
Q4V925_BAD-04          ---------------------------------
Q4V925_BAD-01          ---------------------------------
A0A3B3QX41_BAD-01      ---------------------------------
A0A3Q3RXS8_BAD-01      ---------------------------------
A0A3Q0QNQ2_BAD-02      ---------------------------------
A0A3Q3WTY4_BAD-01      ---------------------------------
A0A3P8Y761_BAD-01      ---------------------------------
A0A4W5JLL9_BAD-01      ---------------------------------
A0A3B5Q2N7_BAD-01      ---------------------------------
A0A087X8P8_BAD-01      ---------------------------------
A0A3B3UA11_BAD-01      ---------------------------------
A0A3B3YFR1_BAD-01      ---------------------------------
A0A3P9Q7C3_BAD-01      ---------------------------------
A0A3B3HDU2_BAD-01      ---------------------------------
A0A3P9KSL7_BAD-02      SLFQGWWFDLPVQDQRRQQLQR-----------
A0A3P9KSL7_BAD-01      SLFQGWWFDLPVQDQRRQQLQARQNFLEPSIRT
A0A3B5BAL2_BAD-01      ---------------------------------
A0A665TUH3_BAD-01      ---------------------------------
A0A674MXC1_BAD-04      ---------------------------------
A0A674MXC1_BAD-01      ---------------------------------
A0A674MXC1_BAD-02      ---------------------------------
A0A674MXC1_BAD-03      ---------------------------------
A0A671TL42_BAD-01      ---------------------------------
A0A3Q3AEL8_BAD-01      ---------------------------------
A0A3Q3AEL8_BAD-02      ---------------------------------
A0A1A8AQV0_BAD-01      ---------------------------------
G3Q8B3_BAD-01          ---------------------------------
A0A3Q2Y0E4_BAD-01      ---------------------------------
A0A3Q3R5S3_BAD-01      ---------------------------------
                                                        

© 1998-2021Legal notice