Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

215 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      ---------------------------------------MGTPENPLSAP
A0A673J9C6_BAD-01      --------------MKTYRSVGPMQLVSVLSISRRIR------------S
A0A4W5JLL9_BAD-02      -------------------MLSPSP-------------PLPFPTYPLSLS
A0A674DKC6_BAD-01      SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLP-LPLSLS
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      THVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR-----------
A0A673J9C6_BAD-01      CSAAVSALAIFHNLATTVYAHDALLRTQRPPERERKRER-------GKIL
A0A4W5JLL9_BAD-02      ASPPVS----------------------------------------FPLS
A0A674DKC6_BAD-01      ASPSSSPLLCLSPSSLSCLSLSSLSSPLSPPSPLSLSLPLLLPSPLSPLS
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTV--------------PVAQATRAGLPQY
A0A673J9C6_BAD-01      ELLLPCSVSCTVCELEVNCSCAATPHNTGACQDSSRNPNRA---------
A0A4W5JLL9_BAD-02      TSLFPSLSTSPLSLCPLSFISLY--------------PLSPHLFPLSL--
A0A674DKC6_BAD-01      SLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSS
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      --------------------------------------------------
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      WREAAGPG------------------------------------------
A0A673J9C6_BAD-01      -SESKHPD-----------TQITRKTVRRTP-------------------
A0A4W5JLL9_BAD-02      -HPSSPPS-----------HSFLVSPLSLTP-------------------
A0A674DKC6_BAD-01      PSPLSPPSPLSLPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFS
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      ------------------------------------------------MY
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          ---------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGS
A0A3B1JLM2_BAD-01      ------------MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDT
A0A4W4DXF5_BAD-01      ------------MHNQYLLRLRKANFTRED--YKKVIKAKTLREEG--ET
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      --------------------------------------------------
A0A673J9C6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      --------------------------------------------------
A0A674DKC6_BAD-01      LSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLTAFLFPL
A0A3P9A5G8_BAD-01      ----------------------------------MFYSFCHSPCDECFLT
A0A3B4DUY7_BAD-01      -----------------------MSNQYLQKLRRARFNCEEERYKKVIKT
A0A4W4HE29_BAD-01      -------------MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSY
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      --------------------------------------------------
A0A1S3L0Z2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
A0A060W8W7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
A0A671PX91_BAD-01      --------------------------------------------------
A0A672LB88_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A671SBB4_BAD-01      --------------------------------------------------
A0A672R7P6_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A6F9CQZ0_BAD-02      --------------------------------------------------
A0A6F9CA11_BAD-02      --------------------------------------------------
A0A1S3N9Q3_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      -----------------MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLN
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3Q3FKT9_BAD-03      ------MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENK
A0A667ZNC6_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      -------------------------------------------------M
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      ------------------------------------------------MN
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      RNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQF
A0A672JQ68_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A672YF93_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      ----------------------------------------MSTAARAAAG
A0A5F8GA49_BAD-01      --------MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESE
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A672V9F8_BAD-01      --------------------------------------------------
A0A674GQ16_BAD-01      --------------------------------------------------
A0A6I8NVP2_BAD-01      --------------------------------------------------
G3TP47_BAD-01          ------------------GPPENPSPASTHAQGVRMSGAEHPEKK-----
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
A0A287CT05_BAD-01      -----------------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPA
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          -----------------MGTPKQPSLAPAHALGLRKSD---PGIRSLGSD
Q61337_BAD-01          -----------------MGTPKQPSLAPAHALGLRKSD---PGIRSLGSD
G5B6Q3_BAD-01          -----------------MRTPENPSPAPTNAEGLRKLE---LGIRRLESA
G5B6Q3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z674_BAD-02      --------------------------------------------------
A0A2I2YFH2_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA1_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2YFH2_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z674_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          -------------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDA
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA1_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-01      --------------------------------------------------
A0A2I2YFH2_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z674_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          -------------------VGTPENPSSAPTHGPGKRKSGTDRRETRKGP
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A4X1VE31_BAD-01      -------------------------MGSSGGKKLWLARPSPSTEEPLPLP
A0A287AEF3_BAD-01      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A4X1VE31_BAD-03      -------------------MGIPENPSSASTHTQGIRKSGAEPGTPEEGG
A0A671ELU4_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      ---------------------------MGTPENPSAAPTTRKLSIRRRRR
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A667H8Z9_BAD-01      --------------------------------------------------
A0A673V6P8_BAD-01      --------------------------------------------------
A0A2Y9EHU3_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      ------------------------------------------MAIINTII
A0A060W8P9_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A673ZHY7_BAD-01      --------------------------------------------------
A0A671NP27_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-01      --------------------------------------------------
A0A672SAE4_BAD-02      --------------------------------------------------
A0A671RUV0_BAD-01      --------------------------------------------------
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A672RGH0_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A665TUH3_BAD-01      --------------------------------------------------
A0A674MXC1_BAD-02      --------------------------------------------------
A0A674MXC1_BAD-03      --------------------------------------------------
A0A674MXC1_BAD-04      --------------------------------------------------
A0A674MXC1_BAD-01      --------------------------------------------------
A0A671TL42_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          DAGGRRWRPAAQSMFQI--PEF-EPSEQEDA--------STTDRGLGPSL
A0A3B1JLM2_BAD-01      LFRPLCWNSSGSTVFTM---EKTPPHSKEDDIS------PIDDHDESRWS
A0A4W4DXF5_BAD-01      PSNTSCWNPFRVTAFTM---EKA-PCGQRDDIS------ALDDQDESRWS
A0A452IFQ4_BAD-01      -------------MFRI--QEF-----------------PDEVFPGRGKE
A0A674I2R9_BAD-01      -------------MFRI--QEF-----------------PDEVFPGRGKE
C1C3S9_BAD-01          -----MGDSPHKSMFSI--EEF-----------------PPTE-RGSAFS
A0A6I8PXS6_BAD-01      -----MADSSPSAVFKL--EEF-----------------DNEE-QGLPLP
A0A337SAW2_BAD-01      --QGPRDRAWAQSMFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A673J9C6_BAD-01      --TDSRNRLIMAQMFSI--SDN-ESD-TETS--------EDCEDSDLTKN
A0A4W5JLL9_BAD-02      LPPSSSVDVSMAQMFTI--SDS-ESEPSEEV--------GETEKDQLAAG
A0A674DKC6_BAD-01      LTSSSSVDVSMAQMFTI--SDS-ESEPSEEV--------GETEKDQSSAG
A0A3P9A5G8_BAD-01      ICNAFGQCLLRMDVFSLQAFKM---DHTQDCVGDIPENINEKYDLDHLGT
A0A3B4DUY7_BAD-01      LTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQDESNWS-ETVKN
A0A4W4HE29_BAD-01      REFTSAAGQLSEVVFTM--AQMFTISDTESD--------TSEGPGDTDQQ
A0A3B4CPH6_BAD-01      ----------MAHMFTL--SDDSDTSEDLGD---------------ADQP
A0A674AVP9_BAD-01      ---------------MD-HTHDCVDECESDH--------SGTTHNSEFQ-
A0A1S3L0Z2_BAD-01      ---------------MD-YTHDCVDECESDH--------SGTTRNSEFQ-
B5XEF1_BAD-01          ---------------MD-YTHDCVDECESDH--------SGTTRNSEFQ-
A0A4W5MZR2_BAD-01      ---------------MD-HTHDCVDECESDH--------SGTTHNSEFQ-
A0A060W8W7_BAD-01      ---------------MD-HIHDCVDECESDH--------SGTTHNSEFQ-
E7FBJ6_BAD-01          ----------MENTSHD-HQDDSSTLDEKER--------SHLKGTIKNH-
A0A673J5Q9_BAD-01      ----------MDNTLHD-HQDDSSTWNDKKK--------GR-EETIKNQ-
A0A671PX91_BAD-01      ----------MDNTLHD-HQDDSSTWNDKKK--------GR-EETIKNQ-
A0A672LB88_BAD-01      ----------MDNTLHD-HQDDSSTWNDKKK--------GR-EETIKNQ-
A0A673I6H5_BAD-01      ----------MDKRLHG-HQYDSSTLNDKKK--------GR-EETINTH-
A0A671SBB4_BAD-01      ----------MDKRLHD-HQNDSSTLNDKKK--------GR-EETINTH-
A0A672R7P6_BAD-01      ----------MDKRLHD-HRNDSSTLNDRKK--------GR-EETINTR-
A0A3P8Y761_BAD-02      -MGCSTPYRNGISTSTILPHTTGTGDRLLPY--------GLFCLITIGTR
A0A3B5L9R9_BAD-01      ----------MDTKFTI-SDGESDPSEDVEE--------RGDLQLMQEK-
H3D8J8_BAD-01          ----------MAAKFSLCSDSDSEPSEEVEE--------GERGSFSTS--
A0A6F9CQZ0_BAD-02      -------------MFTI-SDCKSEPSE-VGE--------TEKDKSAAGQ-
A0A6F9CA11_BAD-02      ----------MAQMFTI-SDSESEPSEDVGE--------TETDQSAAGK-
A0A1S3N9Q3_BAD-01      ----------MAQIFTI-SDSE---SEEVGE--------TENDQSSAGK-
A0A3Q2QC80_BAD-01      FPNSCLPDDTMAAKFTI-SDSDSEPPEEVEE--------EGNDQPADGK-
A0A3Q3FKT9_BAD-02      ----------MAAKFTI-SDSESGSEEEVKE--------EENDQSSAVE-
A0A3Q3FKT9_BAD-03      ISCLGVLDVTMAAKFTI-SDSESGSEEEVKE--------EENDQSSAVE-
A0A667ZNC6_BAD-01      -----------MASFTI-SDGESDPSEEVGE--------SETDKSLNHQ-
A0A3P9B2E4_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A668V3Q4_BAD-01      ----------MAANFTI-SDSESETSEEVGE--------EENQQPAGQD-
I3K7B6_BAD-01          ----------MAANFTI-SDSESETSEEVGE--------EENQQPAGQD-
A0A3Q3C680_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------EENQQSAGQA-
A0A3P8QRJ7_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A3Q4GGN3_BAD-01      ----------MAANFKI-SDSDSETSEEVGE--------GENQQSARQV-
A0A3B4GXJ6_BAD-01      ----------MAANFKI-SDSDSEASEEVGE--------GENQQSAGQA-
A0A3Q2D5S0_BAD-01      AQSVETSDPIMAATFTI-SDSDTEPSEEVEE--------TRNKEPRIRN-
A0A3Q0QNQ2_BAD-01      ----------FIHFLPF-IQGRGQQPSHLLQ--------LIWGTPRHSQ-
A0A3P8WI83_BAD-01      ----------MAAQFTI-SDSESEPEEEVEG--------GKIKHSLNDP-
A0A3P8WI83_BAD-02      VEVSIFPDVTMAAQFTI-SDSESEPEEEVEG--------GKIKHSLNDP-
A0A3P9HNZ2_BAD-01      ----------MAAKFTI-SD-DSESSEEVEG--------GKLDLGAAGG-
A0A3B3BQF7_BAD-01      ----------MAAKFSI-SDNDSESSEEVEG--------GRLDLAASGGE
A0A4W6EMZ7_BAD-02      LLNLPSPDVTMAANFTI-SDSESEASEEVEE--------GEMNQSSTEQ-
A0A672JQ68_BAD-01      ----------MAAKFSI-SDSESEPSEEVEE--------EETNE--TPA-
A0A2U9BAC9_BAD-01      ----------MAANFTI-SDSESEPSEEVEE--------GEVSQPWTGP-
A0A4W6EMZ7_BAD-01      ----------MAANFTI-SDSESEASEEVEE--------GEMNQSSTEQ-
A0A3B4VFC5_BAD-01      ----------MAANFTI-SDSESEPSEEVDE--------GEMSQSLTGQ-
A0A3B4W9T1_BAD-01      ----------MAANFTI-SDSESEPSEEVDE--------GEMSQSLTGQ-
A0A3Q1K1C7_BAD-01      ----------MAARFTI-SDSDSDPSEGMEE--------EGHNQSPPGQ-
A0A3Q1K1C7_BAD-02      ----------MAARFTI-SDSDSDPSEGMEE--------EGHNQSPPGQ-
A0A672YF93_BAD-01      ----------MAAKFTI-SDSESEPSEDLEE--------EQRRQPPTEQ-
A0A3Q1GWH9_BAD-01      ----------MAAKFSI-SDGDSEPEE--VE--------GENNHSPATE-
A0A3Q1CPU7_BAD-01      ----------MAAKFTI-SDSESEPSEEVEE--------GENNHSPATQ-
A0A3P8TWH6_BAD-01      ----------MAAKFTI-SDSESEPSEEVEE--------GENNHSPATQ-
A0A3Q3FKT9_BAD-01      -MTLTASDVTMAAKFTI--SDSESGSEEEVK-----------EEENDQSS
A0A3B1IH05_BAD-01      TCDSTAVSQPSKLDFTM--DHMFTISDESD---------ASEELGDSDQP
A0A5F8GA49_BAD-01      TPSWPDDASRPVSMFQI--PEF-EPGEQEDG----------------SER
H3ANP3_BAD-03          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-04          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-01          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
H3ANP3_BAD-02          -------------MFQI--SDS-DSDAYEDDRTGPLPLQSGGGRGEGSEP
A0A4X2KAA5_BAD-01      -----------MSMFQI--SEF-EPSEQETP--------KEDGFAYAPGE
G3VRY3_BAD-01          -------------MFQI--SEF-EPSE--------------------PGE
G3VRY3_BAD-02          -------------MFQI--SEF-EPSE--------------------PGE
A0A672V9F8_BAD-01      ----------------M--GGPCEVVGCSPP--------VP------PSA
A0A674GQ16_BAD-01      -------------MLRL--DETPEDRGSPPP--------SPWGGSPSPSQ
A0A6I8NVP2_BAD-01      -------------MFQI--PEF-EPSERGDV--------CTP--GGDPSQ
G3TP47_BAD-01          -KGRRRSSGGLQSMFQI--PEF-EQSDREDS--------TPADRGLGPSP
Q61337_BAD-05          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
A0A287CT05_BAD-02      GRRRGWHPAWTQSMFQI--PEF-EPSEQEDS--------SSAEGGLGPSP
A0A287CT05_BAD-01      GRRRGWHPAWTQSMFQI--PEF-EPSEQEDS--------SSAEGGLGPSP
Q61337_BAD-04          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-03          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-06          -------------MFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-02          AGGRRWRPA-AQSMFQI--PEF-EPSEQEDA--------SATDRGLGPSL
Q61337_BAD-01          AGGRRWRPA-AQSMFQI--PEF-EPSEQEDA--------SATDRGLGPSL
G5B6Q3_BAD-01          QS-----------MFQI--PEF-EPSEQEDS--------SSEERALGPTP
G5B6Q3_BAD-02          -------------MFQI--PEF-EPSEQEDS--------SSEERALGPTP
A0A2I3TBK7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-03          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5XJR2_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A096MLD5_BAD-03      -------------MFQI--PEF-EPSEQEDS--------RSAERGLGPSP
A0A2K5VCA1_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6E7I4_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5PDB1_BAD-02      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
A0A2K5E6A6_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K6TG62_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5HKU7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6N196_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6PUL3_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5VCA1_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5XJR2_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A096MLD5_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6E7I4_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-04      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-04          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I3TBK7_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5E6A6_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5PDB1_BAD-03      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
A0A2K6TG62_BAD-03      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
G1P8C5_BAD-01          --------PTAQSMFQI--PEF-EHSEQEDS--------SPADRGLGPCP
A0A452ER54_BAD-02      ------YRAWAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
W5P8G9_BAD-01          --QGPRYRAWAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
Q61337_BAD-07          --------------XQI--PEF-EPSEQEDA--------SATDRGLGPSL
O35147_BAD-01          GGRRWRPAAQS--MFQI--PEF-EPSEQEDA--------STTDRGLGPSL
F7DN67_BAD-01          -------------MFQI--PEF-EQSEPEDS--------SPADRGLGPSP
Q45KI9_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPANRGLGPSP
A0A3Q7SWS0_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPANRGLGPSP
H0WVR2_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSSDRGLGPSP
A0A2K6GWV0_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAGRGLGPSP
H0V608_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSEERGLGPSP
A0A2K5PDB1_BAD-01      -------------MFQI--PEF-EPSEQEGS--------SSAERGLNPST
U3F2S3_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K5E6A6_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A2K6TG62_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLSPST
A0A0D9R491_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5M0A7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A2K5VCA1_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A1D5QBW1_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6E7I4_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5XJR2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSL
A0A096MLD5_BAD-04      -------------MFQI--PEF-EPSEQEDS--------RSAERGLGPSP
A0A2K6N196_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K6PUL3_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2K5HKU7_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
B4DZQ9_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A096MLD5_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I2YFH2_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
Q92934_BAD-02          -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2I3TBK7_BAD-02      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2R8Z674_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
A0A2J8TYJ3_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SSAERGLGPSP
G1MI17_BAD-01          RTTALAPTAQS--MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-02      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-01      STGNRGPSLRAQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A287AEF3_BAD-01      GRGRSRSGPASQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4X1VE31_BAD-03      GRGRSRQGYLSQSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A671ELU4_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A452ER54_BAD-01      ESGGRQWAGPRGSMFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A452RJM6_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A384DJL2_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
M3YNE7_BAD-01          -------------MFQI--PEF-EPSEQEDS--------SPADRGLGPSP
A0A667H8Z9_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A673V6P8_BAD-01      -------------MFQI--PEF-EPSEQEDS--------SPTDRGLGPSP
A0A2Y9EHU3_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4W2C9A8_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
A0A4W2C9A8_BAD-01      -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
F1MUT9_BAD-01          -------------MFQI--PEF-EQSEQEDS--------SPADRGLGPSP
Q3SYZ0_BAD-01          -------------MFQI--PEF-EQSEQEDS--------SRADRGLGPSP
A0A6F9BAV3_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------MAFKMDHTQ--DCVGDIPENINE--------KYDLDHLGTTH
A0A4W5R1T6_BAD-01      HCGCPFSLQIFTMNHTH--DCVDDNPETMNE--------KDESDHSGTTH
A0A060W8P9_BAD-01      ------------MNHTH--DCVDDNPETMNE--------QDESDHSGTTH
B5X1T1_BAD-01          ------------MDHTH--DCVDDNPETMNE--------HDESDHSGTTH
A0A673ZHY7_BAD-01      ------------MDHTH--DCVDDNPETMNE--------QDESDHSGTTH
A0A671NP27_BAD-01      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A672SAE4_BAD-01      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A672SAE4_BAD-02      ----------MAQMFSI--SDNESDTETSED--------CEDSDLTKNNS
A0A671RUV0_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQAKNNS
A0A673HRQ3_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQVKNNS
A0A672RGH0_BAD-01      ----------MAQMFSI--SDNESETETSED--------CEESGQVKNNS
Q4V925_BAD-03          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
Q4V925_BAD-02          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
A7MCM4_BAD-01          ----------MAHMFNI--SD-DSETETMED--------SEASSLDKHKS
Q4V925_BAD-01          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
Q4V925_BAD-04          ----------MAHMFNI--SD-DSETETMED--------SEDSSLDKHKS
A0A3B3QX41_BAD-01      -----MSGVTMAHMFTI--SG-NESDTSESD--------TPDVTANSQLG
A0A3P8Y761_BAD-01      ----------MENIFTI---S-DTESESSDV----------EETKKEWIA
A0A4W5JLL9_BAD-01      ----------MAQMFTI---S-DSESEPSEE--------VGETEKDQLAA
A0A3B5Q2N7_BAD-01      ----------MDTKFTI---S-DGESDPSED--------VEERGDLQLMQ
A0A087X8P8_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3UA11_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3YFR1_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3P9Q7C3_BAD-01      ----------MDAKFTI---S-DSDSEPSED--------VEERGNLQLMQ
A0A3B3HDU2_BAD-01      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3P9KSL7_BAD-02      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3P9KSL7_BAD-01      ----------MAAKFTI-----SDDSESSEE--------VEGGKLDLGAA
A0A3B5BAL2_BAD-01      ----------MAAQFSI---S-GSESDP-EE--------VEEGENNHPPA
A0A665TUH3_BAD-01      ----------MSAQFTI---S-DSESDPSEE--------VEEGDMSQSL-
A0A674MXC1_BAD-02      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-03      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-04      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A674MXC1_BAD-01      ----------MATRFSI--SS-DSDSDPSEE--------VDEGERNSSLS
A0A671TL42_BAD-01      ----------MAANFTI--SS-ESDSEPSEE--------VEEGEHSQSPA
A0A3Q3AEL8_BAD-02      ----------MAAKFTI---S-DSESEPSDE--------VEEGKSKQPAA
A0A3Q3AEL8_BAD-01      ----------MAAKFTI---S-DSESEPSDE--------VEEGKSKQPAA
G3Q8B3_BAD-01          ----------MAAHFTI---S-DSESEPSDG--------VEEREDGQLSS
A0A3Q2Y0E4_BAD-01      ----------MAANFSI---S-DSESEPSEE--------VEEGDDGQGAA
A0A3Q3R5S3_BAD-01      ----------MAANFTI---S-DSESESSEE--------VEEGKHSQSST
A0A3Q3RXS8_BAD-02      ----------MAAKFS---IS-ESESDSSEE--------VEGGKQKKSSA
A0A3Q3RXS8_BAD-01      ----------MAAKFS---IS-ESESDSSEE--------VEGGKQKKSSA
A0A3Q0QNQ2_BAD-02      -------------------MP-EPPRLVLFD--------VEEGQSPFREG
A0A3Q3WTY4_BAD-01      ----------MATNFTI--SS-DSESELSEE--------IEEGENSQLQT
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      -----------------------------------LEF------------
A0A670YRG7_BAD-01      -----------------------------------LELRRR---------
Q6P7C5_BAD-01          TEDQP-------GPYLAPGLLGSI----VQQQPGQAANNSH---------
A0A3B1JLM2_BAD-01      EAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVR-LYSESQ---------
A0A4W4DXF5_BAD-01      ETIESDDSPRISNHHIMPNNTAT----EVGGRVR-LYSESQ---------
A0A452IFQ4_BAD-01      APAPPESQRGHTPGSKQPDT----PTAEVRSRIG-SDTPSL---------
A0A674I2R9_BAD-01      SPLPPESQRGHTPGSKQPDT----PTAEVRSRIG-SDPPSL---------
C1C3S9_BAD-01          GTNPPGFGG--DPGHKSSPNLRRIKGKETRQRTE-SASEAS---------
A0A6I8PXS6_BAD-01      FVDPPRGAGVRQPVAKSSPSLRRYPGKESRLRTE-SASESS---------
A0A337SAW2_BAD-01      TGDRP--RGPGKHQRTTPG--LLGE--AGHQQGQPASSNHH---------
A0A673J9C6_BAD-01      NS-GS--QQKTNHDLAVPD-RLKGEQLGRHR-NLSMNDEDL---------
A0A4W5JLL9_BAD-02      KG-MT--GGPIGHALTVPEMRLAGE--GRLRMNSESQAQEL---------
A0A674DKC6_BAD-01      KG-MT--GGPIGHTLTVPEMRLAGE--GRLRMNSESQAQEL---------
A0A3P9A5G8_BAD-01      THYPEFQFCNTSTNTSNRTLP--------GVRVR-LYSESQ---------
A0A3B4DUY7_BAD-01      GDSPQLDSQHSMASNISPASPDELS--EVGCRVR-LYSESQ---------
A0A4W4HE29_BAD-01      GDSKEAEPSQSEQHLHVPNTLRGEW--TARQRNHSMNEAEL---------
A0A3B4CPH6_BAD-01      EASKRAELSQSGQHPLVPERFRE-----SRQRNHSMNEDAL---------
A0A674AVP9_BAD-01      ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
A0A1S3L0Z2_BAD-01      ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
B5XEF1_BAD-01          ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
A0A4W5MZR2_BAD-01      ---------LHVSTTMSTRPR-------PGERVR-LYSESQ---------
A0A060W8W7_BAD-01      ---------LHVSTTMSNRPR-------PGERVR-LYSESQ---------
E7FBJ6_BAD-01          ---------GQHQDRTSANIS-------PQGRVR-LYSESQ---------
A0A673J5Q9_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A671PX91_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A672LB88_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A673I6H5_BAD-01      ---------GQHQDQTSPNIS-------PQGRVR-LYSESQ---------
A0A671SBB4_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-FYSESQ---------
A0A672R7P6_BAD-01      ---------GQHQDQTLPNIS-------PQGRVR-LYSESQ---------
A0A3P8Y761_BAD-02      DGTGAYGLFWLRNTHIHPLILCSFF--IGEGRIR-LNSESQ---------
A0A3B5L9R9_BAD-01      -----EKPLSQRHTLTLPELRST-----K---------------------
H3D8J8_BAD-01          ------------------------------GRIR-VNSESQ---------
A0A6F9CQZ0_BAD-02      ----GMTGGPLGHTLTVPEMRLA-----GEGRLR-LNSESQ---------
A0A6F9CA11_BAD-02      ----GMTGGPLGHALT----------------------------------
A0A1S3N9Q3_BAD-01      ----GMTGGPIGHALTVPEMRLA-----GEGRLR-MNSESQ---------
A0A3Q2QC80_BAD-01      -----VEPLRQRHALTLPELR-S-----GHGRIR-LNSESH---------
A0A3Q3FKT9_BAD-02      -----EPHVPQRHSLTLPELRLA-----GTGRIR-LNSESH---------
A0A3Q3FKT9_BAD-03      -----EPHVPQRHSLTLPELRLA-----GTGRIR-LNSESH---------
A0A667ZNC6_BAD-01      -----EQNHHLGHALTTPELRMS-----ASGRVR-LNSESH---------
A0A3P9B2E4_BAD-01      -------QESKPQTLSLPVTKTT-----AAGRLR-VNSESH---------
A0A668V3Q4_BAD-01      -------QESKPQTLALPVIKTT-----GAGRLR-LNSESH---------
I3K7B6_BAD-01          -------QESKPQTLALPVIKTT-----GAGRLR-LNSESH---------
A0A3Q3C680_BAD-01      -------QESKPQTLSLPVIKTT-----AAGRLR-VNSESH---------
A0A3P8QRJ7_BAD-01      -------QESKPQTLSLPVTKTT-----AAGRLR-VNSESH---------
A0A3Q4GGN3_BAD-01      -------QESKPQTLSLPVIKTT-----AAGRLR-VNSESH---------
A0A3B4GXJ6_BAD-01      -------QESKPQTLSLPVIKTT-----AAGRLR-VNSESH---------
A0A3Q2D5S0_BAD-01      --------------------SGK-----THRRIR-LSSESH---------
A0A3Q0QNQ2_BAD-01      ---------AIGHDQNTSPMRHP-----TARRIR-MNSESH---------
A0A3P8WI83_BAD-01      -----EQVVPHRHNLTLPELRVA-----GSRRIR-LNSESH---------
A0A3P8WI83_BAD-02      -----EQVVPHRHNLTLPELRVA-----GSRRIR-LNSESH---------
A0A3P9HNZ2_BAD-01      GGGGEGEHLHDRHSLTLPELRLT-----SNGRTR-LNSEST---------
A0A3B3BQF7_BAD-01      GGGGGGGHLHDRHALTLPELRLT-----SNGRTR-LNSEST---------
A0A4W6EMZ7_BAD-02      -----EQQIPQRNTVTLPELRLP-----VPGRIR-LNSESH---------
A0A672JQ68_BAD-01      -----DQRVRRRLDLSLNEFNLT-----ATGRIR-LNSESI---------
A0A2U9BAC9_BAD-01      -----GEQVPPRHTLALPELRMA-----ATGRIR-LNSESN---------
A0A4W6EMZ7_BAD-01      -----EQQIPQRNTVTLPELRLP-----VPGRIR-LNSESH---------
A0A3B4VFC5_BAD-01      -----EQELSQRHTLTLPELRGA-----ATGRTR-LNSESH---------
A0A3B4W9T1_BAD-01      -----EQELSQRHTLTLPELRGA-----ATGRTR-LNSESH---------
A0A3Q1K1C7_BAD-01      -----EQQVFPRHTLTLPELR-------ASGRIR-LNSESH---------
A0A3Q1K1C7_BAD-02      -----EQQVFPRHTLTLPELR-------ASGRIR-LNSESH---------
A0A672YF93_BAD-01      -----EQQISYSHSLTLPELRMA-----GAGRLR-LNSESQ---------
A0A3Q1GWH9_BAD-01      -----AMPVFARRNMALPELRTP-----ASGRIR-LNSESH---------
A0A3Q1CPU7_BAD-01      -----AMPVFARRNMALPELRTP-----ASGRLR-LNSESH---------
A0A3P8TWH6_BAD-01      -----AMPVFARRNMALPELRTP-----ASGRLR-LNSESH---------
A0A3Q3FKT9_BAD-01      AVEEP--HVPQRHSLTLPELRLAG----TGRIR--LNSESH---------
A0A3B1IH05_BAD-01      EVSKTAEPSRSGQHITVPEKLRVE----PRQRNFSMNEEAL---------
A0A5F8GA49_BAD-01      APGQP--GGPGRRSSAAPGAQR----------------------------
H3ANP3_BAD-03          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSHTGV---------
H3ANP3_BAD-04          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSHTVF---------
H3ANP3_BAD-01          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSH------------
H3ANP3_BAD-02          S-EKT--AGLKKHSRTAPNLQNPG----PHQSHP-PSH------------
A0A4X2KAA5_BAD-01      SRGLG--KHSATAPSLAPVRPGPR----PA-----PGAHHH---------
G3VRY3_BAD-01          DPS------ASTAPSLAPLRPGPR----AA-----PGAHHH---------
G3VRY3_BAD-02          DPS------ASTAPSLAPLRPGPR----AA-----PGAHHH---------
A0A672V9F8_BAD-01      AMSPA--PPAGGVPPPAPPRQVRP----AP-----P--------------
A0A674GQ16_BAD-01      PGTPS--PGQRLPPTQNPPPGGTP----KP-----PGG------------
A0A6I8NVP2_BAD-01      APAGP--GGLGRHTHTSPDL---A----SHLPGRRPPPAAHLSEAPPFSW
G3TP47_BAD-01          EGYWP--SGPSDRHRVAPGFLRDS----SHQQGQ-PTSSGH---------
Q61337_BAD-05          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
A0A287CT05_BAD-02      AGDRP---GCG----LAPGLPRDT----GHQQWQ-ATSSSN---------
A0A287CT05_BAD-01      AGDRP---GCG----LAPGLPRDT----GHQQWQ-ATSSSN---------
Q61337_BAD-04          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-03          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-06          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-02          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
Q61337_BAD-01          TEDQP---GPY----LAPGLLGSN----IHQQGR-AATNSH---------
G5B6Q3_BAD-01          TGDRL---GPS----SPGGFLGDI----SHQQRQ-LISSRH---------
G5B6Q3_BAD-02          TGDRL---GPS----SPGGFLGDI----SHQQRQ-LISSRH---------
A0A2I3TBK7_BAD-01      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2R8Z674_BAD-02      AGDGP--SGSSKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-03      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-03          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5M0A7_BAD-02      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5XJR2_BAD-02      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-03      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5VCA1_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6E7I4_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5PDB1_BAD-02      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5E6A6_BAD-02      AGDRP--PGSGKHPRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K6TG62_BAD-02      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5HKU7_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-ATSSSH---------
A0A2K6N196_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6PUL3_BAD-02      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5M0A7_BAD-03      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5VCA1_BAD-03      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5XJR2_BAD-03      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-02      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6E7I4_BAD-03      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-04      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-04          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I3TBK7_BAD-03      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2R8Z674_BAD-03      AGDGP--SGSSKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5E6A6_BAD-03      AGDRP--PGSGKHPRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K5PDB1_BAD-03      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K6TG62_BAD-03      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
G1P8C5_BAD-01          TGDQP--PGLNKHWSTVPGLLGEA----GHQQGQ-PASSSH---------
A0A452ER54_BAD-02      TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
W5P8G9_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
Q61337_BAD-07          TEDQP--G-----PYLAPGLLGSN----IHQQGR-AATNSH---------
O35147_BAD-01          TEDQP--G-----PYLAPGLLGSI----VQQQPGQAANNSH---------
F7DN67_BAD-01          TGDWP--SDPVRHQRTAPGLLGEA----GHQQGQ-PASSSH---------
Q45KI9_BAD-01          TGDRP--PSPGKHQQTAPGLLGEA----GHQQGQ-PASRKH---------
A0A3Q7SWS0_BAD-01      TGDRP------------PGLLGEA----GHQQGQ-PASRKH---------
H0WVR2_BAD-01          SGDQP--LGPGKNRCTTPSLLGDA----SHLQGQ-PASNTH---------
A0A2K6GWV0_BAD-01      SGDRP--SGPGKHPCTAPSFLGDA----SHQQGQ-PSSSSH---------
H0V608_BAD-01          TGDEL--GSS-----PAGGFLGDT----SHQQRQLRSSRSH---------
A0A2K5PDB1_BAD-01      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
U3F2S3_BAD-01          AGDRP--PGSGKHRRQAPGLPGDA----SHQQGQ-STSSSH---------
A0A2K5E6A6_BAD-01      AGDRP--PGSGKHPRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A2K6TG62_BAD-01      AGDSP--PGSGKHRRQAPGLPGDA----SHQQGQ-PTSSSH---------
A0A0D9R491_BAD-01      AGNRP--SDSGKHHHQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5M0A7_BAD-01      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5VCA1_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A1D5QBW1_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6E7I4_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5XJR2_BAD-01      AGDRP--SDCGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-04      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6N196_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K6PUL3_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2K5HKU7_BAD-01      AGDRP--SDSGKHHRQAPGLLWDA----SHQQEQ-ATSSSH---------
B4DZQ9_BAD-01          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A096MLD5_BAD-01      AGDKP--SDSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-01      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I2YFH2_BAD-02      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-01          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
Q92934_BAD-02          AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2I3TBK7_BAD-02      AGDGP--SGSGKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2R8Z674_BAD-01      AGDGP--SGSSKHHRQAPGLLWDA----SHQQEQ-PTSSSH---------
A0A2J8TYJ3_BAD-01      AGDRP--SGSSKHHRQAPGLLRDA----SHQQEQ-PTSSSH---------
G1MI17_BAD-01          TGDQP--PGPGKHRQTAPGLLGEA----AHPQGQ-PASSNH---------
A0A4X1VE31_BAD-02      TGDRP--PGPSKPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A4X1VE31_BAD-01      TGDRP--PGPSKPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A287AEF3_BAD-01      TGTDP------QPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A4X1VE31_BAD-03      TGDRP--PGPSKPWRTAPGHLGEA----GHQQGQ-PASSSH---------
A0A671ELU4_BAD-01      TGDQP--PGPGKHLCTAPGLLGEA----GHQQGQ-PASSSH---------
A0A452ER54_BAD-01      TGDRP--PGL------TPGLLGEA----GHQQGQ-PAGSSH---------
A0A452RJM6_BAD-01      TGDQP--PGPGKHRQTAPGLLGEA----AQPQGQ-PASSNH---------
A0A384DJL2_BAD-01      TGDQP--PGPGKHRQTAPGLLGEA----AHPQGQ-PASSNH---------
M3YNE7_BAD-01          TGDQP--PGLGKHLQTAPGLLGEA----GHQQGQ-PASSSH---------
A0A667H8Z9_BAD-01      TGDRP--RGPGKHQRTAPGLLGEA----GHQQGQ-PASSNH---------
A0A673V6P8_BAD-01      TGDRP--SGLGKHQRTAPGLLGEA----GPQQGQ-PASSSR---------
A0A2Y9EHU3_BAD-01      TGDKP--PGPSKHRQTAPGLLGEA----GHQQGQ-PASSSH---------
A0A4W2C9A8_BAD-01      TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
A0A4W2C9A8_BAD-01      TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
F1MUT9_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
Q3SYZ0_BAD-01          TGDRP--PGLSKHWLTAPGLLGEA----GHQQGQ-PAGSSH---------
A0A6F9BAV3_BAD-01      ------------------MSTRPR----PGGRVR-LYSESQ---------
A0A3P9A5G8_BAD-02      YPEFQ------FCNTSTNTSNRTL----PGVRVR-LYSESQ---------
A0A4W5R1T6_BAD-01      YPEFQ------LHTVSTTTSTRPR----PGGRVR-LYSESQ---------
A0A060W8P9_BAD-01      YPEFQ------LHNVSTTTSIRPR----PGGRAR-LYSESQ---------
B5X1T1_BAD-01          YPEFQ------RHYVSTRTGIRPR----PGGRVR-LYSESQ---------
A0A673ZHY7_BAD-01      YPEFQ------LHYVSTRTSIRPR----PGERVR-LYSESQ---------
A0A671NP27_BAD-01      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A672SAE4_BAD-01      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A672SAE4_BAD-02      GSPQK-----TNHDLAVPD--------------R-LKGEQL---------
A0A671RUV0_BAD-01      GSPQR-----KQH-LAVPD--------------R-LKGEQL---------
A0A673HRQ3_BAD-01      GSPQR-----KQH-LAVPD--------------R-LKGEQL---------
A0A672RGH0_BAD-01      GSPQR-----TQH-LAVPG--------------R-LKGEQL---------
Q4V925_BAD-03          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-02          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
A7MCM4_BAD-01          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-01          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
Q4V925_BAD-04          GSAQK-----KQH-LTVPD--------------R-LKGEQL---------
A0A3B3QX41_BAD-01      NNLKN-------------TKNPGE----AGGRVR-MRSESQ---------
A0A3P8Y761_BAD-01      GQGKT--GSRLGLSLNLP-----G----EG-RIR-LNSESQ---------
A0A4W5JLL9_BAD-01      GKGMT--GGPIGHALTVPEMRLAG----EG-RLR-MNSESQ---------
A0A3B5Q2N7_BAD-01      EKEKP--L-SQRHTLTLPELRSTT----G--RVR-LNSESI---------
A0A087X8P8_BAD-01      VKERP--L-SQRHTLTLPELRSTT----G--RVR-LNSESI---------
A0A3B3UA11_BAD-01      VKERP--L-SQRHTLTLPELRSTT----G--RVR-LNSESI---------
A0A3B3YFR1_BAD-01      VKERP--L-SQRHTLTLPELRSTT----G--RVR-LNSESI---------
A0A3P9Q7C3_BAD-01      VKERP--L-SQRHTLTLPELRSTT----G--RVR-LNSESI---------
A0A3B3HDU2_BAD-01      AGGEGEHL-HDRHSLTLPELRLTS----NG-RTR-LNSEST---------
A0A3P9KSL7_BAD-02      AGGEGEHL-HDRHSLTLPELRLTS----NG-RTR-LNSEST---------
A0A3P9KSL7_BAD-01      AGGEGEHL-HDRHSLTLPELRLTS----NG-RTR-LNSEST---------
A0A3B5BAL2_BAD-01      EQPMH--V-FERRNLALPELRTPA----AG-RIR-LNSESH---------
A0A665TUH3_BAD-01      --EQE--V-FQRHNLTLPEIRTAG----AG-RTR-LNSESH---------
A0A674MXC1_BAD-02      EQERQ--V-LQRHTLTLPELRLTG----TS-RTR-VSSESQ---------
A0A674MXC1_BAD-03      EQERQ--V-LQRHTLTLPELRLTG----TS-RTR-VSSESQ---------
A0A674MXC1_BAD-04      EQERQ--V-LQRHTLTLPELRLTG----TS-RTR-VSSESQ---------
A0A674MXC1_BAD-01      EQERQ--V-LQRHTLTLPELRLTG----TS-RTR-VSSESQ---------
A0A671TL42_BAD-01      EEGQQ--V-SQRHALTLPELRMAG-------RIR-LNSESH---------
A0A3Q3AEL8_BAD-02      GPEDG-----VRQRLTLPELR-HS----KNGRLR-VNSESL---------
A0A3Q3AEL8_BAD-01      GPEDG-----VRQRLTLPELR-HS----KNGRLR-VNSESL---------
G3Q8B3_BAD-01          GQEQQ--R-LQRHTLTLPELRLSG----RKSQRI-VEKE-----------
A0A3Q2Y0E4_BAD-01      EKEQEQCL-RQGLRLTLPELPMEA----MSGRIR-LNSESH---------
A0A3Q3R5S3_BAD-01      SQEQQ--V-PPCHSLTLPELRMAA----TS-RNR-VSSESN---------
A0A3Q3RXS8_BAD-02      RQEQQ--V-SQRHALALPELRTTA----SN-RIR-L--------------
A0A3Q3RXS8_BAD-01      RQEQQ--V-SQRHALALPELRTTA----SN-RIR-L--------------
A0A3Q0QNQ2_BAD-02      SFLLL--VSVISFFWSLPKAFSR---------------------------
A0A3Q3WTY4_BAD-01      EQEQQ--V-FQRHTLTLPELRMA---------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      --------------------------------------------------
A0A670YRG7_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      ----------------VYN-INRWEDNENQ--------------------
A0A4W4DXF5_BAD-01      ----------------AYT-VSHWEDTESQ--------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
A0A674I2R9_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A6I8PXS6_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      --------------------------------------------------
A0A673J9C6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      --------------------------------------------------
A0A674DKC6_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-01      ----------------VCS-QVGRQDNTEF--------------------
A0A3B4DUY7_BAD-01      ----------------VYT-VSRWQDNED---------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A674AVP9_BAD-01      ----------------VCSQVGKREDTEFQ--------------------
A0A1S3L0Z2_BAD-01      ----------------VCSQVGKREDTEFQ--------------------
B5XEF1_BAD-01          ----------------VRSQVGKREDTEFQ--------------------
A0A4W5MZR2_BAD-01      ----------------VCSQVGKRENTEFQ--------------------
A0A060W8W7_BAD-01      ----------------VCSQVGKREDTEFQ--------------------
E7FBJ6_BAD-01          ----------------VYT-VSRWQDTETQ--------------------
A0A673J5Q9_BAD-01      ----------------VYT-VSRWQEAEPQ--------------------
A0A671PX91_BAD-01      ----------------VYT-VSRWQEAEPQ--------------------
A0A672LB88_BAD-01      ----------------VYT-VSRWQEAEPQ--------------------
A0A673I6H5_BAD-01      ----------------VYM-VSRWQEAVPQ--------------------
A0A671SBB4_BAD-01      ----------------VYM-VSRWQEAEPQ--------------------
A0A672R7P6_BAD-01      ----------------VYM-VSRWQEAEPQ--------------------
A0A3P8Y761_BAD-02      ----------------VFA-TSGGERSGEL--------------------
A0A3B5L9R9_BAD-01      ---------------------------VEL--------------------
H3D8J8_BAD-01          ----------------ASA-VSRD---EEL--------------------
A0A6F9CQZ0_BAD-02      ----------------AFS-TSRGKRNGEL--------------------
A0A6F9CA11_BAD-02      ----------------A----------QEL--------------------
A0A1S3N9Q3_BAD-01      ----------------A----------QEL--------------------
A0A3Q2QC80_BAD-01      ----------------AST-ISRE---EEL--------------------
A0A3Q3FKT9_BAD-02      ----------------AYT-VSRD---EEL--------------------
A0A3Q3FKT9_BAD-03      ----------------AYT-VSRD---EEL--------------------
A0A667ZNC6_BAD-01      ----------------VST-VSKD---EEL--------------------
A0A3P9B2E4_BAD-01      ----------------TSS-IARD---EEL--------------------
A0A668V3Q4_BAD-01      ----------------TSS-VARD---EDL--------------------
I3K7B6_BAD-01          ----------------TSS-VARD---EDL--------------------
A0A3Q3C680_BAD-01      ----------------TSS-IARD---EEL--------------------
A0A3P8QRJ7_BAD-01      ----------------TSS-IARD---EEL--------------------
A0A3Q4GGN3_BAD-01      ----------------TSS-IARD---EEL--------------------
A0A3B4GXJ6_BAD-01      ----------------TSS-IARD---EEL--------------------
A0A3Q2D5S0_BAD-01      ----------------A---FTRE---EE---------------------
A0A3Q0QNQ2_BAD-01      ----------------TSS-VSRD---EEL--------------------
A0A3P8WI83_BAD-01      ----------------AST-ISRE---EAF--------------------
A0A3P8WI83_BAD-02      ----------------AST-ISRE---EAF--------------------
A0A3P9HNZ2_BAD-01      ----------------AST-YSRD---EDL--------------------
A0A3B3BQF7_BAD-01      ----------------VST-YSRD---EDL--------------------
A0A4W6EMZ7_BAD-02      ----------------AST-ASRD---EGL--------------------
A0A672JQ68_BAD-01      ----------------AST-VSRD---EEL--------------------
A0A2U9BAC9_BAD-01      ----------------AST-LSRD---EEL--------------------
A0A4W6EMZ7_BAD-01      ----------------AST-ASRD---EGL--------------------
A0A3B4VFC5_BAD-01      ----------------TST-VSRD---EEF--------------------
A0A3B4W9T1_BAD-01      ----------------TST-VSRD---EEF--------------------
A0A3Q1K1C7_BAD-01      ----------------AST-VYRD---EEL--------------------
A0A3Q1K1C7_BAD-02      ----------------AST-VYRD---EEL--------------------
A0A672YF93_BAD-01      ----------------VSN-VTRD---EEL--------------------
A0A3Q1GWH9_BAD-01      ----------------AST-LSRD---EEL--------------------
A0A3Q1CPU7_BAD-01      ----------------AST-LSRD---EEL--------------------
A0A3P8TWH6_BAD-01      ----------------AST-LSRD---EEL--------------------
A0A3Q3FKT9_BAD-01      ------------------A-YTVSRDEEL---------------------
A0A3B1IH05_BAD-01      ------QE------------------------------------------
A0A5F8GA49_BAD-01      ------HE--------GAG-DRRPRLISYPPLREGPAVEVGPE-------
H3ANP3_BAD-03          ------YG-WVKLRKRNNM-EILGRPS-----------------------
H3ANP3_BAD-04          ------WG-FT-----DNM-EILGRPS-----------------------
H3ANP3_BAD-01          ----------T-----DNM-EILGRPS-----------------------
H3ANP3_BAD-02          ----------T-----DNM-EILGRPS-----------------------
A0A4X2KAA5_BAD-01      ------EGAGA-----GAG-DRRPRLISYPPL----------------RE
G3VRY3_BAD-01          ------EGAGA-----G-----RPRLISYPPL----------------RE
G3VRY3_BAD-02          ------EKGGA-----Q-----KSQTHVSKELKASASQGRLGKGSFEGRE
A0A672V9F8_BAD-01      ----------------------PPSPLWGCPRPP----------CFVGGG
A0A674GQ16_BAD-01      ----------------------TPKAIFGGPLTPLPPQRRGPGCCRSGGG
A0A6I8NVP2_BAD-01      LPPRLPPATGP-----RAK-EPSGRLNSEP--------------------
G3TP47_BAD-01          ------HG-GA-----AAV-ETRSRHSSYP--------------------
Q61337_BAD-05          ------HG-GA-----GAM-ETRSRHSSYP--------------------
A0A287CT05_BAD-02      ------HG-GA-----GAT-ETRSRHSSYP--------------------
A0A287CT05_BAD-01      ------HG-GA-----GAT-ETRSRHSSYP--------------------
Q61337_BAD-04          ------HG-GA-----GAM-ETRSRHSSYP--------------------
Q61337_BAD-03          ------HG-GA-----GAM-ETRSRHSSYP--------------------
Q61337_BAD-06          ------HG-GA-----GAM-ETRSRHSSYP--------------------
Q61337_BAD-02          ------HG-GA-----GAM-ETRSRHSSYP--------------------
Q61337_BAD-01          ------HG-GA-----GAM-ETRSRHSSYP--------------------
G5B6Q3_BAD-01          ------HG-GT-----GAT-ETRSRHSSYP--------------------
G5B6Q3_BAD-02          ------HG-GT-----GAT-ETRSRHSSYP--------------------
A0A2I3TBK7_BAD-01      ------HG---------------EGT--SS--------------------
A0A2R8Z674_BAD-02      ------HG---------------EGT--SS--------------------
A0A2I2YFH2_BAD-03      ------HG---------------EGT--SS--------------------
Q92934_BAD-03          ------HG---------------EGT--SS--------------------
A0A2K5M0A7_BAD-02      ------HG---------------GT---SS--------------------
A0A2K5XJR2_BAD-02      ------HG---------------GT---SS--------------------
A0A096MLD5_BAD-03      ------HG---------------GT---SS--------------------
A0A2K5VCA1_BAD-02      ------HG---------------GT---SS--------------------
A0A2K6E7I4_BAD-02      ------HG---------------GT---SS--------------------
A0A2K5PDB1_BAD-02      ------HG---------------GT---SS--------------------
A0A2K5E6A6_BAD-02      ------HG---------------GT---SS--------------------
A0A2K6TG62_BAD-02      ------HG---------------GT---SS--------------------
A0A2K5HKU7_BAD-02      ------HG---------------GRAWYSP--------------------
A0A2K6N196_BAD-02      ------HG---------------GRAWYYP--------------------
A0A2K6PUL3_BAD-02      ------HG---------------GRAWYYP--------------------
A0A2K5M0A7_BAD-03      ------HG---------------GGAWYSP--------------------
A0A2K5VCA1_BAD-03      ------HG---------------GRAWYSP--------------------
A0A2K5XJR2_BAD-03      ------HG---------------GGAWYSP--------------------
A0A096MLD5_BAD-02      ------HG---------------GRAWYSP--------------------
A0A2K6E7I4_BAD-03      ------HG---------------GRAWYSP--------------------
A0A2I2YFH2_BAD-04      ------HG---------------GRTSYSP--------------------
Q92934_BAD-04          ------HG---------------GRTSYSP--------------------
A0A2I3TBK7_BAD-03      ------HG---------------GRTSYSP--------------------
A0A2R8Z674_BAD-03      ------HG---------------GRTSYSP--------------------
A0A2K5E6A6_BAD-03      ------HG---------------GE--YST--------------------
A0A2K5PDB1_BAD-03      ------HG------------------------------------------
A0A2K6TG62_BAD-03      ------HG------------------------------------------
G1P8C5_BAD-01          ------HD-GA-----GSV-EPRSRHSSYP--------------------
A0A452ER54_BAD-02      ------HG-GT-----GAV-ETRSRHSSYP--------------------
W5P8G9_BAD-01          ------HG-GT-----GAV-ETRSRHSSYP--------------------
Q61337_BAD-07          ------HG-GA-----GAM-ETRSRHSSYP--------------------
O35147_BAD-01          ------HG-GA-----GTM-ETRSRHSSYP--------------------
F7DN67_BAD-01          ------HG-GA-----GAV-ETRSRHSSYP--------------------
Q45KI9_BAD-01          ------HG-GA-----GA--ETRSRHSSFP--------------------
A0A3Q7SWS0_BAD-01      ------HG-GA-----GA--ETRSRHSSFP--------------------
H0WVR2_BAD-01          ------HGAGP-----GAV-ETRSRHSSYP--------------------
A0A2K6GWV0_BAD-01      ------HG-GA-----GSV-ETRSRHSSYP--------------------
H0V608_BAD-01          ------HG-GT-----VAM-ETRSRHRSYP--------------------
A0A2K5PDB1_BAD-01      ------HG-GA-----GAV-ETRSRHRSYP--------------------
U3F2S3_BAD-01          ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K5E6A6_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K6TG62_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A0D9R491_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K5M0A7_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K5VCA1_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A1D5QBW1_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K6E7I4_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K5XJR2_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A096MLD5_BAD-04      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K6N196_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K6PUL3_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2K5HKU7_BAD-01      ------HG-GA-----GAV-ETRSRHSSHP--------------------
B4DZQ9_BAD-01          ------HG-GA-----GAV-EIRSRHSSYP--------------------
A0A096MLD5_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2I2YFH2_BAD-01      ------HG-GA-----GAV-EIRSRHSSYP--------------------
A0A2I2YFH2_BAD-02      ------HG-GA-----GAV-EIRSRHSSYP--------------------
Q92934_BAD-01          ------HG-GA-----GAV-EIRSRHSSYP--------------------
Q92934_BAD-02          ------HG-GA-----GAV-EIRSRHSSYP--------------------
A0A2I3TBK7_BAD-02      ------HG-GA-----GAV-EIRSRHSSYP--------------------
A0A2R8Z674_BAD-01      ------HG-GA-----GAV-EIRSRHSSYP--------------------
A0A2J8TYJ3_BAD-01      ------HG-GA-----GAV-EIRSRHSSYP--------------------
G1MI17_BAD-01          ------HG-GA-----GAV-EPRSRHSSYP--------------------
A0A4X1VE31_BAD-02      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A4X1VE31_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A287AEF3_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A4X1VE31_BAD-03      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A671ELU4_BAD-01      ------HG-GA-----GSV-EPRSRHSSYP--------------------
A0A452ER54_BAD-01      ------HG-GT-----GAV-ETRSRHSSYP--------------------
A0A452RJM6_BAD-01      ------HG-GA-----GAV-EPRSRHSSYP--------------------
A0A384DJL2_BAD-01      ------HG-GA-----GAV-EPRSRHSSYP--------------------
M3YNE7_BAD-01          ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A667H8Z9_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A673V6P8_BAD-01      ------HG-GA-----GAV-ETRSRHSSYP--------------------
A0A2Y9EHU3_BAD-01      ------HG-GT-----GAV-DTRSRHSSYS--------------------
A0A4W2C9A8_BAD-01      ------HG-GT-----GAV-ETRSRHSSYR--------------------
A0A4W2C9A8_BAD-01      ------HG-GT-----GAV-ETRSRHSSYR--------------------
F1MUT9_BAD-01          ------HG-GT-----GAV-ETRSRHSSYR--------------------
Q3SYZ0_BAD-01          ------HG-GT-----GAV-ETRSRHSSYR--------------------
A0A6F9BAV3_BAD-01      ----------------VCS-QVGKREDTEF--------------------
A0A3P9A5G8_BAD-02      ----------------VCS-QVGRQDNTEF--------------------
A0A4W5R1T6_BAD-01      ----------------VFS-HVGRRDDTEF--------------------
A0A060W8P9_BAD-01      ----------------VCS-QVGRRDDTEF--------------------
B5X1T1_BAD-01          ----------------VCS-QVGRRDNTEF--------------------
A0A673ZHY7_BAD-01      ----------------VCS-QVGRREDTEF--------------------
A0A671NP27_BAD-01      ----------------GRH-RNLSMNDENL--------------------
A0A672SAE4_BAD-01      ----------------GRH-RNLSMNDEDL--------------------
A0A672SAE4_BAD-02      ----------------GRH-RNLSMNDEDL--------------------
A0A671RUV0_BAD-01      ----------------GRH-RNLSMNDEDL--------------------
A0A673HRQ3_BAD-01      ----------------GRH-RNLSMNDEDL--------------------
A0A672RGH0_BAD-01      ----------------GRH-RNLSMNDEDL--------------------
Q4V925_BAD-03          ----------------GRQ-RNLSMNEEDL--------------------
Q4V925_BAD-02          ----------------GRQ-RNLSMNEEDL--------------------
A7MCM4_BAD-01          ----------------GRQ-RNLSMNEEDL--------------------
Q4V925_BAD-01          ----------------GRQ-RNLSMNEEDL--------------------
Q4V925_BAD-04          ----------------GRQ-RNLSMNEEDL--------------------
A0A3B3QX41_BAD-01      ------------------V-SSIRSEDLDF--------------------
A0A3P8Y761_BAD-01      ----------------VFA-TSGGERSGEL--------------------
A0A4W5JLL9_BAD-01      --------------------------AQEL--------------------
A0A3B5Q2N7_BAD-01      ------------------A-STISR-EVEL--------------------
A0A087X8P8_BAD-01      ------------------A-STISR-EEEL--------------------
A0A3B3UA11_BAD-01      ------------------A-STISR-EEEL--------------------
A0A3B3YFR1_BAD-01      ------------------A-STISR-EEEL--------------------
A0A3P9Q7C3_BAD-01      ------------------A-STISR-EEEL--------------------
A0A3B3HDU2_BAD-01      ------------------A-STYSR-DEDL--------------------
A0A3P9KSL7_BAD-02      ------------------A-STYSR-DEDL--------------------
A0A3P9KSL7_BAD-01      ------------------A-STYSR-DEDL--------------------
A0A3B5BAL2_BAD-01      ------------------A-TTVSR-DEEL--------------------
A0A665TUH3_BAD-01      ------------------T-STGSR-DEDF--------------------
A0A674MXC1_BAD-02      ------------------A-STFSR-EEEL--------------------
A0A674MXC1_BAD-03      ------------------A-STFSR-EEEL--------------------
A0A674MXC1_BAD-04      ------------------A-STFSR-EEEL--------------------
A0A674MXC1_BAD-01      ------------------A-STFSR-EEEL--------------------
A0A671TL42_BAD-01      ------------------A-STVSR-DVEL--------------------
A0A3Q3AEL8_BAD-02      ------------------S-STSSRGEEEL--------------------
A0A3Q3AEL8_BAD-01      ------------------S-STSSRGEEEL--------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      ------------------A-LAVSR-EEEF--------------------
A0A3Q3R5S3_BAD-01      ------------------A-STVQ--------------------------
A0A3Q3RXS8_BAD-02      --------------------------SSES--------------------
A0A3Q3RXS8_BAD-01      --------------------------SSES--------------------
A0A3Q0QNQ2_BAD-02      --------------------------DEEL--------------------
A0A3Q3WTY4_BAD-01      --------------------------GRTL--------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          ------------------------------------MEEEPSPFRGRSRS
A0A2I3H4B2_BAD-01      ------------------------------------MGEEPSPFRGRSRS
Q92934_BAD-06          ------------------------------------MGEEPSPFRGRSRS
Q92934_BAD-05          ------------------------------------MGEEPSPFRGRSRS
A0A670JUY4_BAD-01      -----------NN----------------IRKD---WTLALGTFRARSRS
A0A670YRG7_BAD-01      --------IGSDQ----------------LDSE---TSDEVGAFRARSRS
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------DGASA----------------ED-G---GVGDGAPFRGRSQS
A0A4W4DXF5_BAD-01      --------DGVSA----------------EEGG---GACEGAPFRGRSQS
A0A452IFQ4_BAD-01      -----------------------------EPEV---QDEPGGAFRARSRS
A0A674I2R9_BAD-01      -----------------------------EPEV---QDEPGGAFRARSRS
C1C3S9_BAD-01          -----------------------------ETDS---VGEL-QHFRSRSRS
A0A6I8PXS6_BAD-01      -----------------------------ETDK---VGEL-HPFRSRSRS
A0A337SAW2_BAD-01      --------GGAGAVETRSRHSSYPAGTEEDEGT---EEEEPSPFRGRSRS
A0A673J9C6_BAD-01      --------LETGA----------------ADEG---DLVGGDPFRPRSRS
A0A4W5JLL9_BAD-02      --------QGRGP----------------GVEG---MPTDGASFRVRSQS
A0A674DKC6_BAD-01      --------QGRGP----------------GVEG---VPTDGASFRGRSQS
A0A3P9A5G8_BAD-01      --------QVAMT----------------PTEE---SGGDAAPFRGRSQS
A0A3B4DUY7_BAD-01      ----------GLL----------------AEDG---GAGDGAPFRGRSQS
A0A4W4HE29_BAD-01      ------------------------------------QDSGAESFRRRSRS
A0A3B4CPH6_BAD-01      --------QESGA----------------VRHG--DGAADGDSFRRRCRS
A0A674AVP9_BAD-01      --------DVMTP----------------TEEG---G-GDGASFRGRSQS
A0A1S3L0Z2_BAD-01      --------DVMTP----------------TEEG---G-GDGASFRGRSQS
B5XEF1_BAD-01          --------DVMTP----------------TEEG---G-GDGASFRGRSQS
A0A4W5MZR2_BAD-01      --------DVMTP----------------TEEG---G-GDGASFRGRSQS
A0A060W8W7_BAD-01      --------DVMTP----------------TEDG---G-GDGASFRGRSQS
E7FBJ6_BAD-01          --------DGASV----------------EEN------GDGLPFRGRSQS
A0A673J5Q9_BAD-01      --------DGALA----------------EENG---GTGDGLPFRGRSQS
A0A671PX91_BAD-01      --------DGALA----------------EENG---GTGDGLPFRGRSQS
A0A672LB88_BAD-01      --------DGALV----------------EENG---GTGDGLPFRGRSQS
A0A673I6H5_BAD-01      --------DGASA----------------EENG---GTGDGLPFRGRSQS
A0A671SBB4_BAD-01      --------DGASA----------------EENG---GTGDGLPFRGRSQS
A0A672R7P6_BAD-01      --------DGASA----------------EENG---GTGDGLPFRGRSQS
A0A3P8Y761_BAD-02      --------QGLGQ----------------GLNC---VATEGLPFRVRSQS
A0A3B5L9R9_BAD-01      --------QARGE----------------EEVG---TPTEGFPFRGRSLS
H3D8J8_BAD-01          --------QGNGD----------------DEAG---TPTDGAPFRGRSRS
A0A6F9CQZ0_BAD-02      --------QGRGP----------------GVDG---IPTDGAPFRVRSQS
A0A6F9CA11_BAD-02      --------QGSGP----------------GVDG---VPTDGASFRVRSQS
A0A1S3N9Q3_BAD-01      --------QGRGP----------------GVEG---MPTDGASFRGRSQS
A0A3Q2QC80_BAD-01      --------QGRAE----------------EEAG---TPTEGLPFRNRSNS
A0A3Q3FKT9_BAD-02      --------QARGE----------------EEAG---TPTEGAPFRGRSKS
A0A3Q3FKT9_BAD-03      --------QARGE----------------EEAG---TPTEGAPFRGRSKS
A0A667ZNC6_BAD-01      --------LARGE----------------GEDG------DGAPFRGRSQS
A0A3P9B2E4_BAD-01      --------MARGE----------------DEVC---TPTEGDPFRRRSKS
A0A668V3Q4_BAD-01      --------MARGE----------------DEVC---TPTEGDPFRRRSKS
I3K7B6_BAD-01          --------MARGE----------------DEVC---TPTEGDPFRRRSKS
A0A3Q3C680_BAD-01      --------MARGE----------------DEVC---TPTEGDPFRRRSKS
A0A3P8QRJ7_BAD-01      --------MARGE----------------DEVC---TPTEGDPFRRRSKS
A0A3Q4GGN3_BAD-01      --------MARGE----------------DEVC---TPTEGDPFRRRSKS
A0A3B4GXJ6_BAD-01      --------MARGE----------------DEVC---TPTEGDPFRRRSKS
A0A3Q2D5S0_BAD-01      ---------ARGE----------------EEVG---TPTEGYPFRGRSNS
A0A3Q0QNQ2_BAD-01      --------VVRGE----------------DEIC---TPTEGDPFRRRSKS
A0A3P8WI83_BAD-01      --------QSWGE----------------EEAG---TPTEGAPFRGRSRS
A0A3P8WI83_BAD-02      --------QSWGE----------------EEAG---TPTEGAPFRGRSRS
A0A3P9HNZ2_BAD-01      --------AR--E----------------DEAG---TPTDGLAFRGRSKS
A0A3B3BQF7_BAD-01      --------PR--E----------------DEAG---TPTDGLAFRGRSKS
A0A4W6EMZ7_BAD-02      --------QVRGE----------------EEAG---TPTEGAPFRGRSKS
A0A672JQ68_BAD-01      --------QARAE----------------EEVG---TPTEGAPFRGRSKS
A0A2U9BAC9_BAD-01      --------LTRWD----------------EEAG---TPTDGAPFRGRSKS
A0A4W6EMZ7_BAD-01      --------QVRGE----------------EEAG---TPTEGAPFRGRSKS
A0A3B4VFC5_BAD-01      --------QARGE----------------EEAG---TPTEGAPFRGRSKS
A0A3B4W9T1_BAD-01      --------QARGE----------------EEAG---TPTEGAPFRGRSKS
A0A3Q1K1C7_BAD-01      --------QAKAD----------------EEAG---TPTDGAPFRARSKS
A0A3Q1K1C7_BAD-02      --------QAKAD----------------EEAG---TPTDGAPFRARSKS
A0A672YF93_BAD-01      --------QMRGE----------------DEAS---TPTEGAPFRARSKS
A0A3Q1GWH9_BAD-01      --------QAKGE----------------EEAG---TPTEGAPFRARSKS
A0A3Q1CPU7_BAD-01      --------QARGE----------------EEAG---TPTDGAPFRARSKS
A0A3P8TWH6_BAD-01      --------QARGE----------------EEAG---TPTDGAPFRARSKS
A0A3Q3FKT9_BAD-01      --------QARGE----------------EEAG---TPTEGAPFRGRSKS
A0A3B1IH05_BAD-01      --------SGAGR----------------HEDG----ARDGDSFRRRSRS
A0A5F8GA49_BAD-01      --------AGAQA----------------ERAE---AEEDRGLFRSRSSS
H3ANP3_BAD-03          --------SESQI----------------SDSE---SLDELGPFRTRSRS
H3ANP3_BAD-04          --------SESQI----------------SDSE---SLDELGPFRTRSRS
H3ANP3_BAD-01          --------SESQI----------------SDSE---SLDELGPFRTRSRS
H3ANP3_BAD-02          --------SESQI----------------SDSE---SLDELGPFRTRSRS
A0A4X2KAA5_BAD-01      GPGEASPEAEAEA----------------DFFE---GEEERSLFRSRSSS
G3VRY3_BAD-01          GSREASPEAEAEA----------------EQSE---GEEERGLFRGRSSS
G3VRY3_BAD-02          GSREASPEAEAEA----------------EQSE---GEEERGLFRGRSSS
A0A672V9F8_BAD-01      VQARARLGSEGER----------------G--P---GEPPPGV-RGRSRS
A0A674GQ16_BAD-01      AGG----GGDPQI----------------GAPP---GDPPPA--RGRSRS
A0A6I8NVP2_BAD-01      --------PDSEA----------------EEH---------SPFRGRSHS
G3TP47_BAD-01          --------AGSDE----------------AEGL---EEDP-SPFRGRSLS
Q61337_BAD-05          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
A0A287CT05_BAD-02      --------ADTDL----------------DEGM---EEEP-SPFRGRSRS
A0A287CT05_BAD-01      --------ADTDL----------------DEGM---EEEP-SPFRGRSRS
Q61337_BAD-04          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
Q61337_BAD-03          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
Q61337_BAD-06          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
Q61337_BAD-02          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
Q61337_BAD-01          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
G5B6Q3_BAD-01          --------TGMEE----------------EAGM---KEEP-SPFRGRSRS
G5B6Q3_BAD-02          --------TGMEE----------------EAGM---KEEP-SPFRGRSRS
A0A2I3TBK7_BAD-01      --------PEERG----------------HSNP---DAAKLQLDASLPVL
A0A2R8Z674_BAD-02      --------PEERG----------------HSNA---DAAKLQLDASLPVL
A0A2I2YFH2_BAD-03      --------PEERR----------------HSNA---DAAKLQLDASLPVL
Q92934_BAD-03          --------PEERG----------------HSNA---DAAKLQLDASLPVL
A0A2K5M0A7_BAD-02      --------PEERG----------------HSDA---DAAKLQLDASLPVL
A0A2K5XJR2_BAD-02      --------PEERG----------------HSDA---DAAKLQLDASLPVL
A0A096MLD5_BAD-03      --------PEERG----------------HSDA---DAAKLQLDASLPVL
A0A2K5VCA1_BAD-02      --------PEERG----------------HSDA---DAAKLQLDASLPVL
A0A2K6E7I4_BAD-02      --------PEERG----------------HSDA---DAAKLQLDASLPVL
A0A2K5PDB1_BAD-02      --------PEERG----------------HSNA---DAAKRQLDASHPVL
A0A2K5E6A6_BAD-02      --------PEERG----------------HSNA---DAAKLQLDASHPVL
A0A2K6TG62_BAD-02      --------PEERG----------------HSNA---DAAKLQLDASHPVL
A0A2K5HKU7_BAD-02      --------S-ESE----------------DSEN---PSARMLTEASAGMS
A0A2K6N196_BAD-02      --------A-ESE----------------DSEN---PSARMLAEASAGMS
A0A2K6PUL3_BAD-02      --------A-ESE----------------DSEN---PSARMLAEASAGMS
A0A2K5M0A7_BAD-03      --------SWESE----------------DSEN---PSARMLAEASARMS
A0A2K5VCA1_BAD-03      --------SWESE----------------DSEN---PSARMLAEASARMS
A0A2K5XJR2_BAD-03      --------SWESE----------------DSEN---PSARMLAEASARMS
A0A096MLD5_BAD-02      --------SWESE----------------DSEN---PSARMLAEASAPMS
A0A2K6E7I4_BAD-03      --------SWESE----------------DSEN---PSARMLAEASARMS
A0A2I2YFH2_BAD-04      --------SWESE----------------DSEN---PSAGMLAEASAGMS
Q92934_BAD-04          --------SWESE----------------DSEN---PSAGMLAEASAGMS
A0A2I3TBK7_BAD-03      --------SWESE----------------DSEN---PSAGMLAEASAGMS
A0A2R8Z674_BAD-03      --------SWESE----------------DSEN---PSAGMLAEASAGMS
A0A2K5E6A6_BAD-03      --------CASAS----------------SSEN---PSARMLSKASAGMS
A0A2K5PDB1_BAD-03      -------------------------------EN---PSARMLSKTSAGMS
A0A2K6TG62_BAD-03      -------------------------------EN---PSAKMLSKASAGMS
G1P8C5_BAD-01          --------TGTEE----------------DDDT---EEGEPSPFRGRSRS
A0A452ER54_BAD-02      --------AGPED----------------DEGT---EEEDLGPFRGRSRS
W5P8G9_BAD-01          --------AGPED----------------DEGT---EEEDLGPFRGRSRS
Q61337_BAD-07          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
O35147_BAD-01          --------AGTEE----------------DEGM---EEEL-SPFRGRSRS
F7DN67_BAD-01          --------EGTED----------------EGME---GEEP-GPFRGRSRS
Q45KI9_BAD-01          --------AGTDE----------------DEGM---EEEELSPFRGRSSS
A0A3Q7SWS0_BAD-01      --------AGTDE----------------DEGM---EEEELSPFRGRSSS
H0WVR2_BAD-01          --------AGTEE----------------DEGI----EEP-SPFRGRSRS
A0A2K6GWV0_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
H0V608_BAD-01          --------AGTEE----------------EEGM---EEEL-SPFRGRSRS
A0A2K5PDB1_BAD-01      --------AGTEE----------------DEGM---EEEP-STFRGRSRS
U3F2S3_BAD-01          --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K5E6A6_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K6TG62_BAD-01      --------AGTEG----------------DEGM---EEEP-SPFRGRSRS
A0A0D9R491_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K5M0A7_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K5VCA1_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A1D5QBW1_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K6E7I4_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K5XJR2_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A096MLD5_BAD-04      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K6N196_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K6PUL3_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2K5HKU7_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
B4DZQ9_BAD-01          --------AGTED----------------DEGM---GEEP-SPFRGRSRS
A0A096MLD5_BAD-01      --------AGTEE----------------DEGM---EEEP-SPFRGRSRS
A0A2I2YFH2_BAD-01      --------AGTED----------------DEGM---GEEP-SPFRGRSRS
A0A2I2YFH2_BAD-02      --------AGTED----------------DEGM---GEEP-SPFRGRSRS
Q92934_BAD-01          --------AGTED----------------DEGM---GEEP-SPFRGRSRS
Q92934_BAD-02          --------AGTED----------------DEGM---GEEP-SPFRGRSRS
A0A2I3TBK7_BAD-02      --------AGTED----------------DEGM---GEEP-SPFRGRSRS
A0A2R8Z674_BAD-01      --------AGTED----------------DEGM---GEEP-SPFRGRSRS
A0A2J8TYJ3_BAD-01      --------AGTED----------------DEGM---GEEP-SPFRGRSRS
G1MI17_BAD-01          --------AGTEE----------------DEGL---EEEELSPFRGRSSS
A0A4X1VE31_BAD-02      --------EGTEE----------------DEGT---EDEELSPFRGRSLS
A0A4X1VE31_BAD-01      --------EGTEE----------------DEGT---EDEELSPFRGRSLS
A0A287AEF3_BAD-01      --------EGTEE----------------DEGT---EDEELSPFRGRSLS
A0A4X1VE31_BAD-03      --------EGTEE----------------DEGT---EDEELSPFRGRSLS
A0A671ELU4_BAD-01      --------AGTEE----------------DEEM---EEEEPSPFRGRSRS
A0A452ER54_BAD-01      --------AGPED----------------DEGT---EEEDLGPFRGRSRS
A0A452RJM6_BAD-01      --------AGTEE----------------DEGL---EEEELSPFRGRSSS
A0A384DJL2_BAD-01      --------AGTEE----------------DEGL---EEEELSPFRGRSSS
M3YNE7_BAD-01          --------AGTEE----------------DEGM---EEEELSPFRGRSRS
A0A667H8Z9_BAD-01      --------AGTEE----------------DEGT---EEEEPSPFRGRSRS
A0A673V6P8_BAD-01      --------AGTEE----------------DEGT---EEEEPSPFRGRSRS
A0A2Y9EHU3_BAD-01      --------AGTED----------------DEGT---EEEEPSPFRGRSRS
A0A4W2C9A8_BAD-01      --------AGPED----------------NEET---EEEDLGPFRGRSRS
A0A4W2C9A8_BAD-01      --------AGPED----------------NEET---EEEDLGPFRGRSRS
F1MUT9_BAD-01          --------AGPED----------------NEET---EEEDLGPFRGRSRS
Q3SYZ0_BAD-01          --------AGPED----------------NEET---EEEDLGPFRGRSRS
A0A6F9BAV3_BAD-01      --------QDVMT----------------PTEE---GGGDGASFRGRSQS
A0A3P9A5G8_BAD-02      --------QVAMT----------------PTEE---SGGDAAPFRGRSQS
A0A4W5R1T6_BAD-01      --------QDAMT----------------PTEE---GGGDGAPFRSRSQS
A0A060W8P9_BAD-01      --------QDAIT----------------PTEE---GGGDGAPFRSRSQS
B5X1T1_BAD-01          --------QDVMT----------------PTEE---GGGDGAPFRSRSQS
A0A673ZHY7_BAD-01      --------QDVMT----------------PTEE---GGGDGAPFRSRSQS
A0A671NP27_BAD-01      --------LETGA----------------ADEG---DLVGSDPFRPRSRS
A0A672SAE4_BAD-01      --------LETGA----------------ADEG---DLVGGDPFRPRSRS
A0A672SAE4_BAD-02      --------LETGA----------------ADEG---DLVGGDPFRPRSRS
A0A671RUV0_BAD-01      --------LETGA----------------ADEG---DLVGGDPFRPRSRS
A0A673HRQ3_BAD-01      --------LETGA----------------ADEG---DLVGGDPFRPRSRS
A0A672RGH0_BAD-01      --------LETGA----------------ADEG---DLVGGDPFRPRSRS
Q4V925_BAD-03          --------LETGV----------------AEDP---HML-GDPFRPRSRS
Q4V925_BAD-02          --------LETGV----------------AEDP---HML-GDPFRPRSRS
A7MCM4_BAD-01          --------LETGV----------------AEDP---HML-GDPFRPRSRS
Q4V925_BAD-01          --------LETGV----------------AEDP---HML-GDPFRPRSRS
Q4V925_BAD-04          --------LETGV----------------AEDP---HML-GDPFRPRSRS
A0A3B3QX41_BAD-01      --------GEGGA----------------SEEGGGVCPGDGTPFRGRSRS
A0A3P8Y761_BAD-01      --------QGLGQ----------------GLNC---VATEGLPFRVRSQS
A0A4W5JLL9_BAD-01      --------QGRGP----------------GVEG---MPTDGASFRVRSQS
A0A3B5Q2N7_BAD-01      --------QARGE----------------EEVG---TPTEGFPFRGRSLS
A0A087X8P8_BAD-01      --------QARGE----------------EEVG---TPTEGFPFRGRSNS
A0A3B3UA11_BAD-01      --------QARGE----------------EEVG---TPTEGFPFRGRSNS
A0A3B3YFR1_BAD-01      --------QARGE----------------EEVG---TPTEGFPFRGRSNS
A0A3P9Q7C3_BAD-01      --------QARGE----------------EEVG---TPTEGFPFRVRSNS
A0A3B3HDU2_BAD-01      --------AR--E----------------DEAG---TPTDGLAFRGRSKS
A0A3P9KSL7_BAD-02      --------AR--E----------------DEAG---TPTDGLAFRGRSKS
A0A3P9KSL7_BAD-01      --------AR--E----------------DEAG---TPTDGLAFRGRSKS
A0A3B5BAL2_BAD-01      --------QARGE----------------EEAG---TPTDGAPFRGRSKS
A0A665TUH3_BAD-01      --------LARGD----------------DEAG---TPTDGAPFRGRSKS
A0A674MXC1_BAD-02      --------QGNGE----------------DEAG---TPTEGAPFRGRSRS
A0A674MXC1_BAD-03      --------QGNGE----------------DEAG---TPTEGAPFRGRSRS
A0A674MXC1_BAD-04      --------QGNGE----------------DEAG---TPTEGAPFRGRSRS
A0A674MXC1_BAD-01      --------QGNGE----------------DEAG---TPTEGAPFRGRSRS
A0A671TL42_BAD-01      --------QARGE----------------DEAG---TPTDGAPFRGRSKS
A0A3Q3AEL8_BAD-02      --------PARAD----------------DEPG---TPTEGYPFRGRSKS
A0A3Q3AEL8_BAD-01      --------PARAD----------------DEPG---TPTEGYPFRGRSKS
G3Q8B3_BAD-01          --------EELWL----------------DETG---TPTEGAPFRVRSKS
A0A3Q2Y0E4_BAD-01      --------QARVD----------------EEVG---TPTDGAPFRGRSKS
A0A3Q3R5S3_BAD-01      --------DAKSD----------------EEAG---TPTDGAPFRGRSKS
A0A3Q3RXS8_BAD-02      --------QSRVD----------------EEAG---TPTDGAPFRGRSKS
A0A3Q3RXS8_BAD-01      --------QSRVD----------------EEAG---TPTDGAPFRGRSKS
A0A3Q0QNQ2_BAD-02      --------VVRGE----------------DEIC---TPTEGDPFRRRSKS
A0A3Q3WTY4_BAD-01      --------QVKGE----------------DEAG---TPTDGAPFRGRSKS
                                                                         

Q61337_BAD-09          -----XAAQRYGR-ELRRMSDEFEGSFKF---------------------
Q2PG01_BAD-01          APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2I3H4B2_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
Q92934_BAD-06          APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
Q92934_BAD-05          APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A670JUY4_BAD-01      APPILWAAQRYGR-ELRRMSDEFHGEL-Q---------------------
A0A670YRG7_BAD-01      APPILWAAQRYGR-ELRRMSDEFHG-------------------------
Q6P7C5_BAD-01          ------HGGRFLT-------------------------------------
A0A3B1JLM2_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A4W4DXF5_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A452IFQ4_BAD-01      APPILWAAMRYGR-ELRRMSDEFDVALQV---------------------
A0A674I2R9_BAD-01      APPILWAAMRYGR-ELRRMSDEFDVALQV---------------------
C1C3S9_BAD-01          APSSLMVAARYGR-ELRRMSDEFDQIFTS---------------------
A0A6I8PXS6_BAD-01      APSS-MIATKYGR-ELRRMSDEFEKSFTG---------------------
A0A337SAW2_BAD-01      APPNLWAALRYGR-ELRRMSDEFQGSFKG---------------------
A0A673J9C6_BAD-01      APPALWAAKKYGR-QLRRMSDEFDILLDK---------------------
A0A4W5JLL9_BAD-02      APPALWAAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A674DKC6_BAD-01      APPALWAAKRYGR-QLRRMSDEFDTWLDK---------------------
A0A3P9A5G8_BAD-01      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
A0A3B4DUY7_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A4W4HE29_BAD-01      APPILWAAKKYGR-QLRKMSDEFDTLLDK---------------------
A0A3B4CPH6_BAD-01      APPALWAAKKYGR-QLRKMSDEFDTLLDK---------------------
A0A674AVP9_BAD-01      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
A0A1S3L0Z2_BAD-01      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
B5XEF1_BAD-01          APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
A0A4W5MZR2_BAD-01      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
A0A060W8W7_BAD-01      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
E7FBJ6_BAD-01          APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A673J5Q9_BAD-01      APAVLWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A671PX91_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A672LB88_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A673I6H5_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A671SBB4_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A672R7P6_BAD-01      APAALWKAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A3P8Y761_BAD-02      APPALWAAKRYGR-QLRRMSDEFDTWLDK---------------------
A0A3B5L9R9_BAD-01      APPSLWAAKKYGR-QLRRMSDEFVNLLDK---------------------
H3D8J8_BAD-01          APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A6F9CQZ0_BAD-02      APPALWAAKRYGR-QLRRMSDEFDTWLDK---------------------
A0A6F9CA11_BAD-02      APPALWAAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A1S3N9Q3_BAD-01      APPALWAAKRYGR-QLRRMSDEFDTWLDK---------------------
A0A3Q2QC80_BAD-01      APPALWAAKKYGR-QLRRMSDEFGSLLDK---------------------
A0A3Q3FKT9_BAD-02      APPALWAAKKYGR-QLRRMSDEFDILLDK---------------------
A0A3Q3FKT9_BAD-03      APPALWAAKKYGR-QLRRMSDEFDILLDK---------------------
A0A667ZNC6_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3P9B2E4_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A668V3Q4_BAD-01      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
I3K7B6_BAD-01          APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A3Q3C680_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3P8QRJ7_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3Q4GGN3_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3B4GXJ6_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3Q2D5S0_BAD-01      APPALWAAKKYGR-QLRRMSDEFVTLLDK---------------------
A0A3Q0QNQ2_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3P8WI83_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3P8WI83_BAD-02      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3P9HNZ2_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3B3BQF7_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A4W6EMZ7_BAD-02      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A672JQ68_BAD-01      APPALWAAKKYGQ-RLRRMSDEFDSLLDK---------------------
A0A2U9BAC9_BAD-01      APPALWAAMKYGQ-KLRRMSDEFDSLLDK---------------------
A0A4W6EMZ7_BAD-01      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A3B4VFC5_BAD-01      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A3B4W9T1_BAD-01      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A3Q1K1C7_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q1K1C7_BAD-02      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A672YF93_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q1GWH9_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q1CPU7_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3P8TWH6_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q3FKT9_BAD-01      APPALWAAKKYGR-QLRRMSDEFDILLDK----------GVRIKGGGGGS
A0A3B1IH05_BAD-01      APPSLWAAKKYGR-QLRKMSDEFDKGLEQ---------------------
A0A5F8GA49_BAD-01      APPILWAARRYGS-ELRRMSDEFDCSF-K---------------------
H3ANP3_BAD-03          APPNFWAARKYGQ-ELRRMSDEFDMSF-L---------------------
H3ANP3_BAD-04          APPNFWAARKYGQ-ELRRMSDEFDMSF-L---------------------
H3ANP3_BAD-01          APPNFWAARKYGQ-ELRRMSDEFDMSF-L---------------------
H3ANP3_BAD-02          APPNFWAARKYGQ-ELRRMSDEFDMSF-L---------------------
A0A4X2KAA5_BAD-01      APPILWAARRYGS-ELRRMSDEFDCTF-K---------------------
G3VRY3_BAD-01          APPILWAARHYGS-ELRRMSDEFHCTF-K---------------------
G3VRY3_BAD-02          APPILWAARHYGS-ELRRMSDEFHCTF-K---------------------
A0A672V9F8_BAD-01      APPALWAARRFGR-QLRRMSDEFQQQV-G---------------------
A0A674GQ16_BAD-01      APPVLWAAQRYGR-RLRRMSDEFQLQ------------------------
A0A6I8NVP2_BAD-01      APPILWVAQRYGR-ELRRMSDEFDCTF-Q---------------------
G3TP47_BAD-01          APPNLWAAQRYGR-ELRRMSDEFQGYF-K---------------------
Q61337_BAD-05          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
A0A287CT05_BAD-02      APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
A0A287CT05_BAD-01      APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
Q61337_BAD-04          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
Q61337_BAD-03          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
Q61337_BAD-06          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
Q61337_BAD-02          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
Q61337_BAD-01          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
G5B6Q3_BAD-01          APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
G5B6Q3_BAD-02          APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2I3TBK7_BAD-01      VGSELGQG------KLRPLPVTFAPHP-E---------------------
A0A2R8Z674_BAD-02      VGSELGQG------KLRPLPVTFAPHP-E---------------------
A0A2I2YFH2_BAD-03      VGSELGQG------KLRPLPVTFAAHP-E---------------------
Q92934_BAD-03          VGSELGQG------KLRPLPVTFAPHP-E---------------------
A0A2K5M0A7_BAD-02      VGSELGQG------KLRPLPVTFAPRP-E---------------------
A0A2K5XJR2_BAD-02      VGSELGQG------KLRPLPVTFAPRP-E---------------------
A0A096MLD5_BAD-03      VGSELGQG------KLRPLPVTFAPRP-E---------------------
A0A2K5VCA1_BAD-02      VGSELGQG------KLRTLPVTFAPRP-E---------------------
A0A2K6E7I4_BAD-02      VGSELGQG------KLRTLPVTFAPRP-E---------------------
A0A2K5PDB1_BAD-02      VGSELGQG------RIRSLPVTFAPHP-K---------------------
A0A2K5E6A6_BAD-02      VGSELGQG------RLRSLPVTFAPHP-E---------------------
A0A2K6TG62_BAD-02      VGSELGQG------RLRSLPVTFAPHP-E---------------------
A0A2K5HKU7_BAD-02      APATDSEAQHAENVKLEALGL-WRPGV-A---------------------
A0A2K6N196_BAD-02      APATDSEAQLAENVKLEALGL-WRPGV-A---------------------
A0A2K6PUL3_BAD-02      APATDSEAQLAENVKLEALGL-WRPGV-A---------------------
A0A2K5M0A7_BAD-03      APATDSEAQHAENVKLKALGL-WRPGV-A---------------------
A0A2K5VCA1_BAD-03      APATDSEAQHAENVKLKALGL-WRPGV-A---------------------
A0A2K5XJR2_BAD-03      APATDSEAQLAENVKLKALGL-WRPGV-A---------------------
A0A096MLD5_BAD-02      APATDSEAQHAENVKLKALGL-WRRGV-A---------------------
A0A2K6E7I4_BAD-03      APATDSEAQHAENVKLKALGL-WRPAV-A---------------------
A0A2I2YFH2_BAD-04      APAADSEAQHAENVKLEALGL-WRSGV-A---------------------
Q92934_BAD-04          APAADSEAQHAENVKLEALGL-WRSGV-A---------------------
A0A2I3TBK7_BAD-03      APAADSEAQHAENVKLEALGL-WRSGV-A---------------------
A0A2R8Z674_BAD-03      APAADSEAQHAENVKLEALGL-WRSGV-A---------------------
A0A2K5E6A6_BAD-03      APATDS-----ENVKLE-VPC-W---V-A---------------------
A0A2K5PDB1_BAD-03      SPATDSEAQHTENVKLEALGL-WRPGV-A---------------------
A0A2K6TG62_BAD-03      APATDSEAQHTENVKLEALEP-WRHGV-A---------------------
G1P8C5_BAD-01          APPNLWAAQRYGR-ELRRMSDEFQGSFKK---------------------
A0A452ER54_BAD-02      APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
W5P8G9_BAD-01          APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
Q61337_BAD-07          APPNLWAAQRYGR-ELRRMSDEFEGSFKS---------------------
O35147_BAD-01          APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
F7DN67_BAD-01          APPNLWAARRYGR-ELRRMSDEFQVSF-Q---------------------
Q45KI9_BAD-01          APPNLCAARRYGR-ELRRMSDEFQGSF-K---------------------
A0A3Q7SWS0_BAD-01      APPNLCAALRYGR-ELRRMSDEFQGSF-K---------------------
H0WVR2_BAD-01          APPNLWAAQRYGR-ELRRMSDEFEDSFKK---------------------
A0A2K6GWV0_BAD-01      APPNLWAAQRYGR-ELRRMSDEFEDSFKK---------------------
H0V608_BAD-01          APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K5PDB1_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
U3F2S3_BAD-01          APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K5E6A6_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K6TG62_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A0D9R491_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K5M0A7_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K5VCA1_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A1D5QBW1_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K6E7I4_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K5XJR2_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A096MLD5_BAD-04      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K6N196_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K6PUL3_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
A0A2K5HKU7_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSF-K---------------------
B4DZQ9_BAD-01          APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A096MLD5_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A2I2YFH2_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A2I2YFH2_BAD-02      APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
Q92934_BAD-01          APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
Q92934_BAD-02          APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A2I3TBK7_BAD-02      APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A2R8Z674_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
A0A2J8TYJ3_BAD-01      APPNLWAAQRYGR-ELRRMSDEFVDSFKK---------------------
G1MI17_BAD-01          APPNLCAALRYGR-ELRRMSDEFQGSF-K---------------------
A0A4X1VE31_BAD-02      APPILWAAQRYGR-ELRRMSDEFQGSFKK---------------------
A0A4X1VE31_BAD-01      APPILWAAQRYGR-ELRRMSDEFQGSF-KVSARVGLYPRVSSQWAVPFES
A0A287AEF3_BAD-01      APPILWAAQRYGR-ELRRMSDEFQGSFKK---------------------
A0A4X1VE31_BAD-03      APPILWAAQRYGR-ELRRMSDEFQGSF-K---------------------
A0A671ELU4_BAD-01      APPNLWAAQRYGR-ELRRMSDEFEGSF-K---------------------
A0A452ER54_BAD-01      APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
A0A452RJM6_BAD-01      APPNLCAALRYGR-ELRRMSDEFQGSF-K---------------------
A0A384DJL2_BAD-01      APPNLCAALRYGR-ELRRMSDEFQGSF-K---------------------
M3YNE7_BAD-01          APPNLCAALRYGR-ELRRMSDEFQGSF-K---------------------
A0A667H8Z9_BAD-01      APPNLWAALRYGR-ELRRMSDEFQGSF-K---------------------
A0A673V6P8_BAD-01      APPNLCAALRYGR-ELRRMSDEFQGSF-K---------------------
A0A2Y9EHU3_BAD-01      APPNLWAAQRYGR-ELRRMSDEFHGSF-K---------------------
A0A4W2C9A8_BAD-01      APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
A0A4W2C9A8_BAD-01      APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
F1MUT9_BAD-01          APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
Q3SYZ0_BAD-01          APPNLWAAQRYGR-ELRRMSDEFHVSF-K---------------------
A0A6F9BAV3_BAD-01      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
A0A3P9A5G8_BAD-02      APPALWAAKKYGC-QLRRMSDEFDTWLDK---------------------
A0A4W5R1T6_BAD-01      APPALWAAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A060W8P9_BAD-01      APPTLWAAKKYGR-QLRRMSDEFDTWLDK---------------------
B5X1T1_BAD-01          APPTLWAAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A673ZHY7_BAD-01      APPTLWAAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A671NP27_BAD-01      APPALWAAKKYGR-QLRRMSDEFDILLDK---------------------
A0A672SAE4_BAD-01      APPALWAAKKYGR-QLRRMSDEFDILLDK---------------------
A0A672SAE4_BAD-02      APPALWAAKKYGR-QLRRMSDEFDILLDK---------------------
A0A671RUV0_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDILLDK---------------------
A0A673HRQ3_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDILLDK---------------------
A0A672RGH0_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDILLDK---------------------
Q4V925_BAD-03          APPALWAAKKYGQ-QLRRMSDEF----DK---------------------
Q4V925_BAD-02          APPALWAAKKYGQ-QLRRMSDEF----DK---------------------
A7MCM4_BAD-01          APPALWAAKKYGQ-QLRRMSDEF----DK---------------------
Q4V925_BAD-01          APPALWAAKKYGQ-QLRRMSDEF----DK---------------------
Q4V925_BAD-04          APPALWAAKKYGQ-QLRRMSDEF----DK---------------------
A0A3B3QX41_BAD-01      APPALWAAQRYGR-QLRRMSDEFDTLLDK---------------------
A0A3P8Y761_BAD-01      APPALWAAKRYGR-QLRRMSDEFDTWLDK---------------------
A0A4W5JLL9_BAD-01      APPALWAAKKYGR-QLRRMSDEFDTWLDK---------------------
A0A3B5Q2N7_BAD-01      APPSLWAAKKYGR-QLRRMSDEFVNLLDK---------------------
A0A087X8P8_BAD-01      APPSLWAAKKYGR-QLRRMSDEFVNLLDK---------------------
A0A3B3UA11_BAD-01      APPSLWAAKKYGR-QLRRMSDEFVNLLDK---------------------
A0A3B3YFR1_BAD-01      APPSLWAAKKYGR-QLRRMSDEFVNLLDK---------------------
A0A3P9Q7C3_BAD-01      APPSLWAAKKYGR-QLRRMSDEFVNLLDK---------------------
A0A3B3HDU2_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3P9KSL7_BAD-02      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3P9KSL7_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3B5BAL2_BAD-01      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A665TUH3_BAD-01      APPALWAAKKYGQ-KLRRMSDEFDSLLDK---------------------
A0A674MXC1_BAD-02      APPALWAAQRYGR-QLRRMSDEFDSLLDK---------------------
A0A674MXC1_BAD-03      APPALWAAQRYGR-QLRRMSDEFDSLLDK---------------------
A0A674MXC1_BAD-04      APPALWAAQRYGR-QLRRMSDEFDSLLDK---------------------
A0A674MXC1_BAD-01      APPALWAAQRYGR-QLRRMSDEFDSLLDK---------------------
A0A671TL42_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3Q3AEL8_BAD-02      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3Q3AEL8_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
G3Q8B3_BAD-01          APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3Q2Y0E4_BAD-01      APPVLWAAKKYGR-QLRRMSDEFDSLMDK---------------------
A0A3Q3R5S3_BAD-01      APPALWAAKKYGR-QLRRMSDEFDSLLDK---------------------
A0A3Q3RXS8_BAD-02      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q3RXS8_BAD-01      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q0QNQ2_BAD-02      APPALWAAKKYGQ-QLRRMSDEFDSLLDK---------------------
A0A3Q3WTY4_BAD-01      APPSLWAAKKYGQ-RLRRMSDEF----DR---------------------
                                                                         

Q61337_BAD-09          ----------HLGSRHTHH---------------PVSLTAQCRA------
Q2PG01_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2I3H4B2_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
Q92934_BAD-06          ----------GLPRPKSAG-------------------------------
Q92934_BAD-05          ----------GLPRPKSAG---------------TATQM-RQSS------
A0A670JUY4_BAD-01      ----------KLPRPKSAG---------------TATQM-RRTL------
A0A670YRG7_BAD-01      -----------LPRPKSAG---------------TCSHMDRPPP------
Q6P7C5_BAD-01          ----------------------------------SIIFL-SHVP------
A0A3B1JLM2_BAD-01      ---------GDLRRTTGPG-------------------R-HTNR------
A0A4W4DXF5_BAD-01      ---------GEIRRVSSPG---------------KLSQK-QTNQ------
A0A452IFQ4_BAD-01      -----------LPRPKSAG---------------TTSQL-HRGN------
A0A674I2R9_BAD-01      -----------LPRPKSAG---------------TTSQL-HRGN------
C1C3S9_BAD-01          -----------IPRPKSAS---------------AATEM-TVSK------
A0A6I8PXS6_BAD-01      -----------LPRPKSAS---------------AAGQM-TGNR------
A0A337SAW2_BAD-01      -----------LPRPKSAG---------------TATQM-RQSP------
A0A673J9C6_BAD-01      ---------G-MKRVKSAG---------------TTRQM-QQSP------
A0A4W5JLL9_BAD-02      ---------GEMRRVKSAG---------------AAKQM-TKSP------
A0A674DKC6_BAD-01      ---------GEMRRVKSAG---------------AAKQM-TKSP------
A0A3P9A5G8_BAD-01      ---------GEPKRGIIPG---------------RAKQV-YR--------
A0A3B4DUY7_BAD-01      ---------GDTRRASSPG-----------------KQT-NR--------
A0A4W4HE29_BAD-01      ----------GMKRARSAG---------------AARQM-HTSP------
A0A3B4CPH6_BAD-01      ----------GMKRVRSAG---------------AARQM-HASP------
A0A674AVP9_BAD-01      ---------GVPKRGIIPR----------------GGKQ-KVSR------
A0A1S3L0Z2_BAD-01      ---------GVPKRGIIPR----------------GGKQ-KVSR------
B5XEF1_BAD-01          ---------GVPKRGIIPR----------------GGKQ-KVSR------
A0A4W5MZR2_BAD-01      ---------GEPKRGISPG----------------GGKQ-KVSR------
A0A060W8W7_BAD-01      ---------GEPKRGISPG----------------GGKQ-KVSR------
E7FBJ6_BAD-01          ---------GVSKTP--------------------NSQK-QTYR------
A0A673J5Q9_BAD-01      ---------GEVKRA--------------------NSQK-QTYR------
A0A671PX91_BAD-01      ---------GEVKRA--------------------NSQK-QTYR------
A0A672LB88_BAD-01      ---------GEVKRA--------------------NSQK-QTYR------
A0A673I6H5_BAD-01      ---------GEVKRA--------------------NSQK-QTYR------
A0A671SBB4_BAD-01      ---------GEVKRA--------------------NSQK-QTYR------
A0A672R7P6_BAD-01      ---------GEVKRA--------------------NSQK-QTYR------
A0A3P8Y761_BAD-02      ---------GQMKRVKSAG---------------AAKQM-TTSP------
A0A3B5L9R9_BAD-01      ---------GEMRNVSSDG---------------SNRPI-HHSR------
H3D8J8_BAD-01          ---------GGMRKTSSAG---------------SARQM-HHSR------
A0A6F9CQZ0_BAD-02      ---------GEMKQLKSVG---------------AAKQM-TQSP------
A0A6F9CA11_BAD-02      ---------GEMRRVKSAG---------------AAKQM-TKSP------
A0A1S3N9Q3_BAD-01      ---------GEMRRVKSAG---------------AAKQM-TKSP------
A0A3Q2QC80_BAD-01      ---------GELRKVSSAG---------------TNRPI-HHSR------
A0A3Q3FKT9_BAD-02      ---------GVRIKGGGGGSRGGCGLVVESVVSQPKSQE-FNTQ------
A0A3Q3FKT9_BAD-03      ---------GEMKKVRSPG---------------PAKQM-HHSK------
A0A667ZNC6_BAD-01      ---------GEMKRVRSAG---------------TAKQM-QHSK------
A0A3P9B2E4_BAD-01      ---------G----------------------------------------
A0A668V3Q4_BAD-01      ---------GEMK----------------------LKKL-HHSK------
I3K7B6_BAD-01          ---------GEMK----------------------LKKL-HHSK------
A0A3Q3C680_BAD-01      ---------GEMK----------------------VKKL-HHSK------
A0A3P8QRJ7_BAD-01      ---------GEMK----------------------VKKL-HHSK------
A0A3Q4GGN3_BAD-01      ---------GEMK----------------------LKKL-HHSK------
A0A3B4GXJ6_BAD-01      ---------GEMK----------------------VKKL-HHSK------
A0A3Q2D5S0_BAD-01      ---------GELRKVSSTG---------------TNRPI-RHSK------
A0A3Q0QNQ2_BAD-01      ---------G-MKKAKNAG---------------TTRKM-HHSK------
A0A3P8WI83_BAD-01      ---------G-MRKVKSAG---------------TARQM-HHSK------
A0A3P8WI83_BAD-02      ---------G-MRKVKSAG---------------TARQM-HHSK------
A0A3P9HNZ2_BAD-01      ---------GEMRKVRSTG---------------AAKQM-LHST------
A0A3B3BQF7_BAD-01      ---------GEMRKVRSAG---------------ATKQM-HHST------
A0A4W6EMZ7_BAD-02      ---------GEMRRVKSAT---------------TTRQM-HHSK------
A0A672JQ68_BAD-01      ---------GEMKKLRNPG---------------QARQI-HHSR------
A0A2U9BAC9_BAD-01      ---------GEMRKVKSAG---------------TARQM-HHSQ------
A0A4W6EMZ7_BAD-01      ---------GEMRRVKSAT---------------TTRQM-HHSK------
A0A3B4VFC5_BAD-01      ---------GEMRKVKSAG---------------TAKQM-HHSK------
A0A3B4W9T1_BAD-01      ---------GEMRKVKSAG---------------TAKQM-HHSK------
A0A3Q1K1C7_BAD-01      ---------GEMRKVRSAG---------------TARQM-HHSK------
A0A3Q1K1C7_BAD-02      ---------GEMRKVRSAG---------------TARQM-HHSK------
A0A672YF93_BAD-01      ---------GEMKRVRSAG---------------TARQM-HHSK------
A0A3Q1GWH9_BAD-01      ---------GEMKRVRSAG---------------TARQM-HHSK------
A0A3Q1CPU7_BAD-01      ---------GEMKRVRSAG---------------TARQM-HHSK------
A0A3P8TWH6_BAD-01      ---------GEMKRVRSAG---------------TARQM-HHSK------
A0A3Q3FKT9_BAD-01      RGGCGLVVESVVSQPKSQE---------------FNTQL-LQPHVRCVLG
A0A3B1IH05_BAD-01      ----------GMKRVRSAG---------------AARQM-QNSP------
A0A5F8GA49_BAD-01      ----------GLPRPKSAG---------------TASQM-RRSH------
H3ANP3_BAD-03          ----------GLPRPKSAG---------------AAGEM-VDES------
H3ANP3_BAD-04          ----------GLPRPKSAG---------------AAGEM-VDES------
H3ANP3_BAD-01          ----------GLPRPKSAG---------------AAGEM-VDES------
H3ANP3_BAD-02          ----------GLPRPKSAG---------------AAGEM-VDES------
A0A4X2KAA5_BAD-01      ----------GLPRPKSAG---------------TASQM-RRSH------
G3VRY3_BAD-01          ----------GLPRPKSAG---------------TASQM-RRSH------
G3VRY3_BAD-02          ----------GLPRPKSAG---------------TASQM-RRSH------
A0A672V9F8_BAD-01      ----------VLPRASSAG---------------GA-------G------
A0A674GQ16_BAD-01      ----------VLPRPRSVG---------------GAPP---GGG------
A0A6I8NVP2_BAD-01      ----------GLPRPKSAG---------------TAAQL-QRPS------
G3TP47_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
Q61337_BAD-05          ----------VSASVRCDG---------------T---------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      ----------GLPRPRSAG---------------TASQM-RQSS------
Q61337_BAD-04          ----------GLPRPKSAG---------------TATQM-RQSA------
Q61337_BAD-03          ----------GLPRPKSAG---------------TATQM-RQSA------
Q61337_BAD-06          ----------GLPRPKSAG---------------TATQM-RQSA------
Q61337_BAD-02          ----------G-------------------------EEL-TYSL------
Q61337_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSA------
G5B6Q3_BAD-01          ----------GLPRPKSAG---------------TATKL-WQSS------
G5B6Q3_BAD-02          ----------GLPRPKSAG---------------TATKL-WQSS------
A0A2I3TBK7_BAD-01      ----------TPPVPTALG---------------SHLEY-GRKY------
A0A2R8Z674_BAD-02      ----------TPPVPTALG---------------SHLEY-GRKY------
A0A2I2YFH2_BAD-03      ----------TPPVPTALG---------------SHLEY-GRKY------
Q92934_BAD-03          ----------TPPVPTALG---------------SHLEY-GRKY------
A0A2K5M0A7_BAD-02      ----------TPPALTVLV---------------GHLGY-GRKC------
A0A2K5XJR2_BAD-02      ----------TPPALTVLV---------------GHLGY-GRKC------
A0A096MLD5_BAD-03      ----------TPPALTVLV---------------GHLGY-GRKC------
A0A2K5VCA1_BAD-02      ----------TPPALTVLV---------------GHLGY-GRKC------
A0A2K6E7I4_BAD-02      ----------TPPALTVLV---------------GHLGY-GRKC------
A0A2K5PDB1_BAD-02      ----------TPPALIALS---------------GHLGY-GRKC------
A0A2K5E6A6_BAD-02      ----------TPPVPIALG---------------GHLGY-GRKC------
A0A2K6TG62_BAD-02      ----------TLPAPIALG---------------GHLGH-GRKC------
A0A2K5HKU7_BAD-02      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2K6N196_BAD-02      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2K6PUL3_BAD-02      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2K5M0A7_BAD-03      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2K5VCA1_BAD-03      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2K5XJR2_BAD-03      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A096MLD5_BAD-02      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2K6E7I4_BAD-03      ----------TAPTPRGRR---------------RTKGW-RRSP------
A0A2I2YFH2_BAD-04      ----------TAPTPRGRR---------------TTKGW-GRSP------
Q92934_BAD-04          ----------TAPTPRGRR---------------TTKGW-GRSP------
A0A2I3TBK7_BAD-03      ----------TAPTPRGRR---------------TTKGW-GRSP------
A0A2R8Z674_BAD-03      ----------TAPTPRGRR---------------TTKGW-GRSP------
A0A2K5E6A6_BAD-03      ----------TAPTPQGRR---------------RTKGW-RRSP------
A0A2K5PDB1_BAD-03      ----------TDRTPQGRR---------------RTKGW-RRSP------
A0A2K6TG62_BAD-03      ----------TARTPQGRR---------------GTKGW-RRSP------
G1P8C5_BAD-01          ----------GLPRPKSAG---------------TATQM-WQKS------
A0A452ER54_BAD-02      ----------GLPRPKSAG---------------TATQM-RQSP------
W5P8G9_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
Q61337_BAD-07          ----------------MLG---------------LAVLI-RPLS------
O35147_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSA------
F7DN67_BAD-01          ----------ALPRPKSAG---------------TATQM-RQSP------
Q45KI9_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
A0A3Q7SWS0_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
H0WVR2_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K6GWV0_BAD-01      ----------GLPRPKSAG---------------TATQI-RQSS------
H0V608_BAD-01          ----------GLPRPKSAG---------------TATKL-WQNS------
A0A2K5PDB1_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSA------
U3F2S3_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K5E6A6_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K6TG62_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A0D9R491_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K5M0A7_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K5VCA1_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A1D5QBW1_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K6E7I4_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K5XJR2_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A096MLD5_BAD-04      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K6N196_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K6PUL3_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2K5HKU7_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
B4DZQ9_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
A0A096MLD5_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2I2YFH2_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2I2YFH2_BAD-02      ----------GLPRPKSAG---------------TATQM-RQSS------
Q92934_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSS------
Q92934_BAD-02          ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2I3TBK7_BAD-02      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2R8Z674_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
A0A2J8TYJ3_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSS------
G1MI17_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
A0A4X1VE31_BAD-02      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A4X1VE31_BAD-01      QGLSGSEVQAPLQKAKTPG---------------FPKSL-KREA------
A0A287AEF3_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A4X1VE31_BAD-03      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A671ELU4_BAD-01      ----------GLPRPKSAG---------------TATQM-RQNS------
A0A452ER54_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A452RJM6_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A384DJL2_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
M3YNE7_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
A0A667H8Z9_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A673V6P8_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A2Y9EHU3_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A4W2C9A8_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
A0A4W2C9A8_BAD-01      ----------GLPRPKSAG---------------TATQM-RQSP------
F1MUT9_BAD-01          ----------GLPRPKSAG---------------TATQM-RQSP------
Q3SYZ0_BAD-01          ----------GLPRPKSAG---------------TATEM-RQSP------
A0A6F9BAV3_BAD-01      ---------GEPKRGISPG---------------GCKQ--KVSR------
A0A3P9A5G8_BAD-02      ---------GEPKRGIIPG---------------RAKQ---VYR------
A0A4W5R1T6_BAD-01      ---------GEPKRGISPG---------------GIKQ--EVSR------
A0A060W8P9_BAD-01      ---------GEPKRGISPG---------------GVKQ--EVSR------
B5X1T1_BAD-01          ---------GEPKRGISPG---------------GVKQ--EVSR------
A0A673ZHY7_BAD-01      ---------GEPKRGISPG---------------GVKQ--EVSR------
A0A671NP27_BAD-01      ---------G-MKRVKSAG---------------TTRQM-QQSP------
A0A672SAE4_BAD-01      ---------G-MKRVKSAG---------------TTRQM-QQSP------
A0A672SAE4_BAD-02      ---------G-MKRVKSAG---------------TTRQM-QQSP------
A0A671RUV0_BAD-01      ---------G-MKRVKSAG---------------TTRQM-RQSP------
A0A673HRQ3_BAD-01      ---------G-MKRVKSAG---------------TTRQM-RQSP------
A0A672RGH0_BAD-01      ---------G-MKRVKSAG---------------TTRQM-RQSP------
Q4V925_BAD-03          ---------G-MKRVKSAG---------------TARQM-SQSP------
Q4V925_BAD-02          ---------G-MKRVKSAG---------------TARQM-SQSP------
A7MCM4_BAD-01          ---------GQMKRVKSAG---------------TARQM-SQSP------
Q4V925_BAD-01          ---------GQMKRVKSAG---------------TARQM-SQSP------
Q4V925_BAD-04          ---------GQMKRVKSAG---------------TARQM-SQSP------
A0A3B3QX41_BAD-01      ---------G-MKRVRSAG---------------AARQM-QASP------
A0A3P8Y761_BAD-01      ---------GQMKRVKSAG---------------AAKQM-TTSP------
A0A4W5JLL9_BAD-01      ---------GEMRRVKSAG---------------AAKQM-TKSP------
A0A3B5Q2N7_BAD-01      ---------GEMRNVSSDG---------------SNRPI-HHSR------
A0A087X8P8_BAD-01      ---------GEMRKVSSTG---------------SNRPI-HHSR------
A0A3B3UA11_BAD-01      ---------GEMRKVSSTG---------------SNRPI-HHSR------
A0A3B3YFR1_BAD-01      ---------GEMRKVSSTG---------------SNRPI-HHSR------
A0A3P9Q7C3_BAD-01      ---------GEMRKVSSAG---------------SNGPI-HHSR------
A0A3B3HDU2_BAD-01      ---------GEMRKVRSTG---------------AAKQM-LHST------
A0A3P9KSL7_BAD-02      ---------GEMRKVRSTG---------------AAKQM-LHST------
A0A3P9KSL7_BAD-01      ---------GEMRKVRSTG---------------AAKQM-LHST------
A0A3B5BAL2_BAD-01      ---------GEMKRVRSAG---------------TAKQM-HHSK------
A0A665TUH3_BAD-01      ---------GEMRKVKSVG---------------SAKQM-HHSK------
A0A674MXC1_BAD-02      ---------GGMRKTNSTG---------------STKPM-HHSR------
A0A674MXC1_BAD-03      ---------GGMRKTNSTG---------------STKPM-HHSR------
A0A674MXC1_BAD-04      ---------GGMRKTNSTG---------------STKPM-HHSR------
A0A674MXC1_BAD-01      ---------GGMRKTNSTG---------------STKPM-HHSR------
A0A671TL42_BAD-01      ---------GEMRKVKSAG---------------TPKQM-HHSR------
A0A3Q3AEL8_BAD-02      ---------GEMRKVKSAG---------------TTKQI-HHSR------
A0A3Q3AEL8_BAD-01      ---------GEMRKVKSAG---------------TTKQI-HHSR------
G3Q8B3_BAD-01          ---------GEMRRVKSAG---------------TTKQM-QHSK------
A0A3Q2Y0E4_BAD-01      ---------GELKFKSAGG---------------TSRAI-HHSK------
A0A3Q3R5S3_BAD-01      ---------GEMKRVRSAG---------------AASQM-HHSK------
A0A3Q3RXS8_BAD-02      ---------GEMR-VRNAG---------------KAQKM-HHSK------
A0A3Q3RXS8_BAD-01      ---------GEMR-VRNAG---------------KAQKM-HHSK------
A0A3Q0QNQ2_BAD-02      ---------GMKK-AKNAG---------------TTRKM-HHSK------
A0A3Q3WTY4_BAD-01      ---------QEWK-TRSAG---------------TATQM-HQSR------
                                                                         

Q61337_BAD-09          -----SW--------------------------WWGPDSGCQNEAHSFLL
Q2PG01_BAD-01          -----SW---------------TRVF-----QSWWDRNLGR---------
A0A2I3H4B2_BAD-01      -----SW---------------TRVF-----QSWWDRNLGR---------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          -----SW---------------TR--------------------------
A0A670JUY4_BAD-01      -----GW---------------KEVL-----QSWWRRNSPG---------
A0A670YRG7_BAD-01      -----SW---------------KDTL-----RSWWLYSGSDIMALSRFSP
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      -----GW---------------FSFL------------------------
A0A4W4DXF5_BAD-01      -----GW---------------FSFL------------------------
A0A452IFQ4_BAD-01      -----SW---------------KETL------------------------
A0A674I2R9_BAD-01      -----SW---------------KETL------------------------
C1C3S9_BAD-01          -----SF---------------GETF------------------------
A0A6I8PXS6_BAD-01      -----SI---------------RDLI------------------------
A0A337SAW2_BAD-01      -----SW---------------TRFI------------------------
A0A673J9C6_BAD-01      -----SW---------------FAFL------------------------
A0A4W5JLL9_BAD-02      -----SW---------------WAYL------------------------
A0A674DKC6_BAD-01      -----SW---------------WAYL------------------------
A0A3P9A5G8_BAD-01      -----GW---------------FSFL------------------------
A0A3B4DUY7_BAD-01      -----GW---------------FSFL------------------------
A0A4W4HE29_BAD-01      -----SW---------------FAFL------------------------
A0A3B4CPH6_BAD-01      -----SW---------------FTFL------------------------
A0A674AVP9_BAD-01      -----GW---------------FSFL------------------------
A0A1S3L0Z2_BAD-01      -----GW---------------FSFL------------------------
B5XEF1_BAD-01          -----GW---------------FSFL------------------------
A0A4W5MZR2_BAD-01      -----GW---------------FSFL------------------------
A0A060W8W7_BAD-01      -----GW---------------FSFL------------------------
E7FBJ6_BAD-01          -----GW---------------FSFL------------------------
A0A673J5Q9_BAD-01      -----GW---------------FSFL------------------------
A0A671PX91_BAD-01      -----GW---------------FSFL------------------------
A0A672LB88_BAD-01      -----GW---------------FSFL------------------------
A0A673I6H5_BAD-01      -----GW---------------FSFL------------------------
A0A671SBB4_BAD-01      -----GW---------------FSFL------------------------
A0A672R7P6_BAD-01      -----GW---------------FSFL------------------------
A0A3P8Y761_BAD-02      -----SW---------------WAFL------------------------
A0A3B5L9R9_BAD-01      -----SW---------------WSYL------------------------
H3D8J8_BAD-01          -----SW---------------WSYL------------------------
A0A6F9CQZ0_BAD-02      -----SW---------------WAYL------------------------
A0A6F9CA11_BAD-02      -----SW---------------WAYL------------------------
A0A1S3N9Q3_BAD-01      -----SW---------------WAYL------------------------
A0A3Q2QC80_BAD-01      -----SW---------------WNYL------------------------
A0A3Q3FKT9_BAD-02      -----LLQPHVRCVLGSLNVYKWDYL------------------------
A0A3Q3FKT9_BAD-03      -----SW---------------WSYL------------------------
A0A667ZNC6_BAD-01      -----SW---------------WNYL------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A668V3Q4_BAD-01      -----TW---------------WSYL------------------------
I3K7B6_BAD-01          -----TW---------------WSYL------------------------
A0A3Q3C680_BAD-01      -----TW---------------WSYL------------------------
A0A3P8QRJ7_BAD-01      -----TW---------------WSYL------------------------
A0A3Q4GGN3_BAD-01      -----TW---------------WSYL------------------------
A0A3B4GXJ6_BAD-01      -----TW---------------WSYL------------------------
A0A3Q2D5S0_BAD-01      -----SW---------------WSYL------------------------
A0A3Q0QNQ2_BAD-01      -----TW---------------WSYL------------------------
A0A3P8WI83_BAD-01      -----SW---------------WSYL------------------------
A0A3P8WI83_BAD-02      -----SW---------------WSYL------------------------
A0A3P9HNZ2_BAD-01      -----SW---------------WNYL------------------------
A0A3B3BQF7_BAD-01      -----SW---------------WNYL------------------------
A0A4W6EMZ7_BAD-02      -----SW---------------WSYL------------------------
A0A672JQ68_BAD-01      -----SW---------------WSYL------------------------
A0A2U9BAC9_BAD-01      -----SW---------------WSYL------------------------
A0A4W6EMZ7_BAD-01      -----SW---------------WSYL------------------------
A0A3B4VFC5_BAD-01      -----SW---------------WSYL------------------------
A0A3B4W9T1_BAD-01      -----SW---------------WSYL------------------------
A0A3Q1K1C7_BAD-01      -----SW---------------WSYL------------------------
A0A3Q1K1C7_BAD-02      -----SW---------------WSYL------------------------
A0A672YF93_BAD-01      -----TW---------------WSYL------------------------
A0A3Q1GWH9_BAD-01      -----SW---------------WSYL------------------------
A0A3Q1CPU7_BAD-01      -----SW---------------WSYL------------------------
A0A3P8TWH6_BAD-01      -----SW---------------WSYL------------------------
A0A3Q3FKT9_BAD-01      SLNVYKW---------------DYLILIITLHSSL---------------
A0A3B1IH05_BAD-01      -----SW---------------FAFL------------------------
A0A5F8GA49_BAD-01      -----GW---------------TRTV-----QSWFGR-------------
H3ANP3_BAD-03          -----WW---------------KKLI-----RSLKGR-------------
H3ANP3_BAD-04          -----WW---------------KKLI-----RSLKGR-------------
H3ANP3_BAD-01          -----WW---------------KKLI-----RSLKGR-------------
H3ANP3_BAD-02          -----WW---------------KKLI-----RSLKGR-------------
A0A4X2KAA5_BAD-01      -----GW---------------ARTF-----QSWLSR-------------
G3VRY3_BAD-01          -----GW---------------TRTF-----QSWFGR-------------
G3VRY3_BAD-02          -----GW---------------TRTF-----QSWFGR-------------
A0A672V9F8_BAD-01      -----GW---------------REVL-----RSWWGAPPPPRPRPAATPP
A0A674GQ16_BAD-01      -----GW---------------RETL-----RAWWGS-RRPRPAPPAPPP
A0A6I8NVP2_BAD-01      -----GW---------------TRVL-----RSWWNR-------------
G3TP47_BAD-01          -----SW---------------TRII-----QAWWDR-------------
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      ----------------------VTFS-----QSPFLR-------------
A0A287CT05_BAD-01      -----SW---------------TRFI-----QSWWDR-------------
Q61337_BAD-04          -----GW---------------TRII-----QSWWDR-------------
Q61337_BAD-03          -----GW---------------TRII-----QSWWDR-------------
Q61337_BAD-06          -----GW---------------TRII-----QSWWDR-------------
Q61337_BAD-02          -----SP---------------FRCV-----Q------------------
Q61337_BAD-01          -----GW---------------TRII-----QSWWDR-------------
G5B6Q3_BAD-01          -----SW---------------TRAI-----QSWWDR-------------
G5B6Q3_BAD-02          -----SW---------------TRAI-----QSWWDR-------------
A0A2I3TBK7_BAD-01      -----FP---------------QAYA-----K------------------
A0A2R8Z674_BAD-02      -----FP---------------QAYA-----K------------------
A0A2I2YFH2_BAD-03      -----FP---------------QAYA-----K------------------
Q92934_BAD-03          -----FP---------------QAYA-----K------------------
A0A2K5M0A7_BAD-02      -----FP---------------QALC-----K------------------
A0A2K5XJR2_BAD-02      -----FP---------------QASC-----K------------------
A0A096MLD5_BAD-03      -----FP---------------QALC-----K------------------
A0A2K5VCA1_BAD-02      -----FP---------------QALC-----K------------------
A0A2K6E7I4_BAD-02      -----FP---------------QALC-----K------------------
A0A2K5PDB1_BAD-02      -----FL---------------Q---------------------------
A0A2K5E6A6_BAD-02      -----FL---------------Q---------------------------
A0A2K6TG62_BAD-02      -----FL---------------Q---------------------------
A0A2K5HKU7_BAD-02      -----AP---------------FGAA-----RAPRPL-------------
A0A2K6N196_BAD-02      -----AP---------------FGAA-----RAPRPL-------------
A0A2K6PUL3_BAD-02      -----AP---------------FGAA-----RAPRPL-------------
A0A2K5M0A7_BAD-03      -----AP---------------FGAA-----RAPRPP-------------
A0A2K5VCA1_BAD-03      -----AP---------------FGAA-----RAPRPP-------------
A0A2K5XJR2_BAD-03      -----AP---------------FGAA-----RAPRPP-------------
A0A096MLD5_BAD-02      -----AP---------------FGAA-----RAPRPP-------------
A0A2K6E7I4_BAD-03      -----AP---------------FGAA-----RAPRPP-------------
A0A2I2YFH2_BAD-04      -----AP---------------FGAA-----RARRPP-------------
Q92934_BAD-04          -----AP---------------FGAA-----RARRPP-------------
A0A2I3TBK7_BAD-03      -----AP---------------FGAA-----RARRPP-------------
A0A2R8Z674_BAD-03      -----AP---------------FGAA-----RARRPP-------------
A0A2K5E6A6_BAD-03      -----AP---------------FGAV-----RAQHPP-------------
A0A2K5PDB1_BAD-03      -----AP---------------FGAV-----RARHPP-------------
A0A2K6TG62_BAD-03      -----AL---------------FGAV-----RARHPP-------------
G1P8C5_BAD-01          -----SW---------------TRFF-----QSWWDR-------------
A0A452ER54_BAD-02      -----SW---------------TRFL-----QSWLSR-------------
W5P8G9_BAD-01          -----SW---------------TRFL-----QSWLSR-------------
Q61337_BAD-07          -----VS---------------SDLLGFPPSSSFVQD-------------
O35147_BAD-01          -----SW---------------TRII-----QSWWDR-------------
F7DN67_BAD-01          -----SW---------------TRAI-----QSWWDR-------------
Q45KI9_BAD-01          -----SW---------------TRVI-----QSWWDR-------------
A0A3Q7SWS0_BAD-01      -----SW---------------TRVI-----QSWWDR-------------
H0WVR2_BAD-01          -----SW---------------TRVI-----QSWWDR-------------
A0A2K6GWV0_BAD-01      -----SW---------------TRVI-----QSWWDR-------------
H0V608_BAD-01          -----NW---------------TRAI-----QSWWDR-------------
A0A2K5PDB1_BAD-01      -----SW---------------TRVI-----QSWWDR-------------
U3F2S3_BAD-01          -----SW---------------TRVI-----QSWWDR-------------
A0A2K5E6A6_BAD-01      -----SW---------------TQVI-----QSWWDR-------------
A0A2K6TG62_BAD-01      -----SW---------------TRVI-----QSWWDR-------------
A0A0D9R491_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2K5M0A7_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2K5VCA1_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A1D5QBW1_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2K6E7I4_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2K5XJR2_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A096MLD5_BAD-04      -----SW---------------TRVF-----QSWWDR-------------
A0A2K6N196_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2K6PUL3_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2K5HKU7_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
B4DZQ9_BAD-01          -----RR---------------LR--------------------------
A0A096MLD5_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2I2YFH2_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2I2YFH2_BAD-02      -----SW---------------TRVF-----QSWWDR-------------
Q92934_BAD-01          -----SW---------------TRVF-----QSWWDR-------------
Q92934_BAD-02          -----SW---------------TRVF-----QSWWDR-------------
A0A2I3TBK7_BAD-02      -----SW---------------TRVF-----QSWWDR-------------
A0A2R8Z674_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
A0A2J8TYJ3_BAD-01      -----SW---------------TRVF-----QSWWDR-------------
G1MI17_BAD-01          -----SW---------------TRVI-----QSWWDR-------------
A0A4X1VE31_BAD-02      -----SW---------------KRFL-----QSWWYR-------------
A0A4X1VE31_BAD-01      -----GW-------------------------------------------
A0A287AEF3_BAD-01      -----SW---------------KRFL-----QSWWYR-------------
A0A4X1VE31_BAD-03      -----SW---------------KRFL-----QSWWYR-------------
A0A671ELU4_BAD-01      -----SW---------------TRIF-----QSLW---------------
A0A452ER54_BAD-01      -----SW---------------TRFL-----QSWLSR-------------
A0A452RJM6_BAD-01      -----SW---------------TRVI-----QSWWDR-------------
A0A384DJL2_BAD-01      -----SW---------------TRVI-----QSWWDR-------------
M3YNE7_BAD-01          -----SW---------------TRVI-----QSWWDR-------------
A0A667H8Z9_BAD-01      -----SW---------------TRFI-----QSWWDR-------------
A0A673V6P8_BAD-01      -----SW---------------TRFI-----QSWWDR-------------
A0A2Y9EHU3_BAD-01      -----SW---------------TRFL-----QSWWNR-------------
A0A4W2C9A8_BAD-01      -----SW---------------TRFL-----QSWLSR-------------
A0A4W2C9A8_BAD-01      -----SW---------------TRFL-----QSWLSR-------------
F1MUT9_BAD-01          -----SW---------------TRFL-----QSWLSR-------------
Q3SYZ0_BAD-01          -----SW---------------TRFL-----QSWLSR-------------
A0A6F9BAV3_BAD-01      -----GW---------------FSFL------------------------
A0A3P9A5G8_BAD-02      -----GW---------------FSFL------------------------
A0A4W5R1T6_BAD-01      -----GW---------------FSFL------------------------
A0A060W8P9_BAD-01      -----GW---------------FSFL------------------------
B5X1T1_BAD-01          -----GW---------------FSFL------------------------
A0A673ZHY7_BAD-01      -----GW---------------FSFL------------------------
A0A671NP27_BAD-01      -----SW---------------FAFL------------------------
A0A672SAE4_BAD-01      -----SW---------------FAFL------------------------
A0A672SAE4_BAD-02      -----SW---------------FAFL------------------------
A0A671RUV0_BAD-01      -----SW---------------LAFL------------------------
A0A673HRQ3_BAD-01      -----SW---------------LAFL------------------------
A0A672RGH0_BAD-01      -----SW---------------LAFL------------------------
Q4V925_BAD-03          -----SW---------------LAFL------------------------
Q4V925_BAD-02          -----SW---------------LAFL------------------------
A7MCM4_BAD-01          -----SW---------------LAFL------------------------
Q4V925_BAD-01          -----SW---------------LAFL------------------------
Q4V925_BAD-04          -----SW---------------LAFL------------------------
A0A3B3QX41_BAD-01      -----SW---------------FAFL------------------------
A0A3P8Y761_BAD-01      -----SW---------------WAFL------------------------
A0A4W5JLL9_BAD-01      -----SW---------------WAYL------------------------
A0A3B5Q2N7_BAD-01      -----SW---------------WSYL------------------------
A0A087X8P8_BAD-01      -----SW---------------WSYL------------------------
A0A3B3UA11_BAD-01      -----SW---------------WSYL------------------------
A0A3B3YFR1_BAD-01      -----SW---------------WSYL------------------------
A0A3P9Q7C3_BAD-01      -----SW---------------WSYL------------------------
A0A3B3HDU2_BAD-01      -----SW---------------WNYL------------------------
A0A3P9KSL7_BAD-02      -----SW---------------WNYL------------------------
A0A3P9KSL7_BAD-01      -----SW---------------WNYL------------------------
A0A3B5BAL2_BAD-01      -----SW---------------WSYL------------------------
A0A665TUH3_BAD-01      -----SW---------------WNYL------------------------
A0A674MXC1_BAD-02      -----SW---------------WSYL------------------------
A0A674MXC1_BAD-03      -----SW---------------WSYL------------------------
A0A674MXC1_BAD-04      -----SW---------------WSYL------------------------
A0A674MXC1_BAD-01      -----SW---------------WSYL------------------------
A0A671TL42_BAD-01      -----SW---------------WSYL------------------------
A0A3Q3AEL8_BAD-02      -----SW---------------WNYL------------------------
A0A3Q3AEL8_BAD-01      -----SW---------------WNYL------------------------
G3Q8B3_BAD-01          -----SW---------------WSSL------------------------
A0A3Q2Y0E4_BAD-01      -----TW---------------WSYL------------------------
A0A3Q3R5S3_BAD-01      -----SW---------------WSYL------------------------
A0A3Q3RXS8_BAD-02      -----TW---------------WSYL------------------------
A0A3Q3RXS8_BAD-01      -----TW---------------WSYL------------------------
A0A3Q0QNQ2_BAD-02      -----TW---------------WSYL------------------------
A0A3Q3WTY4_BAD-01      -----SW---------------WSYL------------------------
                                                                         

Q61337_BAD-09          LP------------------------------------------------
Q2PG01_BAD-01          GSSAPSQ-------------------------------------------
A0A2I3H4B2_BAD-01      GSSAPSQ-------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
A0A670JUY4_BAD-01      NGPRSPP-------------------------------------------
A0A670YRG7_BAD-01      SAPSTLN-------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      ---------WGTKEEEGRE-------------------------------
A0A4W4DXF5_BAD-01      ---------WCSKEEEGRK-------------------------------
A0A452IFQ4_BAD-01      ------QAWLGHRPARDALPRSSK--------------------------
A0A674I2R9_BAD-01      ------QAWLGHRPARDAPPRSSK--------------------------
C1C3S9_BAD-01          ------FNFFRRKNKDRSQSENDKH-------------------------
A0A6I8PXS6_BAD-01      ------MGLFSRRKSKGRDESGDEE-------------------------
A0A337SAW2_BAD-01      ---------QSWWDRNLGRGGSAPSQ------------------------
A0A673J9C6_BAD-01      ---------WSHKESDAESRP------AE---------------------
A0A4W5JLL9_BAD-02      ---------FSHKETETEHTPTIPPRSSE---------------------
A0A674DKC6_BAD-01      ---------FSHKETETEHTPTIPPRSSE---------------------
A0A3P9A5G8_BAD-01      ---------WSPKEAEGRD-------------------------------
A0A3B4DUY7_BAD-01      ---------WGSKEEEGRE-------------------------------
A0A4W4HE29_BAD-01      ---------WSHKESDTETSSSVTAPDTRPAE------------------
A0A3B4CPH6_BAD-01      ---------WSHKESDSEASSSLTAPDTRPAE------------------
A0A674AVP9_BAD-01      ---------WSPKEAEGRE-------------------------------
A0A1S3L0Z2_BAD-01      ---------WSPKEAEGRE-------------------------------
B5XEF1_BAD-01          ---------WSPKEAEGRE-------------------------------
A0A4W5MZR2_BAD-01      ---------WSPKEAEGRE-------------------------------
A0A060W8W7_BAD-01      ---------WSPKEAEGRE-------------------------------
E7FBJ6_BAD-01          ---------WSPKEEEGRE-------------------------------
A0A673J5Q9_BAD-01      ---------WSPKEEEGRE-------------------------------
A0A671PX91_BAD-01      ---------WSPKEEEGRE-------------------------------
A0A672LB88_BAD-01      ---------WSSKEEEGRE-------------------------------
A0A673I6H5_BAD-01      ---------WSSKEEEGRE-------------------------------
A0A671SBB4_BAD-01      ---------LSSKEEEGRE-------------------------------
A0A672R7P6_BAD-01      ---------WSSKDEEGRE-------------------------------
A0A3P8Y761_BAD-02      ---------FSHKETETEKTPNLIITEPRSSE------------------
A0A3B5L9R9_BAD-01      ---------FSHQETEGENNHHENHAS-RTE-------------------
H3D8J8_BAD-01          ---------FSHQETESENNHHD---------------------------
A0A6F9CQZ0_BAD-02      ---------FSHQETETEHSPNLTAPEPR---------------------
A0A6F9CA11_BAD-02      ---------FSHQETETEHTSTIPPRSSE---------------------
A0A1S3N9Q3_BAD-01      ---------FSHKETETEHTPTIPPRSSE---------------------
A0A3Q2QC80_BAD-01      ---------FSHQETEGENSHHENHAP-RTE-------------------
A0A3Q3FKT9_BAD-02      ---------ILIITLHSSL-------------------------------
A0A3Q3FKT9_BAD-03      ---------FSHQETEGENNHHENHTH-RNE-------------------
A0A667ZNC6_BAD-01      ---------FSHQETEGETSHHENHSN-RTE-------------------
A0A3P9B2E4_BAD-01      ---------VRMGVSQGLN-------------------------------
A0A668V3Q4_BAD-01      ---------FSHQETEGENNHLENHNQ-RTE-------------------
I3K7B6_BAD-01          ---------FSHQETEGENNHLENHNQ-RTE-------------------
A0A3Q3C680_BAD-01      ---------FSHQETEGENNHLENHNQ-RTE-------------------
A0A3P8QRJ7_BAD-01      ---------FSHQETEGENNHLENHNQ-RTE-------------------
A0A3Q4GGN3_BAD-01      ---------FSHQETEGENNHLENHNQ-RTE-------------------
A0A3B4GXJ6_BAD-01      ---------FSHQETEGENNHLENHNQ-RTE-------------------
A0A3Q2D5S0_BAD-01      ---------FSHQEMEGENSHHENHTQ-CTEQRGE---------------
A0A3Q0QNQ2_BAD-01      ---------FSHQESDGENSHHENHTQ-RTE-------------------
A0A3P8WI83_BAD-01      ---------FSHQELEGENNHHENHTH-RTE-------------------
A0A3P8WI83_BAD-02      ---------FSHQELEGENNHHENHTH-RTE-------------------
A0A3P9HNZ2_BAD-01      ---------FSHPEAEGEYSHHESQ---RTE-------------------
A0A3B3BQF7_BAD-01      ---------FSHPEAEGEYSHHESH---RTE-------------------
A0A4W6EMZ7_BAD-02      ---------FSHQETEGENNHHENHTH-RTE-------------------
A0A672JQ68_BAD-01      ---------FSHQETEGENNHHENHSHDRTE-------------------
A0A2U9BAC9_BAD-01      ---------FSHQEMEGENNHHENHTQ-RNE-------------------
A0A4W6EMZ7_BAD-01      ---------FSHQETEGENNHHENHTH-RTE-------------------
A0A3B4VFC5_BAD-01      ---------FSHQETEGENNHHENHTH-RTE-------------------
A0A3B4W9T1_BAD-01      ---------FSHQETEGENNHHENHTH-RTE-------------------
A0A3Q1K1C7_BAD-01      ---------FSHQETEGENNHHESHTH-RTE-------------------
A0A3Q1K1C7_BAD-02      ---------FSHQETEGENNHHESHTH-RTE-------------------
A0A672YF93_BAD-01      ---------FSHQEMEGENSHHENHKN-RTE-------------------
A0A3Q1GWH9_BAD-01      ---------FSHQEMEGENNHHESHTH-RNE-------------------
A0A3Q1CPU7_BAD-01      ---------FSHQEMEGENNHHESHTH-RNE-------------------
A0A3P8TWH6_BAD-01      ---------FSHQEMEGENNHHESHTH-RNE-------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      ---------WSHKESDSEASSSRPAE------------------------
A0A5F8GA49_BAD-01      ----------NLGKGGAGPSH-----------------------------
H3ANP3_BAD-03          ------------GQPRDPPGQ-----------------------------
H3ANP3_BAD-04          ------------GQPRDPPGQ-----------------------------
H3ANP3_BAD-01          ------------GQPRDPPGQQGVSIRGPD--------------------
H3ANP3_BAD-02          ------------GQPRDPPGQQGVSIRGPD--------------------
A0A4X2KAA5_BAD-01      ----------SLGKGSAA-----GPSH-----------------------
G3VRY3_BAD-01          ----------NLGKGS-V-----GPSH-----------------------
G3VRY3_BAD-02          ----------NLGKGS-V-----GPSH-----------------------
A0A672V9F8_BAD-01      LTAPPRVPPPRFGGGGPRFR---GGGQ-----------------------
A0A674GQ16_BAD-01      DRPPPQ--KPHLGRGAPKCCREWGGGQ-----------------------
A0A6I8NVP2_BAD-01      ----------SSSSAQ----------------------------------
G3TP47_BAD-01          ----------NLGRGSSAPSQ-----------------------------
Q61337_BAD-05          --------------------------------------------------
A0A287CT05_BAD-02      ----------A---------------------------------------
A0A287CT05_BAD-01      ----------NLGRRGSAPSQ-----------------------------
Q61337_BAD-04          ----------NLGKGGSTPSQ-----------------------------
Q61337_BAD-03          ----------NLGKGGSTPSQ-----------------------------
Q61337_BAD-06          ----------NLGKGGSTPSQ-----------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          ----------NLGKGGSTPSQ-----------------------------
G5B6Q3_BAD-01          ----------NLGRGGSAPSQ-----------------------------
G5B6Q3_BAD-02          ----------NLGRGGSAPSQ-----------------------------
A0A2I3TBK7_BAD-01      -------------RGSVLSPLEGGLTPIPFRCV-----------------
A0A2R8Z674_BAD-02      -------------RGSVLSPLEGGLTQIPFRCV-----------------
A0A2I2YFH2_BAD-03      -------------RGSVLSPLEGRLTQIPFRCV-----------------
Q92934_BAD-03          -------------RGSVLSPLEGGLTQIPFRCV-----------------
A0A2K5M0A7_BAD-02      -------------RGSVLPLSVGGLTQIPFRCM-----------------
A0A2K5XJR2_BAD-02      -------------RGSVLPLSVGGLTQIPFRCM-----------------
A0A096MLD5_BAD-03      -------------RGSVLPLSVGGLTQIPFRCM-----------------
A0A2K5VCA1_BAD-02      -------------RGSVLPLSVGGLTQIPFRCM-----------------
A0A2K6E7I4_BAD-02      -------------RGSVLPLSVGGLTQIPFRCM-----------------
A0A2K5PDB1_BAD-02      ----------------------GGLTQIPFRCV-----------------
A0A2K5E6A6_BAD-02      ----------------------GELTQIPFRCV-----------------
A0A2K6TG62_BAD-02      ----------------------GGLTQIPFRCV-----------------
A0A2K5HKU7_BAD-02      ----------TSGQHSDMAASSGG--------------------------
A0A2K6N196_BAD-02      ----------TSGQHSDMAASSGG--------------------------
A0A2K6PUL3_BAD-02      ----------TSGQHSDMAASSGG--------------------------
A0A2K5M0A7_BAD-03      ----------TSGQHSVMAASSGG--------------------------
A0A2K5VCA1_BAD-03      ----------TSGQHSVMAASSGG--------------------------
A0A2K5XJR2_BAD-03      ----------TSGQHSVMAASSGG--------------------------
A0A096MLD5_BAD-02      ----------TSGQHSVMAASSGG--------------------------
A0A2K6E7I4_BAD-03      ----------TSGQHSVMAASSGG--------------------------
A0A2I2YFH2_BAD-04      ----------TSGQHSAMAASSGG--------------------------
Q92934_BAD-04          ----------TSGQHSAMAASSGG--------------------------
A0A2I3TBK7_BAD-03      ----------TSGQHSAMAASSGG--------------------------
A0A2R8Z674_BAD-03      ----------TSGQHSAMAASSGG--------------------------
A0A2K5E6A6_BAD-03      ----------TSGQHSAMAASSGG--------------------------
A0A2K5PDB1_BAD-03      ----------TSGQHSAMAASSGG--------------------------
A0A2K6TG62_BAD-03      ----------TSGQHSDMAASSGG--------------------------
G1P8C5_BAD-01          ----------NSGRGGSAPSQ-----------------------------
A0A452ER54_BAD-02      ----------NLGRGGSAPSQ-----------------------------
W5P8G9_BAD-01          ----------NLGRGGSAPSQ-----------------------------
Q61337_BAD-07          ----------PVPSPGLCLHL-----------------------------
O35147_BAD-01          ----------NLGKGGSTPSQ-----------------------------
F7DN67_BAD-01          ----------NLGRGGSAPSQ-----------------------------
Q45KI9_BAD-01          ----------NLGRGGSAPSQ-----------------------------
A0A3Q7SWS0_BAD-01      ----------NLGRGGSAPSQ-----------------------------
H0WVR2_BAD-01          ----------NVGRGGSAPCQ-----------------------------
A0A2K6GWV0_BAD-01      ----------NVGRGGSAPSQ-----------------------------
H0V608_BAD-01          ----------NLGRGGSAPSQESV--------------------------
A0A2K5PDB1_BAD-01      ----------NLGRGGSAPSQ-----------------------------
U3F2S3_BAD-01          ----------NLGRGGSAPSQ-----------------------------
A0A2K5E6A6_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A2K6TG62_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A0D9R491_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2K5M0A7_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2K5VCA1_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A1D5QBW1_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2K6E7I4_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2K5XJR2_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A096MLD5_BAD-04      ----------NLGRGSSAPSQ-----------------------------
A0A2K6N196_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2K6PUL3_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2K5HKU7_BAD-01      ----------NLGRGSSAPSQ-----------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2I2YFH2_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2I2YFH2_BAD-02      ----------NLGRGSSAPSQ-----------------------------
Q92934_BAD-01          ----------NLGRGSSAPSQ-----------------------------
Q92934_BAD-02          ----------NLGRGSSAPSQ-----------------------------
A0A2I3TBK7_BAD-02      ----------NLGRGSSAPSQ-----------------------------
A0A2R8Z674_BAD-01      ----------NLGRGSSAPSQ-----------------------------
A0A2J8TYJ3_BAD-01      ----------NLGRGSSAPSQ-----------------------------
G1MI17_BAD-01          ----------NLGRGGSAPSQ-----------------------------
A0A4X1VE31_BAD-02      ----------NSGRGGPAPSQ-----------------------------
A0A4X1VE31_BAD-01      ----------HLGS------------------------------------
A0A287AEF3_BAD-01      ----------NSGRGGPAPSQ-----------------------------
A0A4X1VE31_BAD-03      ----------NSGRGGPAPSQ-----------------------------
A0A671ELU4_BAD-01      -------------RGGSASSQ-----------------------------
A0A452ER54_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A452RJM6_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A384DJL2_BAD-01      ----------NLGRGGSAPSQ-----------------------------
M3YNE7_BAD-01          ----------NLGRGGSAPSQ-----------------------------
A0A667H8Z9_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A673V6P8_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A2Y9EHU3_BAD-01      ----------NLGRGGPAPSQ-----------------------------
A0A4W2C9A8_BAD-01      ----------NLGRGGSAPSQ-----------------------------
A0A4W2C9A8_BAD-01      ----------NLGRGGSAPSQ-----------------------------
F1MUT9_BAD-01          ----------NLGRGGSAPSQ-----------------------------
Q3SYZ0_BAD-01          ----------NLGRGGSAPSQ-----------------------------
A0A6F9BAV3_BAD-01      ---------WSPKEAEGR--------------E-----------------
A0A3P9A5G8_BAD-02      ---------WSPKEAEGR--------------D-----------------
A0A4W5R1T6_BAD-01      ---------WSPKESEGR--------------E-----------------
A0A060W8P9_BAD-01      ---------WSPNEAEGR--------------E-----------------
B5X1T1_BAD-01          ---------WSPKKAEGR--------------E-----------------
A0A673ZHY7_BAD-01      ---------WSPKKAEGR--------------E-----------------
A0A671NP27_BAD-01      ---------WSHKESDAE----------SRPAE-----------------
A0A672SAE4_BAD-01      ---------WSHKESDAE----------SRPAE-----------------
A0A672SAE4_BAD-02      ---------WSHKESDAE----------SRPAE-----------------
A0A671RUV0_BAD-01      ---------WSHKESDAE----------SRPAE-----------------
A0A673HRQ3_BAD-01      ---------WSHKESDAE----------SRPAE-----------------
A0A672RGH0_BAD-01      ---------WSHKESDAE----------SRPAE-----------------
Q4V925_BAD-03          ---------WSHKESDAE----------SRPAE-----------------
Q4V925_BAD-02          ---------WSHKESDAE----------SRPAE-----------------
A7MCM4_BAD-01          ---------WSHKESDAE----------SRPAE-----------------
Q4V925_BAD-01          ---------WSHKESDAE----------SRPAE-----------------
Q4V925_BAD-04          ---------WSHKESDAE----------SRPAE-----------------
A0A3B3QX41_BAD-01      ---------WSHKESDAE-ISGSLSTADSRAAQ-----------------
A0A3P8Y761_BAD-01      ---------FSHKETETE-KTPNLIITEPRSSE-----------------
A0A4W5JLL9_BAD-01      ---------FSHKETETE-HTPTI---PPRSSE-----------------
A0A3B5Q2N7_BAD-01      ---------FSHQETEGE---NNHHENHASRTE-----------------
A0A087X8P8_BAD-01      ---------FSHQETEGE---NNHHENHASRTE-----------------
A0A3B3UA11_BAD-01      ---------FSHQETEGE---NNHHENHASRTE-----------------
A0A3B3YFR1_BAD-01      ---------FSHQETEGE---NNHHENHASRTE-----------------
A0A3P9Q7C3_BAD-01      ---------FSHQETEGE---NNHHENHASRTE-----------------
A0A3B3HDU2_BAD-01      ---------FSHPEAEGE---YSHHE--SHRTE-----------------
A0A3P9KSL7_BAD-02      ---------FSHPEAEGE---YSHHE--SHRTENRDLLGWLRCSSDITVS
A0A3P9KSL7_BAD-01      ---------FSHPEAEGE---YSHHE--SHRTENRDLLGWLRCSSDITVS
A0A3B5BAL2_BAD-01      ---------FSHQELEGE---NNHHENHTHRNE-----------------
A0A665TUH3_BAD-01      ---------FSHQETEGE---NNHLE--SHRNE-----------------
A0A674MXC1_BAD-02      ---------FSHQETEGE---NGHHDGHTHRTE-----------------
A0A674MXC1_BAD-03      ---------FSHQETEGE---NGHHDGHTHRTE-----------------
A0A674MXC1_BAD-04      ---------FSHQETEGE---NGHHDGHTHRTE-----------------
A0A674MXC1_BAD-01      ---------FSHQETEGE---NGHHDGHTHRTE-----------------
A0A671TL42_BAD-01      ---------FSHQEMEGE---NNHHDNHTHRTE-----------------
A0A3Q3AEL8_BAD-02      ---------FSHQETDGE---SSHHEKPTHRTE-----------------
A0A3Q3AEL8_BAD-01      ---------FSHQETDGE---SSHHEKPTHRTE-----------------
G3Q8B3_BAD-01          ---------FSHQEMEGE---NNHHE------------------------
A0A3Q2Y0E4_BAD-01      ---------FSHQETEGENNNNNHHDNHANRTE-----------------
A0A3Q3R5S3_BAD-01      ---------FSHQETEGE---NTHHENAALAQEVERVVS-----------
A0A3Q3RXS8_BAD-02      ---------FSYQETDGE---NNLHENHTPRTE-----------------
A0A3Q3RXS8_BAD-01      ---------FSYQETDGE---NNLHENHTPRTE-----------------
A0A3Q0QNQ2_BAD-02      ---------FSHQESDGE---NSHHENHTQRTE-----------------
A0A3Q3WTY4_BAD-01      ---------FSHQETDGE---NNHHDSHTHRNE-----------------
                                                                         

Q61337_BAD-09          ----------------------------------------------
Q2PG01_BAD-01          ----------------------------------------------
A0A2I3H4B2_BAD-01      ----------------------------------------------
Q92934_BAD-06          ----------------------------------------------
Q92934_BAD-05          ----------------------------------------------
A0A670JUY4_BAD-01      ----------------------------------------------
A0A670YRG7_BAD-01      ----------------------------------------------
Q6P7C5_BAD-01          ----------------------------------------------
A0A3B1JLM2_BAD-01      ----------------------------------------------
A0A4W4DXF5_BAD-01      ----------------------------------------------
A0A452IFQ4_BAD-01      ----------------------------------------------
A0A674I2R9_BAD-01      ----------------------------------------------
C1C3S9_BAD-01          ----------------------------------------------
A0A6I8PXS6_BAD-01      ----------------------------------------------
A0A337SAW2_BAD-01      ----------------------------------------------
A0A673J9C6_BAD-01      ----------------------------------------------
A0A4W5JLL9_BAD-02      ----------------------------------------------
A0A674DKC6_BAD-01      ----------------------------------------------
A0A3P9A5G8_BAD-01      ----------------------------------------------
A0A3B4DUY7_BAD-01      ----------------------------------------------
A0A4W4HE29_BAD-01      ----------------------------------------------
A0A3B4CPH6_BAD-01      ----------------------------------------------
A0A674AVP9_BAD-01      ----------------------------------------------
A0A1S3L0Z2_BAD-01      ----------------------------------------------
B5XEF1_BAD-01          ----------------------------------------------
A0A4W5MZR2_BAD-01      ----------------------------------------------
A0A060W8W7_BAD-01      ----------------------------------------------
E7FBJ6_BAD-01          ----------------------------------------------
A0A673J5Q9_BAD-01      ----------------------------------------------
A0A671PX91_BAD-01      ----------------------------------------------
A0A672LB88_BAD-01      ----------------------------------------------
A0A673I6H5_BAD-01      ----------------------------------------------
A0A671SBB4_BAD-01      ----------------------------------------------
A0A672R7P6_BAD-01      ----------------------------------------------
A0A3P8Y761_BAD-02      ----------------------------------------------
A0A3B5L9R9_BAD-01      ----------------------------------------------
H3D8J8_BAD-01          ----------------------------------------------
A0A6F9CQZ0_BAD-02      ----------------------------------------------
A0A6F9CA11_BAD-02      ----------------------------------------------
A0A1S3N9Q3_BAD-01      ----------------------------------------------
A0A3Q2QC80_BAD-01      ----------------------------------------------
A0A3Q3FKT9_BAD-02      ----------------------------------------------
A0A3Q3FKT9_BAD-03      ----------------------------------------------
A0A667ZNC6_BAD-01      ----------------------------------------------
A0A3P9B2E4_BAD-01      ----------------------------------------------
A0A668V3Q4_BAD-01      ----------------------------------------------
I3K7B6_BAD-01          ----------------------------------------------
A0A3Q3C680_BAD-01      ----------------------------------------------
A0A3P8QRJ7_BAD-01      ----------------------------------------------
A0A3Q4GGN3_BAD-01      ----------------------------------------------
A0A3B4GXJ6_BAD-01      ----------------------------------------------
A0A3Q2D5S0_BAD-01      ----------------------------------------------
A0A3Q0QNQ2_BAD-01      ----------------------------------------------
A0A3P8WI83_BAD-01      ----------------------------------------------
A0A3P8WI83_BAD-02      ----------------------------------------------
A0A3P9HNZ2_BAD-01      ----------------------------------------------
A0A3B3BQF7_BAD-01      ----------------------------------------------
A0A4W6EMZ7_BAD-02      ----------------------------------------------
A0A672JQ68_BAD-01      ----------------------------------------------
A0A2U9BAC9_BAD-01      ----------------------------------------------
A0A4W6EMZ7_BAD-01      ----------------------------------------------
A0A3B4VFC5_BAD-01      ----------------------------------------------
A0A3B4W9T1_BAD-01      ----------------------------------------------
A0A3Q1K1C7_BAD-01      ----------------------------------------------
A0A3Q1K1C7_BAD-02      ----------------------------------------------
A0A672YF93_BAD-01      ----------------------------------------------
A0A3Q1GWH9_BAD-01      ----------------------------------------------
A0A3Q1CPU7_BAD-01      ----------------------------------------------
A0A3P8TWH6_BAD-01      ----------------------------------------------
A0A3Q3FKT9_BAD-01      ----------------------------------------------
A0A3B1IH05_BAD-01      ----------------------------------------------
A0A5F8GA49_BAD-01      ----------------------------------------------
H3ANP3_BAD-03          ----------------------------------------------
H3ANP3_BAD-04          ----------------------------------------------
H3ANP3_BAD-01          ----------------------------------------------
H3ANP3_BAD-02          ----------------------------------------------
A0A4X2KAA5_BAD-01      ----------------------------------------------
G3VRY3_BAD-01          ----------------------------------------------
G3VRY3_BAD-02          ----------------------------------------------
A0A672V9F8_BAD-01      ----------------------------------------------
A0A674GQ16_BAD-01      ----------------------------------------------
A0A6I8NVP2_BAD-01      ----------------------------------------------
G3TP47_BAD-01          ----------------------------------------------
Q61337_BAD-05          ----------------------------------------------
A0A287CT05_BAD-02      ----------------------------------------------
A0A287CT05_BAD-01      ----------------------------------------------
Q61337_BAD-04          ----------------------------------------------
Q61337_BAD-03          ----------------------------------------------
Q61337_BAD-06          ----------------------------------------------
Q61337_BAD-02          ----------------------------------------------
Q61337_BAD-01          ----------------------------------------------
G5B6Q3_BAD-01          ----------------------------------------------
G5B6Q3_BAD-02          ----------------------------------------------
A0A2I3TBK7_BAD-01      ----------------------------------------------
A0A2R8Z674_BAD-02      ----------------------------------------------
A0A2I2YFH2_BAD-03      ----------------------------------------------
Q92934_BAD-03          ----------------------------------------------
A0A2K5M0A7_BAD-02      ----------------------------------------------
A0A2K5XJR2_BAD-02      ----------------------------------------------
A0A096MLD5_BAD-03      ----------------------------------------------
A0A2K5VCA1_BAD-02      ----------------------------------------------
A0A2K6E7I4_BAD-02      ----------------------------------------------
A0A2K5PDB1_BAD-02      ----------------------------------------------
A0A2K5E6A6_BAD-02      ----------------------------------------------
A0A2K6TG62_BAD-02      ----------------------------------------------
A0A2K5HKU7_BAD-02      ----------------------------------------------
A0A2K6N196_BAD-02      ----------------------------------------------
A0A2K6PUL3_BAD-02      ----------------------------------------------
A0A2K5M0A7_BAD-03      ----------------------------------------------
A0A2K5VCA1_BAD-03      ----------------------------------------------
A0A2K5XJR2_BAD-03      ----------------------------------------------
A0A096MLD5_BAD-02      ----------------------------------------------
A0A2K6E7I4_BAD-03      ----------------------------------------------
A0A2I2YFH2_BAD-04      ----------------------------------------------
Q92934_BAD-04          ----------------------------------------------
A0A2I3TBK7_BAD-03      ----------------------------------------------
A0A2R8Z674_BAD-03      ----------------------------------------------
A0A2K5E6A6_BAD-03      ----------------------------------------------
A0A2K5PDB1_BAD-03      ----------------------------------------------
A0A2K6TG62_BAD-03      ----------------------------------------------
G1P8C5_BAD-01          ----------------------------------------------
A0A452ER54_BAD-02      ----------------------------------------------
W5P8G9_BAD-01          ----------------------------------------------
Q61337_BAD-07          ----------------------------------------------
O35147_BAD-01          ----------------------------------------------
F7DN67_BAD-01          ----------------------------------------------
Q45KI9_BAD-01          ----------------------------------------------
A0A3Q7SWS0_BAD-01      ----------------------------------------------
H0WVR2_BAD-01          ----------------------------------------------
A0A2K6GWV0_BAD-01      ----------------------------------------------
H0V608_BAD-01          ----------------------------------------------
A0A2K5PDB1_BAD-01      ----------------------------------------------
U3F2S3_BAD-01          ----------------------------------------------
A0A2K5E6A6_BAD-01      ----------------------------------------------
A0A2K6TG62_BAD-01      ----------------------------------------------
A0A0D9R491_BAD-01      ----------------------------------------------
A0A2K5M0A7_BAD-01      ----------------------------------------------
A0A2K5VCA1_BAD-01      ----------------------------------------------
A0A1D5QBW1_BAD-01      ----------------------------------------------
A0A2K6E7I4_BAD-01      ----------------------------------------------
A0A2K5XJR2_BAD-01      ----------------------------------------------
A0A096MLD5_BAD-04      ----------------------------------------------
A0A2K6N196_BAD-01      ----------------------------------------------
A0A2K6PUL3_BAD-01      ----------------------------------------------
A0A2K5HKU7_BAD-01      ----------------------------------------------
B4DZQ9_BAD-01          ----------------------------------------------
A0A096MLD5_BAD-01      ----------------------------------------------
A0A2I2YFH2_BAD-01      ----------------------------------------------
A0A2I2YFH2_BAD-02      ----------------------------------------------
Q92934_BAD-01          ----------------------------------------------
Q92934_BAD-02          ----------------------------------------------
A0A2I3TBK7_BAD-02      ----------------------------------------------
A0A2R8Z674_BAD-01      ----------------------------------------------
A0A2J8TYJ3_BAD-01      ----------------------------------------------
G1MI17_BAD-01          ----------------------------------------------
A0A4X1VE31_BAD-02      ----------------------------------------------
A0A4X1VE31_BAD-01      ----------------------------------------------
A0A287AEF3_BAD-01      ----------------------------------------------
A0A4X1VE31_BAD-03      ----------------------------------------------
A0A671ELU4_BAD-01      ----------------------------------------------
A0A452ER54_BAD-01      ----------------------------------------------
A0A452RJM6_BAD-01      ----------------------------------------------
A0A384DJL2_BAD-01      ----------------------------------------------
M3YNE7_BAD-01          ----------------------------------------------
A0A667H8Z9_BAD-01      ----------------------------------------------
A0A673V6P8_BAD-01      ----------------------------------------------
A0A2Y9EHU3_BAD-01      ----------------------------------------------
A0A4W2C9A8_BAD-01      ----------------------------------------------
A0A4W2C9A8_BAD-01      ----------------------------------------------
F1MUT9_BAD-01          ----------------------------------------------
Q3SYZ0_BAD-01          ----------------------------------------------
A0A6F9BAV3_BAD-01      ----------------------------------------------
A0A3P9A5G8_BAD-02      ----------------------------------------------
A0A4W5R1T6_BAD-01      ----------------------------------------------
A0A060W8P9_BAD-01      ----------------------------------------------
B5X1T1_BAD-01          ----------------------------------------------
A0A673ZHY7_BAD-01      ----------------------------------------------
A0A671NP27_BAD-01      ----------------------------------------------
A0A672SAE4_BAD-01      ----------------------------------------------
A0A672SAE4_BAD-02      ----------------------------------------------
A0A671RUV0_BAD-01      ----------------------------------------------
A0A673HRQ3_BAD-01      ----------------------------------------------
A0A672RGH0_BAD-01      ----------------------------------------------
Q4V925_BAD-03          ----------------------------------------------
Q4V925_BAD-02          ----------------------------------------------
A7MCM4_BAD-01          ----------------------------------------------
Q4V925_BAD-01          ----------------------------------------------
Q4V925_BAD-04          ----------------------------------------------
A0A3B3QX41_BAD-01      ----------------------------------------------
A0A3P8Y761_BAD-01      ----------------------------------------------
A0A4W5JLL9_BAD-01      ----------------------------------------------
A0A3B5Q2N7_BAD-01      ----------------------------------------------
A0A087X8P8_BAD-01      ----------------------------------------------
A0A3B3UA11_BAD-01      ----------------------------------------------
A0A3B3YFR1_BAD-01      ----------------------------------------------
A0A3P9Q7C3_BAD-01      ----------------------------------------------
A0A3B3HDU2_BAD-01      ----------------------------------------------
A0A3P9KSL7_BAD-02      HVTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQR-----------
A0A3P9KSL7_BAD-01      HVTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQARQNFLEPSIRT
A0A3B5BAL2_BAD-01      ----------------------------------------------
A0A665TUH3_BAD-01      ----------------------------------------------
A0A674MXC1_BAD-02      ----------------------------------------------
A0A674MXC1_BAD-03      ----------------------------------------------
A0A674MXC1_BAD-04      ----------------------------------------------
A0A674MXC1_BAD-01      ----------------------------------------------
A0A671TL42_BAD-01      ----------------------------------------------
A0A3Q3AEL8_BAD-02      ----------------------------------------------
A0A3Q3AEL8_BAD-01      ----------------------------------------------
G3Q8B3_BAD-01          ----------------------------------------------
A0A3Q2Y0E4_BAD-01      ----------------------------------------------
A0A3Q3R5S3_BAD-01      ----------------------------------------------
A0A3Q3RXS8_BAD-02      ----------------------------------------------
A0A3Q3RXS8_BAD-01      ----------------------------------------------
A0A3Q0QNQ2_BAD-02      ----------------------------------------------
A0A3Q3WTY4_BAD-01      ----------------------------------------------
                                                                     

© 1998-2021Legal notice