Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

175 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
A8MXU7_BAD-05          --------------------------------------------------
A8MXU7_BAD-06          --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A4W4DXF5_BAD-01      --------------------------------------------------
A0A3P8Y761_BAD-02      --------------------------------------------------
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A2D0SYM2_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      -----------MLSPSPPLPFPTYPLSLSASPPVSFPLSTSLFPSLSTSP
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-03      ------------------------------------------------MK
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      ----------------------------------------MYRNKCCLVI
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A5F8GA49_BAD-01      --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z688_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
A8MXU7_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
A8MXU7_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z688_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A1U7Q4V0_BAD-01      --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A091DDU4_BAD-01      --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA9_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A8MXU7_BAD-01          --------------------------------------------------
A8MXU7_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z688_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A4X1VE31_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
A0A4X1VE31_BAD-03      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
A8MXU7_BAD-05          --------------------------------------------------
A8MXU7_BAD-06          --------------------------------------------------
Q6P7C5_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
A0A3B1JLM2_BAD-01      ----MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWN
A0A4W4DXF5_BAD-01      ----MHNQYLLRLRKANFTRED--YKKVIKAKTLREEG--ETPSNTSCWN
A0A3P8Y761_BAD-02      -------------------------------------------MGCSTPY
A0A3P9A5G8_BAD-01      -----------------MFYSFCHSPCDECFLTICNAF--GQCLLRM--D
A0A2D0SYM2_BAD-01      ------MSNQYLLRLRKARFNFDKEEYTKVINTRIGSEGGGTILNHFFGN
A0A3B4DUY7_BAD-01      ------MSNQYLQKLRRARFNCEEERYKKVIKTLTGEK--GTPFNPLCWN
E7FBJ6_BAD-01          --------------------------------------------------
A0A4W5MZR2_BAD-01      --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-02      LSLCPLSFISLYPLSPHLFPLSLHPSSPPSHSFLVSPLSLTPLPPSSSVD
A0A3Q2QC80_BAD-01      ---------MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLPD
A0A3Q3FKT9_BAD-02      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-03      CNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGVLD
A0A3Q2D5S0_BAD-01      -----------------------------------------MAQSVETSD
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      ----------------------------------------MNVEVSIFPD
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-02      ICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRVQFLLNLPSPD
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A4W6EMZ7_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          -----------------------------------------------MGD
A0A4W4HE29_BAD-01      -----MFNSSFDFDRLRKVCAARHREQQPPADQTSRSVSVSYREFTSAAG
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A4W5R1T6_BAD-01      ------------------------------------MAIINTIIHCGCPF
B5X1T1_BAD-01          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A4W5JLL9_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-01      -------------------------------------------MTLTASD
A0A3B1IH05_BAD-01      --------------------------------MSTAARAAAGTCDSTAVS
A0A5F8GA49_BAD-01      MTVSLTQATGAGLPPKQERGGGGGESPGAEHRDLAAAPRESETPSWPDDA
A0A3B3QX41_BAD-01      -----------------------------------------------MSG
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A4X2KAA5_BAD-01      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z688_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
A8MXU7_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A096MLD5_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5PDB1_BAD-02      --------------------------------------------------
A0A2K5E6A6_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-03      --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
A8MXU7_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z688_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      ------------------------------------------------YR
W5P8G9_BAD-01          --------------------------------------------QGPRYR
G3TP47_BAD-01          ----------------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSS
A0A287CT05_BAD-01      ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A287CT05_BAD-02      ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A1U7Q4V0_BAD-01      ---------MGTPKQPSLAPAHALGVRKS---DPGIRSLGNDAGGRRRRP
Q61337_BAD-02          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
Q61337_BAD-01          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
A0A091DDU4_BAD-01      --------------------------------------------------
G5B6Q3_BAD-02          --------------------------------------------------
G5B6Q3_BAD-01          ---------MRTPENPSPAPTNAEGLRKL---ELGIRRLES---------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
O35147_BAD-01          -----------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPA
F7DN67_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
A0A3Q7SWS0_BAD-01      --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
U3F2S3_BAD-01          --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0A7_BAD-01      --------------------------------------------------
A0A2K5VCA9_BAD-01      --------------------------------------------------
A0A1D5QBW1_BAD-01      --------------------------------------------------
A0A2K6E7I4_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A096MLD5_BAD-04      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A8MXU7_BAD-01          --------------------------------------------------
A8MXU7_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z688_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          -----------VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALAPT
A0A4X1VE31_BAD-01      -----------------MGSSGGKKLWLARPSPSTEEPLPLPSTGNRGPS
A0A4X1VE31_BAD-02      --------------------------------------------------
A0A287AEF3_BAD-01      -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSG
A0A4X1VE31_BAD-03      -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRQG
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      -------------------MGTPENPSAAPTTRKLSIRRRRRESGGRQWA
A0A4W2C9A8_BAD-01      --------------------------------------------------
A0A4W2C9A8_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          ----------ME--------------------------------------
A0A2I3H4B2_BAD-01      ----------MG--------------------------------------
A8MXU7_BAD-05          ----------MG--------------------------------------
A8MXU7_BAD-06          ----------MG--------------------------------------
Q6P7C5_BAD-01          PAAQSMFQI-PE-FEPSEQEDA--------ST------------------
A0A3B1JLM2_BAD-01      SSGSTVFTMEKT-PPHSKEDDI--------SPIDDHD-------------
A0A4W4DXF5_BAD-01      PFRVTAFTMEKA--PCGQRDDI--------SALDDQD-------------
A0A3P8Y761_BAD-02      RNGISTSTILPH-TTGTGDRLL--------PY---GL-------------
A0A3P9A5G8_BAD-01      VFSLQAFKM--D-HTQDCVGDI--------PENINEKYDLDHLGTTHYPE
A0A2D0SYM2_BAD-01      SSRITAFTM--D-ETPQSVRGD--------AGPVDDK------------E
A0A3B4DUY7_BAD-01      SLRTTACAM--E-KHSED--GI--------STMDDQD------------E
E7FBJ6_BAD-01          ----MENTS-HD-HQDDSSTLD--------EK---ER-------------
A0A4W5MZR2_BAD-01      ----------MD-HTHDCVDEC--------ES---DH-------------
B5XEF1_BAD-01          ----------MD-YTHDCVDEC--------ES---DH-------------
H3D8J8_BAD-01          --MAAKFSLCSD-SDSEPSEEV--------EE------------------
A0A3B5L9R9_BAD-01      --MDTKFTI-SD-GESDPSEDV--------EE------------------
A0A3B4CPH6_BAD-01      --MAHMFTL-SD--DSDTSEDL--------GD---AD-------------
A0A4W5JLL9_BAD-02      VSMAQMFTI-SD-SESEPSEEV--------GE---TE-------------
A0A3Q2QC80_BAD-01      DTMAAKFTI-SD-SDSEPPEEV--------EE---EG-------------
A0A3Q3FKT9_BAD-02      --MAAKFTI-SD-SESGSEEEV--------KE---EE-------------
A0A3P9B2E4_BAD-01      --MAANFKI-SD-SDSEASEEV--------GE---GE-------------
I3K7B6_BAD-01          --MAANFTI-SD-SESETSEEV--------GE---EE-------------
A0A3Q3C680_BAD-01      --MAANFKI-SD-SDSEASEEV--------GE---EE-------------
A0A3P8QRJ7_BAD-01      --MAANFKI-SD-SDSEASEEV--------GE---GE-------------
A0A3Q4GGN3_BAD-01      --MAANFKI-SD-SDSETSEEV--------GE---GE-------------
A0A3B4GXJ6_BAD-01      --MAANFKI-SD-SDSEASEEV--------GE---GE-------------
A0A3Q3FKT9_BAD-03      VTMAAKFTI-SD-SESGSEEEV--------KE---EE-------------
A0A3Q2D5S0_BAD-01      PIMAATFTI-SD-SDTEPSEEV--------EETRNKE-------------
A0A3Q0QNQ2_BAD-01      --FIHFLPF-IQ-GRGQQPSHL--------LQLIWGT-------------
A0A3P8WI83_BAD-01      --MAAQFTI-SD-SESEPEEEV--------EG---GK-------------
A0A3P8WI83_BAD-02      VTMAAQFTI-SD-SESEPEEEV--------EG---GK-------------
A0A3P9HNZ2_BAD-01      --MAAKFTI-SD--DSESSEEV--------EG---GK-------------
A0A3B3BQF7_BAD-01      --MAAKFSI-SD-NDSESSEEV--------EG---GR-------------
A0A3Q1K1C7_BAD-01      --MAARFTI-SD-SDSDPSEGM--------EE---EG-------------
A0A3Q1K1C7_BAD-02      --MAARFTI-SD-SDSDPSEGM--------EE---EG-------------
A0A3Q1GWH9_BAD-01      --MAAKFSI-SD-GDSEPEE----------VE---GE-------------
A0A3Q1CPU7_BAD-01      --MAAKFTI-SD-SESEPSEEV--------EE---GE-------------
A0A3P8TWH6_BAD-01      --MAAKFTI-SD-SESEPSEEV--------EE---GE-------------
A0A4W6EMZ7_BAD-02      VTMAANFTI-SD-SESEASEEV--------EE---GE-------------
A0A2U9BAC9_BAD-01      --MAANFTI-SD-SESEPSEEV--------EE---GE-------------
A0A4W6EMZ7_BAD-01      --MAANFTI-SD-SESEASEEV--------EE---GE-------------
A0A3B4VFC5_BAD-01      --MAANFTI-SD-SESEPSEEV--------DE---GE-------------
A0A3B4W9T1_BAD-01      --MAANFTI-SD-SESEPSEEV--------DE---GE-------------
A0A452IFQ4_BAD-01      -----MFRI-QE-FP----DEV--------FP------------------
C1C3S9_BAD-01          SPHKSMFSI-EE-FPPTERGSA--------FS------------------
A0A4W4HE29_BAD-01      QLSEVVFTM-AQMFTISDTESD--------TS------------------
A0A337SAW2_BAD-01      AWAQSMFQI-PE-FEPSEQEDS--------SP------------------
A0A3P9A5G8_BAD-02      --MAFKMDH-TQ-DCVGDIPEN--------IN------------------
A0A4W5R1T6_BAD-01      SLQIFTMNH-TH-DCVDDNPET--------MN------------------
B5X1T1_BAD-01          ------MDH-TH-DCVDDNPET--------MN------------------
Q4V925_BAD-02          --MAHMFNI-SD-DSETETMED--------SE------------------
Q4V925_BAD-03          --MAHMFNI-SD-DSETETMED--------SE------------------
A7MCM4_BAD-01          --MAHMFNI-SD-DSETETMED--------SE------------------
Q4V925_BAD-01          --MAHMFNI-SD-DSETETMED--------SE------------------
Q4V925_BAD-04          --MAHMFNI-SD-DSETETMED--------SE------------------
A0A3P8Y761_BAD-01      --MENIFT--IS-DTESESSDV----------------------------
A0A4W5JLL9_BAD-01      --MAQMFT--IS-DSESEPSEE--------VG------------------
A0A3B5Q2N7_BAD-01      --MDTKFT--IS-DGESDPSED--------VE------------------
A0A087X8P8_BAD-01      --MDAKFT--IS-DSDSEPSED--------VE------------------
A0A3B3UA11_BAD-01      --MDAKFT--IS-DSDSEPSED--------VE------------------
A0A3B3YFR1_BAD-01      --MDAKFT--IS-DSDSEPSED--------VE------------------
A0A3P9Q7C3_BAD-01      --MDAKFT--IS-DSDSEPSED--------VE------------------
A0A3B3HDU2_BAD-01      --MAAKFT--IS-D-DSESSEE--------VE------------------
A0A3P9KSL7_BAD-01      --MAAKFT--IS-D-DSESSEE--------VE------------------
A0A3P9KSL7_BAD-02      --MAAKFT--IS-D-DSESSEE--------VE------------------
A0A3B5BAL2_BAD-01      --MAAQFS--IS-GSESDP-EE--------VE------------------
A0A3Q3AEL8_BAD-01      --MAAKFT--IS-DSESEPSDE--------VE------------------
A0A3Q3AEL8_BAD-02      --MAAKFT--IS-DSESEPSDE--------VE------------------
G3Q8B3_BAD-01          --MAAHFT--IS-DSESEPSDG--------VE------------------
A0A3Q2Y0E4_BAD-01      --MAANFS--IS-DSESEPSEE--------VE------------------
A0A3Q3R5S3_BAD-01      --MAANFT--IS-DSESESSEE--------VE------------------
A0A3Q3RXS8_BAD-01      --MAAKFS--IS-ESESDSSEE--------VE------------------
A0A3Q3RXS8_BAD-02      --MAAKFS--IS-ESESDSSEE--------VE------------------
A0A3Q0QNQ2_BAD-02      ----------MP-EPPRLVLFD--------VE------------------
A0A3Q3WTY4_BAD-01      --MATNFTI-SS-DSESELSEE--------IE------------------
A0A3Q3FKT9_BAD-01      VTMAAKFTI-SD-SESGSEEEV----------------------------
A0A3B1IH05_BAD-01      QPSKLDFTM-DH-MFTISDESD--------AS------------------
A0A5F8GA49_BAD-01      SRPVSMFQI-PE-FEPGEQEDG----------------------------
A0A3B3QX41_BAD-01      VTMAHMFTI-SG-NESDTSESD----------------------------
H3ANP3_BAD-03          -----MFQI-SD-SDSDAYEDDRTGPLPLQSG------------------
H3ANP3_BAD-04          -----MFQI-SD-SDSDAYEDDRTGPLPLQSG------------------
H3ANP3_BAD-01          -----MFQI-SD-SDSDAYEDDRTGPLPLQSG------------------
H3ANP3_BAD-02          -----MFQI-SD-SDSDAYEDDRTGPLPLQSG------------------
A0A4X2KAA5_BAD-01      ---MSMFQI-SE-FEPSEQETP--------KE------------------
G3VRY3_BAD-01          -----MFQI-SE-FEPSE--------------------------------
G3VRY3_BAD-02          -----MFQI-SE-FEPSE--------------------------------
A0A2I3TBK7_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2R8Z688_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2I2Z8C7_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A8MXU7_BAD-03          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5M0A7_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5XJR2_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A096MLD5_BAD-03      -----MFQI-PE-FEPSEQEDS--------RS------------------
A0A2K5VCA9_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6E7I4_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5PDB1_BAD-02      -----MFQI-PE-FEPSEQEGS--------SS------------------
A0A2K5E6A6_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6TG62_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5HKU7_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6N196_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6PUL3_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5M0A7_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5VCA9_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5XJR2_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A096MLD5_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6E7I4_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2I2Z8C7_BAD-04      -----MFQI-PE-FEPSEQEDS--------SS------------------
A8MXU7_BAD-04          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2I3TBK7_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2R8Z688_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5E6A6_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5PDB1_BAD-03      -----MFQI-PE-FEPSEQEGS--------SS------------------
A0A2K6TG62_BAD-03      -----MFQI-PE-FEPSEQEDS--------SS------------------
G1P8C5_BAD-01          PTAQSMFQI-PE-FEHSEQEDS--------SP------------------
A0A452ER54_BAD-02      AWAQSMFQI-PE-FEQSEQEDS--------SP------------------
W5P8G9_BAD-01          AWAQSMFQI-PE-FEQSEQEDS--------SP------------------
G3TP47_BAD-01          GGLQSMFQI-PE-FEQSDREDS--------TP------------------
A0A287CT05_BAD-01      AWTQSMFQI-PE-FEPSEQEDS--------SS------------------
A0A287CT05_BAD-02      AWTQSMFQI-PE-FEPSEQEDS--------SS------------------
A0A1U7Q4V0_BAD-01      A-AQSMFQI-PE-FEPSEQEDS--------NT------------------
Q61337_BAD-02          A-AQSMFQI-PE-FEPSEQEDA--------SA------------------
Q61337_BAD-01          A-AQSMFQI-PE-FEPSEQEDA--------SA------------------
A0A091DDU4_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
G5B6Q3_BAD-02          -----MFQI-PE-FEPSEQEDS--------SS------------------
G5B6Q3_BAD-01          --AQSMFQI-PE-FEPSEQEDS--------SS------------------
Q61337_BAD-05          -----MFQI-PE-FEPSEQEDA--------SA------------------
Q61337_BAD-03          -----MFQI-PE-FEPSEQEDA--------SA------------------
Q61337_BAD-04          -----MFQI-PE-FEPSEQEDA--------SA------------------
Q61337_BAD-06          -----MFQI-PE-FEPSEQEDA--------SA------------------
Q61337_BAD-07          ------XQI-PE-FEPSEQEDA--------SA------------------
O35147_BAD-01          AQS--MFQI-PE-FEPSEQEDA--------ST------------------
F7DN67_BAD-01          -----MFQI-PE-FEQSEPEDS--------SP------------------
Q45KI9_BAD-01          -----MFQI-PE-FEPSEQEDS--------SP------------------
A0A3Q7SWS0_BAD-01      -----MFQI-PE-FEPSEQEDS--------SP------------------
H0WVR2_BAD-01          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6GWV0_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
H0V608_BAD-01          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A1S3FL84_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5PDB1_BAD-01      -----MFQI-PE-FEPSEQEGS--------SS------------------
U3F2S3_BAD-01          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5E6A6_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6TG62_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A0D9R491_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5M0A7_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5VCA9_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A1D5QBW1_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6E7I4_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5XJR2_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A096MLD5_BAD-04      -----MFQI-PE-FEPSEQEDS--------RS------------------
A0A2K6N196_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K6PUL3_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2K5HKU7_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
B4DZQ9_BAD-01          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A096MLD5_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2I2Z8C7_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2I2Z8C7_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A8MXU7_BAD-01          -----MFQI-PE-FEPSEQEDS--------SS------------------
A8MXU7_BAD-02          -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2I3TBK7_BAD-02      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2R8Z688_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
A0A2J8TYJ3_BAD-01      -----MFQI-PE-FEPSEQEDS--------SS------------------
G1MI17_BAD-01          AQS--MFQI-PE-FEPSEQEDS--------SP------------------
A0A4X1VE31_BAD-01      LRAQSMFQI-PE-FEQSEQEDS--------SP------------------
A0A4X1VE31_BAD-02      -----MFQI-PE-FEQSEQEDS--------SP------------------
A0A287AEF3_BAD-01      PASQSMFQI-PE-FEQSEQEDS--------SP------------------
A0A4X1VE31_BAD-03      YLSQSMFQI-PE-FEQSEQEDS--------SP------------------
M3YNE7_BAD-01          -----MFQI-PE-FEPSEQEDS--------SP------------------
A0A452RJM6_BAD-01      -----MFQI-PE-FEPSEQEDS--------SP------------------
A0A384DJL2_BAD-01      -----MFQI-PE-FEPSEQEDS--------SP------------------
A0A452ER54_BAD-01      GPRGSMFQI-PE-FEQSEQEDS--------SP------------------
A0A4W2C9A8_BAD-01      -----MFQI-PE-FEQSEQEDS--------SP------------------
A0A4W2C9A8_BAD-01      -----MFQI-PE-FEQSEQEDS--------SP------------------
F1MUT9_BAD-01          -----MFQI-PE-FEQSEQEDS--------SP------------------
Q3SYZ0_BAD-01          -----MFQI-PE-FEQSEQEDS--------SR------------------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
A8MXU7_BAD-05          --------------------------------------------------
A8MXU7_BAD-06          --------------------------------------------------
Q6P7C5_BAD-01          ---TDRGLGPSLTEDQP-------GPYLAPGLLGSIVQQQPGQAANNSH-
A0A3B1JLM2_BAD-01      ---ESRWSEAVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVR-LYSESQ-
A0A4W4DXF5_BAD-01      ---ESRWSETIESDDSPRISNHHIMPNNTAT----EVGGRVR-LYSESQ-
A0A3P8Y761_BAD-02      ---FCLITIGTRDGTGAYGLFWLRNTHIHPLILCSFFIGEGR-IRLNSE-
A0A3P9A5G8_BAD-01      FQFCNTSTNTSNRTLP-----------------------GVR-VRLYSE-
A0A2D0SYM2_BAD-01      SRWSETVENTDSP---------------------S---VGGR-VRLYSE-
A0A3B4DUY7_BAD-01      SNWSETVKNGDSPQLDSQHSMASNISPASPDELSE---VGCR-VRLYSE-
E7FBJ6_BAD-01          ---SHLKGTIK----------NHGQHQDRTSANIS---PQGR-VRLYSE-
A0A4W5MZR2_BAD-01      ---SGTTHNSE----------FQLHVSTTMSTRPR---PGER-VRLYSE-
B5XEF1_BAD-01          ---SGTTRNSE----------FQLHVSTTMSNRPR---PGER-VRLYSE-
H3D8J8_BAD-01          ----------------------------GERGSFS---TSGR-IRVNSE-
A0A3B5L9R9_BAD-01      ---------------------------------------RGD-LQLMQE-
A0A3B4CPH6_BAD-01      ---QPEASKRA---------------------ELS---QSGQ-HPLVPE-
A0A4W5JLL9_BAD-02      ---KDQLAAGK-----GMTGGPIGHALTVPEMRLA---GEGR-LRMNSE-
A0A3Q2QC80_BAD-01      ---NDQPADGK------VEPLRQRHALTLPELR-S---GHGR-IRLNSE-
A0A3Q3FKT9_BAD-02      ---NDQSSAVE------EPHVPQRHSLTLPELRLA---GTGR-IRLNSE-
A0A3P9B2E4_BAD-01      ---NQQSAGQA--------QESKPQTLSLPVTKTT---AAGR-LRVNSE-
I3K7B6_BAD-01          ---NQQPAGQD--------QESKPQTLALPVIKTT---GAGR-LRLNSE-
A0A3Q3C680_BAD-01      ---NQQSAGQA--------QESKPQTLSLPVIKTT---AAGR-LRVNSE-
A0A3P8QRJ7_BAD-01      ---NQQSAGQA--------QESKPQTLSLPVTKTT---AAGR-LRVNSE-
A0A3Q4GGN3_BAD-01      ---NQQSARQV--------QESKPQTLSLPVIKTT---AAGR-LRVNSE-
A0A3B4GXJ6_BAD-01      ---NQQSAGQA--------QESKPQTLSLPVIKTT---AAGR-LRVNSE-
A0A3Q3FKT9_BAD-03      ---NDQSSAVE------EPHVPQRHSLTLPELRLA---GTGR-IRLNSE-
A0A3Q2D5S0_BAD-01      ---PRIRNSGK---------------------------THRR-IRLSSE-
A0A3Q0QNQ2_BAD-01      ---PRHSQAIG-------------HDQNTSPMRHP---TARR-IRMNSE-
A0A3P8WI83_BAD-01      ---IKHSLNDP------EQVVPHRHNLTLPELRVA---GSRR-IRLNSE-
A0A3P8WI83_BAD-02      ---IKHSLNDP------EQVVPHRHNLTLPELRVA---GSRR-IRLNSE-
A0A3P9HNZ2_BAD-01      ---LDLGAAGG-GGGGEGEHLHDRHSLTLPELRLT---SNGR-TRLNSE-
A0A3B3BQF7_BAD-01      ---LDLAASGGEGGGGGGGHLHDRHALTLPELRLT---SNGR-TRLNSE-
A0A3Q1K1C7_BAD-01      ---HNQSPPGQ------EQQVFPRHTLTLPELR-----ASGR-IRLNSE-
A0A3Q1K1C7_BAD-02      ---HNQSPPGQ------EQQVFPRHTLTLPELR-----ASGR-IRLNSE-
A0A3Q1GWH9_BAD-01      ---NNHSPATE------AMPVFARRNMALPELRTP---ASGR-IRLNSE-
A0A3Q1CPU7_BAD-01      ---NNHSPATQ------AMPVFARRNMALPELRTP---ASGR-LRLNSE-
A0A3P8TWH6_BAD-01      ---NNHSPATQ------AMPVFARRNMALPELRTP---ASGR-LRLNSE-
A0A4W6EMZ7_BAD-02      ---MNQSSTEQ------EQQIPQRNTVTLPELRLP---VPGR-IRLNSE-
A0A2U9BAC9_BAD-01      ---VSQPWTGP------GEQVPPRHTLALPELRMA---ATGR-IRLNSE-
A0A4W6EMZ7_BAD-01      ---MNQSSTEQ------EQQIPQRNTVTLPELRLP---VPGR-IRLNSE-
A0A3B4VFC5_BAD-01      ---MSQSLTGQ------EQELSQRHTLTLPELRGA---ATGR-TRLNSE-
A0A3B4W9T1_BAD-01      ---MSQSLTGQ------EQELSQRHTLTLPELRGA---ATGR-TRLNSE-
A0A452IFQ4_BAD-01      ---GRGKEAPAPPESQR-------GHTPGSKQPDTPTAEVRS-RIGSDT-
C1C3S9_BAD-01          ---GTN---PPGFGGDP-------GHKSSPNLRRIKGKETRQ-RTESAS-
A0A4W4HE29_BAD-01      ---EGPGDTDQQGDSKEAEPSQSEQHLHVPNTLRGEWTARQR-----NH-
A0A337SAW2_BAD-01      ---TDRGLGPSPTGDRPRGPGK--HQRTTPGLLGEAGHQQGQ-PASSNH-
A0A3P9A5G8_BAD-02      ---EKYDLDHLGTTHYP---EFQFCNTSTNTSNRTLPGVRVR-LYSESQ-
A0A4W5R1T6_BAD-01      ---EKDESDHSGTTHYP---EFQLHTVSTTTSTRPRPGGRVR-LYSESQ-
B5X1T1_BAD-01          ---EHDESDHSGTTHYP---EFQRHYVSTRTGIRPRPGGRVR-LYSESQ-
Q4V925_BAD-02          ---DSSLDKHKSGSAQK------KQHLTVPD----------R-LKGEQL-
Q4V925_BAD-03          ---DSSLDKHKSGSAQK------KQHLTVPD----------R-LKGEQL-
A7MCM4_BAD-01          ---ASSLDKHKSGSAQK------KQHLTVPD----------R-LKGEQL-
Q4V925_BAD-01          ---DSSLDKHKSGSAQK------KQHLTVPD----------R-LKGEQL-
Q4V925_BAD-04          ---DSSLDKHKSGSAQK------KQHLTVPD----------R-LKGEQL-
A0A3P8Y761_BAD-01      ---EETKKEWIAGQGKT--GSRLGLSLNLP------GEGRIR-LNSESQ-
A0A4W5JLL9_BAD-01      ---ETEKDQLAAGKGMT--GGPIGHALTVPEMR-LAGEGRLR-MNSESQ-
A0A3B5Q2N7_BAD-01      ---ERGDLQLMQEKEKP--L-SQRHTLTLPELR--STTGRVR-LNSESI-
A0A087X8P8_BAD-01      ---ERGNLQLMQVKERP--L-SQRHTLTLPELR--STTGRVR-LNSESI-
A0A3B3UA11_BAD-01      ---ERGNLQLMQVKERP--L-SQRHTLTLPELR--STTGRVR-LNSESI-
A0A3B3YFR1_BAD-01      ---ERGNLQLMQVKERP--L-SQRHTLTLPELR--STTGRVR-LNSESI-
A0A3P9Q7C3_BAD-01      ---ERGNLQLMQVKERP--L-SQRHTLTLPELR--STTGRVR-LNSESI-
A0A3B3HDU2_BAD-01      ---GGKLDLGAAAGGEGEHL-HDRHSLTLPELR-LTSNGRTR-LNSEST-
A0A3P9KSL7_BAD-01      ---GGKLDLGAAAGGEGEHL-HDRHSLTLPELR-LTSNGRTR-LNSEST-
A0A3P9KSL7_BAD-02      ---GGKLDLGAAAGGEGEHL-HDRHSLTLPELR-LTSNGRTR-LNSEST-
A0A3B5BAL2_BAD-01      ---EGENNHPPAEQPMH--V-FERRNLALPELR-TPAAGRIR-LNSESH-
A0A3Q3AEL8_BAD-01      ---EGKSKQPAAGPEDG-----VRQRLTLPELR-HSKNGRLR-VNSESL-
A0A3Q3AEL8_BAD-02      ---EGKSKQPAAGPEDG-----VRQRLTLPELR-HSKNGRLR-VNSESL-
G3Q8B3_BAD-01          ---EREDGQLSSGQEQQ--R-LQRHTLTLPELRLSGRKSQRI-VEKE---
A0A3Q2Y0E4_BAD-01      ---EGDDGQGAAEKEQEQCL-RQGLRLTLPELPMEAMSGRIR-LNSESH-
A0A3Q3R5S3_BAD-01      ---EGKHSQSSTSQEQQ--V-PPCHSLTLPELRMAATS-RNR-VSSESN-
A0A3Q3RXS8_BAD-01      ---GGKQKKSSARQEQQ--V-SQRHALALPELR-TTASNRIR-LSSES--
A0A3Q3RXS8_BAD-02      ---GGKQKKSSARQEQQ--V-SQRHALALPELR-TTASNRIR-LSSES--
A0A3Q0QNQ2_BAD-02      ---EGQSPFREGSFLLL--VSVISFFWSLPKAF-SR--------DEEL--
A0A3Q3WTY4_BAD-01      ---EGENSQLQTEQEQQ--V-FQRHTLTLPELR-MA--------GRTL--
A0A3Q3FKT9_BAD-01      ---KEEENDQSSAVEEPHVPQR--HSLTLPELRLAGTGRIRLNSESHAY-
A0A3B1IH05_BAD-01      ---EELGDSDQPEVSKTAEPSRSGQHITVPEKLRVEPRQRNFSMNEEAL-
A0A5F8GA49_BAD-01      -------------------------SERAPGQPGGPGRRSSAAPGAQRH-
A0A3B3QX41_BAD-01      --------TPDVTANSQLGNNL--KNTKNPGEAGGRVRMRSESQVSSIRS
H3ANP3_BAD-03          ---GGRGEGSEPS-EKTAGLKK--HSRTAPNLQNPGPHQSHP-PSHTGV-
H3ANP3_BAD-04          ---GGRGEGSEPS-EKTAGLKK--HSRTAPNLQNPGPHQSHP-PSHTVF-
H3ANP3_BAD-01          ---GGRGEGSEPS-EKTAGLKK--HSRTAPNLQNPGPHQSHP-PSH----
H3ANP3_BAD-02          ---GGRGEGSEPS-EKTAGLKK--HSRTAPNLQNPGPHQSHP-PSH----
A0A4X2KAA5_BAD-01      ---DGFAYAPG----ESRGLGK--HSATAPSLAPVRPGPRPA-PGAHHH-
G3VRY3_BAD-01          ---------PG----EDPS------ASTAPSLAPLRPGPRAA-PGAHHH-
G3VRY3_BAD-02          ---------PG----EDPS------ASTAPSLAPLRPGPRAA-PGAHHH-
A0A2I3TBK7_BAD-01      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2R8Z688_BAD-02      ---AERGLGPSPAGDGPSGSSK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2I2Z8C7_BAD-03      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A8MXU7_BAD-03          ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5M0A7_BAD-02      ---AERGLGPSLAGDRPSDCGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5XJR2_BAD-02      ---AERGLGPSLAGDRPSDCGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A096MLD5_BAD-03      ---AERGLGPSPAGDKPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5VCA9_BAD-02      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K6E7I4_BAD-02      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5PDB1_BAD-02      ---AERGLNPSTAGDSPPGSGK--HRRQAPGLPGDASHQQGQ-PTSSSH-
A0A2K5E6A6_BAD-02      ---AERGLSPSTAGDRPPGSGK--HPRQAPGLPGDASHQQGQ-PTSSSH-
A0A2K6TG62_BAD-02      ---AERGLSPSTAGDSPPGSGK--HRRQAPGLPGDASHQQGQ-PTSSSH-
A0A2K5HKU7_BAD-02      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-ATSSSH-
A0A2K6N196_BAD-02      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K6PUL3_BAD-02      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5M0A7_BAD-03      ---AERGLGPSLAGDRPSDCGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5VCA9_BAD-03      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5XJR2_BAD-03      ---AERGLGPSLAGDRPSDCGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A096MLD5_BAD-02      ---AERGLGPSPAGDKPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K6E7I4_BAD-03      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2I2Z8C7_BAD-04      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A8MXU7_BAD-04          ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2I3TBK7_BAD-03      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2R8Z688_BAD-03      ---AERGLGPSPAGDGPSGSSK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5E6A6_BAD-03      ---AERGLSPSTAGDRPPGSGK--HPRQAPGLPGDASHQQGQ-PTSSSH-
A0A2K5PDB1_BAD-03      ---AERGLNPSTAGDSPPGSGK--HRRQAPGLPGDASHQQGQ-PTSSSH-
A0A2K6TG62_BAD-03      ---AERGLSPSTAGDSPPGSGK--HRRQAPGLPGDASHQQGQ-PTSSSH-
G1P8C5_BAD-01          ---ADRGLGPCPTGDQPPGLNK--HWSTVPGLLGEAGHQQGQ-PASSSH-
A0A452ER54_BAD-02      ---ADRGLGPSPTGDRPPGLSK--HWLTAPGLLGEAGHQQGQ-PAGSSH-
W5P8G9_BAD-01          ---ADRGLGPSPTGDRPPGLSK--HWLTAPGLLGEAGHQQGQ-PAGSSH-
G3TP47_BAD-01          ---ADRGLGPSPEGYWPSGPSD--RHRVAPGFLRDSSHQQGQ-PTSSGH-
A0A287CT05_BAD-01      ---AEGGLGPSPAGDRPGCG-------LAPGLPRDTGHQQWQ-ATSSSN-
A0A287CT05_BAD-02      ---AEGGLGPSPAGDRPGCG-------LAPGLPRDTGHQQWQ-ATSSSN-
A0A1U7Q4V0_BAD-01      ---ADRGLGPSLTGDPPGPC-------LAPGLLGNIRHQQEQ-AANSSH-
Q61337_BAD-02          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
Q61337_BAD-01          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
A0A091DDU4_BAD-01      ---EERGLGPSPIGDQLGPS-------PARGFLGDTSHQQRQ-LFSSRH-
G5B6Q3_BAD-02          ---EERALGPTPTGDRLGPS-------SPGGFLGDISHQQRQ-LISSRH-
G5B6Q3_BAD-01          ---EERALGPTPTGDRLGPS-------SPGGFLGDISHQQRQ-LISSRH-
Q61337_BAD-05          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
Q61337_BAD-03          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
Q61337_BAD-04          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
Q61337_BAD-06          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
Q61337_BAD-07          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSNIHQQGR-AATNSH-
O35147_BAD-01          ---TDRGLGPSLTEDQPGPY-------LAPGLLGSIVQQQPGQAANNSH-
F7DN67_BAD-01          ---ADRGLGPSPTGDWPSDPVR--HQRTAPGLLGEAGHQQGQ-PASSSH-
Q45KI9_BAD-01          ---ANRGLGPSPTGDRPPSPGK--HQQTAPGLLGEAGHQQGQ-PASRKH-
A0A3Q7SWS0_BAD-01      ---ANRGLGPSPTGDRP------------PGLLGEAGHQQGQ-PASRKH-
H0WVR2_BAD-01          ---SDRGLGPSPSGDQPLGPGK--NRCTTPSLLGDASHLQGQ-PASNTH-
A0A2K6GWV0_BAD-01      ---AGRGLGPSPSGDRPSGPGK--HPCTAPSFLGDASHQQGQ-PSSSSH-
H0V608_BAD-01          ---EERGLGPSPTGDELGSS-------PAGGFLGDTSHQQRQLRSSRSH-
A0A1S3FL84_BAD-01      ---ADRGLGPSLC--------------PAPGLLGDHSPQQGL-PTSRSH-
A0A2K5PDB1_BAD-01      ---AERGLNPSTAGDSPPGSGK--HRRQAPGLPGDASHQQGQ-PTSSSH-
U3F2S3_BAD-01          ---AERGLSPSTAGDRPPGSGK--HRRQAPGLPGDASHQQGQ-STSSSH-
A0A2K5E6A6_BAD-01      ---AERGLSPSTAGDRPPGSGK--HPRQAPGLPGDASHQQGQ-PTSSSH-
A0A2K6TG62_BAD-01      ---AERGLSPSTAGDSPPGSGK--HRRQAPGLPGDASHQQGQ-PTSSSH-
A0A0D9R491_BAD-01      ---AERGLGPSPAGNRPSDSGK--HHHQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5M0A7_BAD-01      ---AERGLGPSLAGDRPSDCGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5VCA9_BAD-01      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A1D5QBW1_BAD-01      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K6E7I4_BAD-01      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5XJR2_BAD-01      ---AERGLGPSLAGDRPSDCGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A096MLD5_BAD-04      ---AERGLGPSPAGDKPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K6N196_BAD-01      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K6PUL3_BAD-01      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2K5HKU7_BAD-01      ---AERGLGPSPAGDRPSDSGK--HHRQAPGLLWDASHQQEQ-ATSSSH-
B4DZQ9_BAD-01          ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A096MLD5_BAD-01      ---AERGLGPSPAGDKPSDSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2I2Z8C7_BAD-01      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2I2Z8C7_BAD-02      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A8MXU7_BAD-01          ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A8MXU7_BAD-02          ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2I3TBK7_BAD-02      ---AERGLGPSPAGDGPSGSGK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2R8Z688_BAD-01      ---AERGLGPSPAGDGPSGSSK--HHRQAPGLLWDASHQQEQ-PTSSSH-
A0A2J8TYJ3_BAD-01      ---AERGLGPSPAGDRPSGSSK--HHRQAPGLLRDASHQQEQ-PTSSSH-
G1MI17_BAD-01          ---ADRGLGPSPTGDQPPGPGK--HRQTAPGLLGEAAHPQGQ-PASSNH-
A0A4X1VE31_BAD-01      ---ADRGLGPSPTGDRPPGPSK--PWRTAPGHLGEAGHQQGQ-PASSSH-
A0A4X1VE31_BAD-02      ---ADRGLGPSPTGDRPPGPSK--PWRTAPGHLGEAGHQQGQ-PASSSH-
A0A287AEF3_BAD-01      ---ADRGLGPSPTGTDP----Q--PWRTAPGHLGEAGHQQGQ-PASSSH-
A0A4X1VE31_BAD-03      ---ADRGLGPSPTGDRPPGPSK--PWRTAPGHLGEAGHQQGQ-PASSSH-
M3YNE7_BAD-01          ---ADRGLGPSPTGDQPPGLGK--HLQTAPGLLGEAGHQQGQ-PASSSH-
A0A452RJM6_BAD-01      ---ADRGLGPSPTGDQPPGPGK--HRQTAPGLLGEAAQPQGQ-PASSNH-
A0A384DJL2_BAD-01      ---ADRGLGPSPTGDQPPGPGK--HRQTAPGLLGEAAHPQGQ-PASSNH-
A0A452ER54_BAD-01      ---ADRGLGPSPTGDRPPGLT--------PGLLGEAGHQQGQ-PAGSSH-
A0A4W2C9A8_BAD-01      ---ADRGLGPSPTGDRPPGLSK--HWLTAPGLLGEAGHQQGQ-PAGSSH-
A0A4W2C9A8_BAD-01      ---ADRGLGPSPTGDRPPGLSK--HWLTAPGLLGEAGHQQGQ-PAGSSH-
F1MUT9_BAD-01          ---ADRGLGPSPTGDRPPGLSK--HWLTAPGLLGEAGHQQGQ-PAGSSH-
Q3SYZ0_BAD-01          ---ADRGLGPSPTGDRPPGLSK--HWLTAPGLLGEAGHQQGQ-PAGSSH-
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
A8MXU7_BAD-05          --------------------------------------------------
A8MXU7_BAD-06          --------------------------------------------------
Q6P7C5_BAD-01          ------HG------------------------------------------
A0A3B1JLM2_BAD-01      ----------------VYNINRWEDNE-----------NQDG--------
A0A4W4DXF5_BAD-01      ----------------AYTVSHWEDTE-----------SQDG--------
A0A3P8Y761_BAD-02      ----------------SQVFA-TSGGERSG--------ELQG--------
A0A3P9A5G8_BAD-01      ----------------SQVCSQVGRQDNTE--------FQVA--------
A0A2D0SYM2_BAD-01      ----------------SQVHT-VSRWEDAE--------LQDG--------
A0A3B4DUY7_BAD-01      ----------------SQVYT-VSRWQDNE----------DG--------
E7FBJ6_BAD-01          ----------------SQVYT-VSRWQDTETQ------D--G--------
A0A4W5MZR2_BAD-01      ----------------SQVCSQVGKRENTEFQ------DVMT--------
B5XEF1_BAD-01          ----------------SQVRSQVGKREDTEFQ------DVMT--------
H3D8J8_BAD-01          ----------------SQASA-VSRDE-----------ELQG--------
A0A3B5L9R9_BAD-01      ----------------KEKPL-SQRHTLTLPELRSTKVELQA--------
A0A3B4CPH6_BAD-01      ----------------RFRES-RQRNH-----------SMNE--------
A0A4W5JLL9_BAD-02      ----------------SQA-------Q-----------ELQG--------
A0A3Q2QC80_BAD-01      ----------------SHAST-ISREE-----------ELQG--------
A0A3Q3FKT9_BAD-02      ----------------SHAYT-VSRDE-----------ELQA--------
A0A3P9B2E4_BAD-01      ----------------SHTSS-IARDE-----------ELMA--------
I3K7B6_BAD-01          ----------------SHTSS-VARDE-----------DLMA--------
A0A3Q3C680_BAD-01      ----------------SHTSS-IARDE-----------ELMA--------
A0A3P8QRJ7_BAD-01      ----------------SHTSS-IARDE-----------ELMA--------
A0A3Q4GGN3_BAD-01      ----------------SHTSS-IARDE-----------ELMA--------
A0A3B4GXJ6_BAD-01      ----------------SHTSS-IARDE-----------ELMA--------
A0A3Q3FKT9_BAD-03      ----------------SHAYT-VSRDE-----------ELQA--------
A0A3Q2D5S0_BAD-01      ----------------SHA---FTREE-----------E--A--------
A0A3Q0QNQ2_BAD-01      ----------------SHTSS-VSRDE-----------ELVV--------
A0A3P8WI83_BAD-01      ----------------SHAST-ISREE-----------AFQS--------
A0A3P8WI83_BAD-02      ----------------SHAST-ISREE-----------AFQS--------
A0A3P9HNZ2_BAD-01      ----------------STAST-YSRDE-----------DLAR--------
A0A3B3BQF7_BAD-01      ----------------STVST-YSRDE-----------DLPR--------
A0A3Q1K1C7_BAD-01      ----------------SHAST-VYRDE-----------ELQA--------
A0A3Q1K1C7_BAD-02      ----------------SHAST-VYRDE-----------ELQA--------
A0A3Q1GWH9_BAD-01      ----------------SHAST-LSRDE-----------ELQA--------
A0A3Q1CPU7_BAD-01      ----------------SHAST-LSRDE-----------ELQA--------
A0A3P8TWH6_BAD-01      ----------------SHAST-LSRDE-----------ELQA--------
A0A4W6EMZ7_BAD-02      ----------------SHAST-ASRDE-----------GLQV--------
A0A2U9BAC9_BAD-01      ----------------SNAST-LSRDE-----------ELLT--------
A0A4W6EMZ7_BAD-01      ----------------SHAST-ASRDE-----------GLQV--------
A0A3B4VFC5_BAD-01      ----------------SHTST-VSRDE-----------EFQA--------
A0A3B4W9T1_BAD-01      ----------------SHTST-VSRDE-----------EFQA--------
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
A0A4W4HE29_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A3P9A5G8_BAD-02      ----------------VCSQVGRQDNT-----------EFQV--------
A0A4W5R1T6_BAD-01      ----------------VFSHVGRRDDT-----------EFQD--------
B5X1T1_BAD-01          ----------------VCSQVGRRDNT-----------EFQD--------
Q4V925_BAD-02          ----------------GRQRNLSMNEE-----------DLLE--------
Q4V925_BAD-03          ----------------GRQRNLSMNEE-----------DLLE--------
A7MCM4_BAD-01          ----------------GRQRNLSMNEE-----------DLLE--------
Q4V925_BAD-01          ----------------GRQRNLSMNEE-----------DLLE--------
Q4V925_BAD-04          ----------------GRQRNLSMNEE-----------DLLE--------
A0A3P8Y761_BAD-01      ----------------VFATSGGERSG-----------ELQG--------
A0A4W5JLL9_BAD-01      -------------------------AQ-----------ELQG--------
A0A3B5Q2N7_BAD-01      ------------------ASTISR-EV-----------ELQA--------
A0A087X8P8_BAD-01      ------------------ASTISR-EE-----------ELQA--------
A0A3B3UA11_BAD-01      ------------------ASTISR-EE-----------ELQA--------
A0A3B3YFR1_BAD-01      ------------------ASTISR-EE-----------ELQA--------
A0A3P9Q7C3_BAD-01      ------------------ASTISR-EE-----------ELQA--------
A0A3B3HDU2_BAD-01      ------------------ASTYSRDE--------------DL--------
A0A3P9KSL7_BAD-01      ------------------ASTYSRDE--------------DL--------
A0A3P9KSL7_BAD-02      ------------------ASTYSRDE--------------DL--------
A0A3B5BAL2_BAD-01      ------------------ATTVSR-DE-----------ELQA--------
A0A3Q3AEL8_BAD-01      ------------------SSTSSRGEE-----------ELPA--------
A0A3Q3AEL8_BAD-02      ------------------SSTSSRGEE-----------ELPA--------
G3Q8B3_BAD-01          ----------------------------------------EE--------
A0A3Q2Y0E4_BAD-01      ------------------ALAVSR-EE-----------EFQA--------
A0A3Q3R5S3_BAD-01      ------------------ASTVQ-----------------DA--------
A0A3Q3RXS8_BAD-01      ----------------------------------------QS--------
A0A3Q3RXS8_BAD-02      ----------------------------------------QS--------
A0A3Q0QNQ2_BAD-02      ----------------------------------------VV--------
A0A3Q3WTY4_BAD-01      ----------------------------------------QV--------
A0A3Q3FKT9_BAD-01      --------------------TVSRDEE-----------LQAR--------
A0A3B1IH05_BAD-01      ------QESGA-----GRHEDGARDG------------------------
A0A5F8GA49_BAD-01      ------EGAGD---------RRPRLIS-----------YPPL--------
A0A3B3QX41_BAD-01      EDLDFGEG-GA---------------------------------------
H3ANP3_BAD-03          ------YG-WVKLRKRNNMEILGRPSS-----------E-----------
H3ANP3_BAD-04          ------WG-FT-----DNMEILGRPSS-----------E-----------
H3ANP3_BAD-01          ----------T-----DNMEILGRPSS-----------E-----------
H3ANP3_BAD-02          ----------T-----DNMEILGRPSS-----------E-----------
A0A4X2KAA5_BAD-01      ------EGAGA-----GAGDRRPRLIS-----------YPPL--------
G3VRY3_BAD-01          ------EGAGA-----G----RPRLIS-----------YPPL--------
G3VRY3_BAD-02          ------EKGGA-----Q----KSQTHV-----------SKELKASASQGR
A0A2I3TBK7_BAD-01      ------HG-EG-----T--SSPEERGH-----------SN----------
A0A2R8Z688_BAD-02      ------HG-EG-----T--SSPEERGH-----------SN----------
A0A2I2Z8C7_BAD-03      ------HG-EG-----T--SSPEERRH-----------SN----------
A8MXU7_BAD-03          ------HG-EG-----T--SSPEERGH-----------SN----------
A0A2K5M0A7_BAD-02      ------HG-GT--------SSPEERGH-----------SD----------
A0A2K5XJR2_BAD-02      ------HG-GT--------SSPEERGH-----------SD----------
A0A096MLD5_BAD-03      ------HG-GT--------SSPEERGH-----------SD----------
A0A2K5VCA9_BAD-02      ------HG-GT--------SSPEERGH-----------SD----------
A0A2K6E7I4_BAD-02      ------HG-GT--------SSPEERGH-----------SD----------
A0A2K5PDB1_BAD-02      ------HG-GT--------SSPEERGH-----------SN----------
A0A2K5E6A6_BAD-02      ------HG-GT--------SSPEERGH-----------SN----------
A0A2K6TG62_BAD-02      ------HG-GT--------SSPEERGH-----------SN----------
A0A2K5HKU7_BAD-02      ------HG-GR-----AWYSPS-ESED-----------SE----------
A0A2K6N196_BAD-02      ------HG-GR-----AWYYPA-ESED-----------SE----------
A0A2K6PUL3_BAD-02      ------HG-GR-----AWYYPA-ESED-----------SE----------
A0A2K5M0A7_BAD-03      ------HG-GG-----AWYSPSWESED-----------SE----------
A0A2K5VCA9_BAD-03      ------HG-GR-----AWYSPSWESED-----------SE----------
A0A2K5XJR2_BAD-03      ------HG-GG-----AWYSPSWESED-----------SE----------
A0A096MLD5_BAD-02      ------HG-GR-----AWYSPSWESED-----------SE----------
A0A2K6E7I4_BAD-03      ------HG-GR-----AWYSPSWESED-----------SE----------
A0A2I2Z8C7_BAD-04      ------HG-GR-----TSYSPSWESED-----------SE----------
A8MXU7_BAD-04          ------HG-GR-----TSYSPSWESED-----------SE----------
A0A2I3TBK7_BAD-03      ------HG-GR-----TSYSPSWESED-----------SE----------
A0A2R8Z688_BAD-03      ------HG-GR-----TSYSPSWESED-----------SE----------
A0A2K5E6A6_BAD-03      ------HG-GE-------YSTCASASS-----------SE----------
A0A2K5PDB1_BAD-03      ------HG-------------------------------E----------
A0A2K6TG62_BAD-03      ------HG-------------------------------E----------
G1P8C5_BAD-01          ------HD-GA-----GSVEPRSRHSS-----------YPTG--------
A0A452ER54_BAD-02      ------HG-GT-----GAVETRSRHSS-----------YPAG--------
W5P8G9_BAD-01          ------HG-GT-----GAVETRSRHSS-----------YPAG--------
G3TP47_BAD-01          ------HG-GA-----AAVETRSRHSS-----------YPAG--------
A0A287CT05_BAD-01      ------HG-GA-----GATETRSRHSS-----------YPAD--------
A0A287CT05_BAD-02      ------HG-GA-----GATETRSRHSS-----------YPAD--------
A0A1U7Q4V0_BAD-01      ------HG-GT-----GAMETRSRHSS-----------YTAG--------
Q61337_BAD-02          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
Q61337_BAD-01          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
A0A091DDU4_BAD-01      ------HG-GA-----GAMETRSRHSS-----------YPTG--------
G5B6Q3_BAD-02          ------HG-GT-----GATETRSRHSS-----------YPTG--------
G5B6Q3_BAD-01          ------HG-GT-----GATETRSRHSS-----------YPTG--------
Q61337_BAD-05          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
Q61337_BAD-03          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
Q61337_BAD-04          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
Q61337_BAD-06          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
Q61337_BAD-07          ------HG-GA-----GAMETRSRHSS-----------YPAG--------
O35147_BAD-01          ------HG-GA-----GTMETRSRHSS-----------YPAG--------
F7DN67_BAD-01          ------HG-GA-----GAVETRSRHSS-----------YPEG--------
Q45KI9_BAD-01          ------HG-GA-----GA-ETRSRHSS-----------FPAG--------
A0A3Q7SWS0_BAD-01      ------HG-GA-----GA-ETRSRHSS-----------FPAG--------
H0WVR2_BAD-01          ------HGAGP-----GAVETRSRHSS-----------YPAG--------
A0A2K6GWV0_BAD-01      ------HG-GA-----GSVETRSRHSS-----------YPAG--------
H0V608_BAD-01          ------HG-GT-----VAMETRSRHRS-----------YPAG--------
A0A1S3FL84_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K5PDB1_BAD-01      ------HG-GA-----GAVETRSRHRS-----------YPAG--------
U3F2S3_BAD-01          ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K5E6A6_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K6TG62_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A0D9R491_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K5M0A7_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K5VCA9_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A1D5QBW1_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K6E7I4_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K5XJR2_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A096MLD5_BAD-04      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K6N196_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K6PUL3_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2K5HKU7_BAD-01      ------HG-GA-----GAVETRSRHSS-----------HPAG--------
B4DZQ9_BAD-01          ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A0A096MLD5_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A2I2Z8C7_BAD-01      ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A0A2I2Z8C7_BAD-02      ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A8MXU7_BAD-01          ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A8MXU7_BAD-02          ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A0A2I3TBK7_BAD-02      ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A0A2R8Z688_BAD-01      ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
A0A2J8TYJ3_BAD-01      ------HG-GA-----GAVEIRSRHSS-----------YPAG--------
G1MI17_BAD-01          ------HG-GA-----GAVEPRSRHSS-----------YPAG--------
A0A4X1VE31_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPEG--------
A0A4X1VE31_BAD-02      ------HG-GA-----GAVETRSRHSS-----------YPEG--------
A0A287AEF3_BAD-01      ------HG-GA-----GAVETRSRHSS-----------YPEG--------
A0A4X1VE31_BAD-03      ------HG-GA-----GAVETRSRHSS-----------YPEG--------
M3YNE7_BAD-01          ------HG-GA-----GAVETRSRHSS-----------YPAG--------
A0A452RJM6_BAD-01      ------HG-GA-----GAVEPRSRHSS-----------YPAG--------
A0A384DJL2_BAD-01      ------HG-GA-----GAVEPRSRHSS-----------YPAG--------
A0A452ER54_BAD-01      ------HG-GT-----GAVETRSRHSS-----------YPAG--------
A0A4W2C9A8_BAD-01      ------HG-GT-----GAVETRSRHSS-----------YRAG--------
A0A4W2C9A8_BAD-01      ------HG-GT-----GAVETRSRHSS-----------YRAG--------
F1MUT9_BAD-01          ------HG-GT-----GAVETRSRHSS-----------YRAG--------
Q3SYZ0_BAD-01          ------HG-GT-----GAVETRSRHSS-----------YRAG--------
                                                                         

Q61337_BAD-09          --------------------------------------------------
Q2PG01_BAD-01          -----------------------------------EEPSPFRGRSRSAPP
A0A2I3H4B2_BAD-01      -----------------------------------EEPSPFRGRSRSAPP
A8MXU7_BAD-05          -----------------------------------EEPSPFRGRSRSAPP
A8MXU7_BAD-06          -----------------------------------EEPSPFRGRSRSAPP
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------ASAED-GG------VGDGAPFRGRSQSAPA
A0A4W4DXF5_BAD-01      --------------------VSAEEGGG------ACEGAPFRGRSQSAPA
A0A3P8Y761_BAD-02      --------------------LGQGLNCV------ATEGLPFRVRSQSAPP
A0A3P9A5G8_BAD-01      --------------------MTPTE-ES------GGDAAPFRGRSQSAPP
A0A2D0SYM2_BAD-01      --------------------ISAEESGG------ASDGAPFRGRSQSAPA
A0A3B4DUY7_BAD-01      --------------------LLAED-GG------AGDGAPFRGRSQSAPA
E7FBJ6_BAD-01          --------------------ASVEENGD---------GLPFRGRSQSAPA
A0A4W5MZR2_BAD-01      --------------------PTEEGGGD---------GASFRGRSQSAPP
B5XEF1_BAD-01          --------------------PTEEGGGD---------GASFRGRSQSAPP
H3D8J8_BAD-01          --------------------NGDDEAGT------PTDGAPFRGRSRSAPP
A0A3B5L9R9_BAD-01      --------------------RGEEEVGT------PTEGFPFRGRSLSAPP
A0A3B4CPH6_BAD-01      --------------------DALQESGAVRHGDGAADGDSFRRRCRSAPP
A0A4W5JLL9_BAD-02      --------------------RGPGVEGM------PTDGASFRVRSQSAPP
A0A3Q2QC80_BAD-01      --------------------RAEEEAGT------PTEGLPFRNRSNSAPP
A0A3Q3FKT9_BAD-02      --------------------RGEEEAGT------PTEGAPFRGRSKSAPP
A0A3P9B2E4_BAD-01      --------------------RGEDEVCT------PTEGDPFRRRSKSAPP
I3K7B6_BAD-01          --------------------RGEDEVCT------PTEGDPFRRRSKSAPP
A0A3Q3C680_BAD-01      --------------------RGEDEVCT------PTEGDPFRRRSKSAPP
A0A3P8QRJ7_BAD-01      --------------------RGEDEVCT------PTEGDPFRRRSKSAPP
A0A3Q4GGN3_BAD-01      --------------------RGEDEVCT------PTEGDPFRRRSKSAPP
A0A3B4GXJ6_BAD-01      --------------------RGEDEVCT------PTEGDPFRRRSKSAPP
A0A3Q3FKT9_BAD-03      --------------------RGEEEAGT------PTEGAPFRGRSKSAPP
A0A3Q2D5S0_BAD-01      --------------------RGEEEVGT------PTEGYPFRGRSNSAPP
A0A3Q0QNQ2_BAD-01      --------------------RGEDEICT------PTEGDPFRRRSKSAPP
A0A3P8WI83_BAD-01      --------------------WGEEEAGT------PTEGAPFRGRSRSAPP
A0A3P8WI83_BAD-02      --------------------WGEEEAGT------PTEGAPFRGRSRSAPP
A0A3P9HNZ2_BAD-01      ----------------------EDEAGT------PTDGLAFRGRSKSAPP
A0A3B3BQF7_BAD-01      ----------------------EDEAGT------PTDGLAFRGRSKSAPP
A0A3Q1K1C7_BAD-01      --------------------KADEEAGT------PTDGAPFRARSKSAPP
A0A3Q1K1C7_BAD-02      --------------------KADEEAGT------PTDGAPFRARSKSAPP
A0A3Q1GWH9_BAD-01      --------------------KGEEEAGT------PTEGAPFRARSKSAPP
A0A3Q1CPU7_BAD-01      --------------------RGEEEAGT------PTDGAPFRARSKSAPP
A0A3P8TWH6_BAD-01      --------------------RGEEEAGT------PTDGAPFRARSKSAPP
A0A4W6EMZ7_BAD-02      --------------------RGEEEAGT------PTEGAPFRGRSKSAPP
A0A2U9BAC9_BAD-01      --------------------RWDEEAGT------PTDGAPFRGRSKSAPP
A0A4W6EMZ7_BAD-01      --------------------RGEEEAGT------PTEGAPFRGRSKSAPP
A0A3B4VFC5_BAD-01      --------------------RGEEEAGT------PTEGAPFRGRSKSAPP
A0A3B4W9T1_BAD-01      --------------------RGEEEAGT------PTEGAPFRGRSKSAPP
A0A452IFQ4_BAD-01      --------------------PSLEPEVQ------DEPGGAFRARSRSAPP
C1C3S9_BAD-01          --------------------EASETDSV------GEL-QHFRSRSRSAPS
A0A4W4HE29_BAD-01      --------------------SMNEAELQ------DSGAESFRRRSRSAPP
A0A337SAW2_BAD-01      --------------------TEEDEGTE------EEEPSPFRGRSRSAPP
A0A3P9A5G8_BAD-02      --------------------AMTPTEES------GGDAAPFRGRSQSAPP
A0A4W5R1T6_BAD-01      --------------------AMTPTEEG------GGDGAPFRSRSQSAPP
B5X1T1_BAD-01          --------------------VMTPTEEG------GGDGAPFRSRSQSAPP
Q4V925_BAD-02          --------------------TGVAE-DP------HMLGDPFRPRSRSAPP
Q4V925_BAD-03          --------------------TGVAE-DP------HMLGDPFRPRSRSAPP
A7MCM4_BAD-01          --------------------TGVAE-DP------HMLGDPFRPRSRSAPP
Q4V925_BAD-01          --------------------TGVAE-DP------HMLGDPFRPRSRSAPP
Q4V925_BAD-04          --------------------TGVAE-DP------HMLGDPFRPRSRSAPP
A0A3P8Y761_BAD-01      --------------------LGQGLNCV------ATEGLPFRVRSQSAPP
A0A4W5JLL9_BAD-01      --------------------RGPGVEGM------PTDGASFRVRSQSAPP
A0A3B5Q2N7_BAD-01      --------------------RGEEEVGT------PTEGFPFRGRSLSAPP
A0A087X8P8_BAD-01      --------------------RGEEEVGT------PTEGFPFRGRSNSAPP
A0A3B3UA11_BAD-01      --------------------RGEEEVGT------PTEGFPFRGRSNSAPP
A0A3B3YFR1_BAD-01      --------------------RGEEEVGT------PTEGFPFRGRSNSAPP
A0A3P9Q7C3_BAD-01      --------------------RGEEEVGT------PTEGFPFRVRSNSAPP
A0A3B3HDU2_BAD-01      --------------------AREDEAGT------PTDGLAFRGRSKSAPP
A0A3P9KSL7_BAD-01      --------------------AREDEAGT------PTDGLAFRGRSKSAPP
A0A3P9KSL7_BAD-02      --------------------AREDEAGT------PTDGLAFRGRSKSAPP
A0A3B5BAL2_BAD-01      --------------------RGEEEAGT------PTDGAPFRGRSKSAPP
A0A3Q3AEL8_BAD-01      --------------------RADDEPGT------PTEGYPFRGRSKSAPP
A0A3Q3AEL8_BAD-02      --------------------RADDEPGT------PTEGYPFRGRSKSAPP
G3Q8B3_BAD-01          --------------------LWLDETGT------PTEGAPFRVRSKSAPP
A0A3Q2Y0E4_BAD-01      --------------------RVDEEVGT------PTDGAPFRGRSKSAPP
A0A3Q3R5S3_BAD-01      --------------------KSDEEAGT------PTDGAPFRGRSKSAPP
A0A3Q3RXS8_BAD-01      --------------------RVDEEAGT------PTDGAPFRGRSKSAPP
A0A3Q3RXS8_BAD-02      --------------------RVDEEAGT------PTDGAPFRGRSKSAPP
A0A3Q0QNQ2_BAD-02      --------------------RGEDEICT------PTEGDPFRRRSKSAPP
A0A3Q3WTY4_BAD-01      --------------------KGEDEAGT------PTDGAPFRGRSKSAPP
A0A3Q3FKT9_BAD-01      --------------------GEEEAGTP------TEG-APFRGRSKSAPP
A0A3B1IH05_BAD-01      --------------------------------------DSFRRRSRSAPP
A0A5F8GA49_BAD-01      -------REGPAVEVGPEAGAQAERAEA------EEDRGLFRSRSSSAPP
A0A3B3QX41_BAD-01      --------------------SEEGGGVC------PGDGTPFRGRSRSAPP
H3ANP3_BAD-03          --------------------SQISDSES------LDELGPFRTRSRSAPP
H3ANP3_BAD-04          --------------------SQISDSES------LDELGPFRTRSRSAPP
H3ANP3_BAD-01          --------------------SQISDSES------LDELGPFRTRSRSAPP
H3ANP3_BAD-02          --------------------SQISDSES------LDELGPFRTRSRSAPP
A0A4X2KAA5_BAD-01      --------REGPGEASPEAEAEADFFEG------EEERSLFRSRSSSAPP
G3VRY3_BAD-01          --------REGSREASPEAEAEAEQSEG------EEERGLFRGRSSSAPP
G3VRY3_BAD-02          LGKGSFEGREGSREASPEAEAEAEQSEG------EEERGLFRGRSSSAPP
A0A2I3TBK7_BAD-01      --------------------------------------PDAAKLQLDASL
A0A2R8Z688_BAD-02      --------------------------------------ADAAKLQLDASL
A0A2I2Z8C7_BAD-03      --------------------------------------ADAAKLQLDASL
A8MXU7_BAD-03          --------------------------------------ADAAKLQLDASL
A0A2K5M0A7_BAD-02      --------------------------------------ADAAKLQLDASL
A0A2K5XJR2_BAD-02      --------------------------------------ADAAKLQLDASL
A0A096MLD5_BAD-03      --------------------------------------ADAAKLQLDASL
A0A2K5VCA9_BAD-02      --------------------------------------ADAAKLQLDASL
A0A2K6E7I4_BAD-02      --------------------------------------ADAAKLQLDASL
A0A2K5PDB1_BAD-02      --------------------------------------ADAAKRQLDASH
A0A2K5E6A6_BAD-02      --------------------------------------ADAAKLQLDASH
A0A2K6TG62_BAD-02      --------------------------------------ADAAKLQLDASH
A0A2K5HKU7_BAD-02      --------------------------------------NPSARMLTEASA
A0A2K6N196_BAD-02      --------------------------------------NPSARMLAEASA
A0A2K6PUL3_BAD-02      --------------------------------------NPSARMLAEASA
A0A2K5M0A7_BAD-03      --------------------------------------NPSARMLAEASA
A0A2K5VCA9_BAD-03      --------------------------------------NPSARMLAEASA
A0A2K5XJR2_BAD-03      --------------------------------------NPSARMLAEASA
A0A096MLD5_BAD-02      --------------------------------------NPSARMLAEASA
A0A2K6E7I4_BAD-03      --------------------------------------NPSARMLAEASA
A0A2I2Z8C7_BAD-04      --------------------------------------NPSAGMLAEASA
A8MXU7_BAD-04          --------------------------------------NPSAGMLAEASA
A0A2I3TBK7_BAD-03      --------------------------------------NPSAGMLAEASA
A0A2R8Z688_BAD-03      --------------------------------------NPSAGMLAEASA
A0A2K5E6A6_BAD-03      --------------------------------------NPSARMLSKASA
A0A2K5PDB1_BAD-03      --------------------------------------NPSARMLSKTSA
A0A2K6TG62_BAD-03      --------------------------------------NPSAKMLSKASA
G1P8C5_BAD-01          --------------------TEEDDDTE------EGEPSPFRGRSRSAPP
A0A452ER54_BAD-02      --------------------PEDDEGTE------EEDLGPFRGRSRSAPP
W5P8G9_BAD-01          --------------------PEDDEGTE------EEDLGPFRGRSRSAPP
G3TP47_BAD-01          --------------------SDEAEGLE------EDP-SPFRGRSLSAPP
A0A287CT05_BAD-01      --------------------TDLDEGME------EEP-SPFRGRSRSAPP
A0A287CT05_BAD-02      --------------------TDLDEGME------EEP-SPFRGRSRSAPP
A0A1U7Q4V0_BAD-01      --------------------NEEDEGME------EEL-SPFRGRSRSAPP
Q61337_BAD-02          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
Q61337_BAD-01          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
A0A091DDU4_BAD-01      --------------------TEEEEGME------EEP-SPFRGRSRSAPP
G5B6Q3_BAD-02          --------------------MEEEAGMK------EEP-SPFRGRSRSAPP
G5B6Q3_BAD-01          --------------------MEEEAGMK------EEP-SPFRGRSRSAPP
Q61337_BAD-05          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
Q61337_BAD-03          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
Q61337_BAD-04          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
Q61337_BAD-06          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
Q61337_BAD-07          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
O35147_BAD-01          --------------------TEEDEGME------EEL-SPFRGRSRSAPP
F7DN67_BAD-01          --------------------TEDEGMEG------EEP-GPFRGRSRSAPP
Q45KI9_BAD-01          --------------------TDEDEGME------EEELSPFRGRSSSAPP
A0A3Q7SWS0_BAD-01      --------------------TDEDEGME------EEELSPFRGRSSSAPP
H0WVR2_BAD-01          --------------------TEEDEGI-------EEP-SPFRGRSRSAPP
A0A2K6GWV0_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
H0V608_BAD-01          --------------------TEEEEGME------EEL-SPFRGRSRSAPP
A0A1S3FL84_BAD-01      --------------------MEEDEGLE------EEP-SPFRGRSRSAPP
A0A2K5PDB1_BAD-01      --------------------TEEDEGME------EEP-STFRGRSRSAPP
U3F2S3_BAD-01          --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K5E6A6_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K6TG62_BAD-01      --------------------TEGDEGME------EEP-SPFRGRSRSAPP
A0A0D9R491_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K5M0A7_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K5VCA9_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A1D5QBW1_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K6E7I4_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K5XJR2_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A096MLD5_BAD-04      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K6N196_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K6PUL3_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2K5HKU7_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
B4DZQ9_BAD-01          --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A0A096MLD5_BAD-01      --------------------TEEDEGME------EEP-SPFRGRSRSAPP
A0A2I2Z8C7_BAD-01      --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A0A2I2Z8C7_BAD-02      --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A8MXU7_BAD-01          --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A8MXU7_BAD-02          --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A0A2I3TBK7_BAD-02      --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A0A2R8Z688_BAD-01      --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
A0A2J8TYJ3_BAD-01      --------------------TEDDEGMG------EEP-SPFRGRSRSAPP
G1MI17_BAD-01          --------------------TEEDEGLE------EEELSPFRGRSSSAPP
A0A4X1VE31_BAD-01      --------------------TEEDEGTE------DEELSPFRGRSLSAPP
A0A4X1VE31_BAD-02      --------------------TEEDEGTE------DEELSPFRGRSLSAPP
A0A287AEF3_BAD-01      --------------------TEEDEGTE------DEELSPFRGRSLSAPP
A0A4X1VE31_BAD-03      --------------------TEEDEGTE------DEELSPFRGRSLSAPP
M3YNE7_BAD-01          --------------------TEEDEGME------EEELSPFRGRSRSAPP
A0A452RJM6_BAD-01      --------------------TEEDEGLE------EEELSPFRGRSSSAPP
A0A384DJL2_BAD-01      --------------------TEEDEGLE------EEELSPFRGRSSSAPP
A0A452ER54_BAD-01      --------------------PEDDEGTE------EEDLGPFRGRSRSAPP
A0A4W2C9A8_BAD-01      --------------------PEDNEETE------EEDLGPFRGRSRSAPP
A0A4W2C9A8_BAD-01      --------------------PEDNEETE------EEDLGPFRGRSRSAPP
F1MUT9_BAD-01          --------------------PEDNEETE------EEDLGPFRGRSRSAPP
Q3SYZ0_BAD-01          --------------------PEDNEETE------EEDLGPFRGRSRSAPP
                                                                         

Q61337_BAD-09          --XAAQRYGR-------ELRRMSDEFEGSFKF------------------
Q2PG01_BAD-01          NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2I3H4B2_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A8MXU7_BAD-05          NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A8MXU7_BAD-06          NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      ALWKAKKYGR-------QLRRMSDEFDTWLDK------------------
A0A4W4DXF5_BAD-01      ALWKAKKYGR-------QLRRMSDEFDTWLDK------------------
A0A3P8Y761_BAD-02      ALWAAKRYGR-------QLRRMSDEFDTWLDK------------------
A0A3P9A5G8_BAD-01      ALWAAKKYGC-------QLRRMSDEFDTWLDK------------------
A0A2D0SYM2_BAD-01      ALWKAKKYGR-------QLRRMSDEFDTWLDR------------------
A0A3B4DUY7_BAD-01      ALWKAKKYGR-------QLRRMSDEFDTWLDK------------------
E7FBJ6_BAD-01          ALWKAKKYGR-------QLRRMSDEFDTWLDK------------------
A0A4W5MZR2_BAD-01      ALWAAKKYGC-------QLRRMSDEFDTWLDK------------------
B5XEF1_BAD-01          ALWAAKKYGC-------QLRRMSDEFDTWLDK------------------
H3D8J8_BAD-01          ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3B5L9R9_BAD-01      SLWAAKKYGR-------QLRRMSDEFVNLLDK------------------
A0A3B4CPH6_BAD-01      ALWAAKKYGR-------QLRKMSDEFDTLLDK------------------
A0A4W5JLL9_BAD-02      ALWAAKKYGR-------QLRRMSDEFDTWLDK------------------
A0A3Q2QC80_BAD-01      ALWAAKKYGR-------QLRRMSDEFGSLLDK------------------
A0A3Q3FKT9_BAD-02      ALWAAKKYGR-------QLRRMSDEFDILLDK------------------
A0A3P9B2E4_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
I3K7B6_BAD-01          ALWAAKKYGQ-------KLRRMSDEFDSLLDK------------------
A0A3Q3C680_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3P8QRJ7_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3Q4GGN3_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3B4GXJ6_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3Q3FKT9_BAD-03      ALWAAKKYGR-------QLRRMSDEFDILLDK------------------
A0A3Q2D5S0_BAD-01      ALWAAKKYGR-------QLRRMSDEFVTLLDK------------------
A0A3Q0QNQ2_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3P8WI83_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3P8WI83_BAD-02      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3P9HNZ2_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3B3BQF7_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q1K1C7_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q1K1C7_BAD-02      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q1GWH9_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q1CPU7_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3P8TWH6_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A4W6EMZ7_BAD-02      ALWAAKKYGQ-------KLRRMSDEFDSLLDK------------------
A0A2U9BAC9_BAD-01      ALWAAMKYGQ-------KLRRMSDEFDSLLDK------------------
A0A4W6EMZ7_BAD-01      ALWAAKKYGQ-------KLRRMSDEFDSLLDK------------------
A0A3B4VFC5_BAD-01      ALWAAKKYGQ-------KLRRMSDEFDSLLDK------------------
A0A3B4W9T1_BAD-01      ALWAAKKYGQ-------KLRRMSDEFDSLLDK------------------
A0A452IFQ4_BAD-01      ILWAAMRYGR-------ELRRMSDEFDVAL-Q------------------
C1C3S9_BAD-01          SLMVAARYGR-------ELRRMSDEFDQIF-T------------------
A0A4W4HE29_BAD-01      ILWAAKKYGR-------QLRKMSDEFDTLLDK------------------
A0A337SAW2_BAD-01      NLWAALRYGR-------ELRRMSDEFQGSF-K------------------
A0A3P9A5G8_BAD-02      ALWAAKKYGC-------QLRRMSDEFDTWLDK------------------
A0A4W5R1T6_BAD-01      ALWAAKKYGR-------QLRRMSDEFDTWLDK------------------
B5X1T1_BAD-01          TLWAAKKYGR-------QLRRMSDEFDTWLDK------------------
Q4V925_BAD-02          ALWAAKKYGQ-------QLRRMSDEF----DK------------------
Q4V925_BAD-03          ALWAAKKYGQ-------QLRRMSDEF----DK------------------
A7MCM4_BAD-01          ALWAAKKYGQ-------QLRRMSDEF----DK------------------
Q4V925_BAD-01          ALWAAKKYGQ-------QLRRMSDEF----DK------------------
Q4V925_BAD-04          ALWAAKKYGQ-------QLRRMSDEF----DK------------------
A0A3P8Y761_BAD-01      ALWAAKRYGR-------QLRRMSDEFDTWLDK------------------
A0A4W5JLL9_BAD-01      ALWAAKKYGR-------QLRRMSDEFDTWLDK------------------
A0A3B5Q2N7_BAD-01      SLWAAKKYGR-------QLRRMSDEFVNLLDK------------------
A0A087X8P8_BAD-01      SLWAAKKYGR-------QLRRMSDEFVNLLDK------------------
A0A3B3UA11_BAD-01      SLWAAKKYGR-------QLRRMSDEFVNLLDK------------------
A0A3B3YFR1_BAD-01      SLWAAKKYGR-------QLRRMSDEFVNLLDK------------------
A0A3P9Q7C3_BAD-01      SLWAAKKYGR-------QLRRMSDEFVNLLDK------------------
A0A3B3HDU2_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3P9KSL7_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3P9KSL7_BAD-02      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3B5BAL2_BAD-01      ALWAAKKYGQ-------KLRRMSDEFDSLLDK------------------
A0A3Q3AEL8_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3Q3AEL8_BAD-02      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
G3Q8B3_BAD-01          ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3Q2Y0E4_BAD-01      VLWAAKKYGR-------QLRRMSDEFDSLMDK------------------
A0A3Q3R5S3_BAD-01      ALWAAKKYGR-------QLRRMSDEFDSLLDK------------------
A0A3Q3RXS8_BAD-01      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q3RXS8_BAD-02      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q0QNQ2_BAD-02      ALWAAKKYGQ-------QLRRMSDEFDSLLDK------------------
A0A3Q3WTY4_BAD-01      SLWAAKKYGQ-------RLRRMSDEF----DR------------------
A0A3Q3FKT9_BAD-01      ALWAAKKYGR-------QLRRMSDEFDILLDK------------------
A0A3B1IH05_BAD-01      SLWAAKKYGR-------QLRKMSDEFDKGLEQ------------------
A0A5F8GA49_BAD-01      ILWAARRYGS-------ELRRMSDEFDCSF-K------------------
A0A3B3QX41_BAD-01      ALWAAQRYGR-------QLRRMSDEFDTLLDK------------------
H3ANP3_BAD-03          NFWAARKYGQ-------ELRRMSDEFDMSF-L------------------
H3ANP3_BAD-04          NFWAARKYGQ-------ELRRMSDEFDMSF-L------------------
H3ANP3_BAD-01          NFWAARKYGQ-------ELRRMSDEFDMSF-L------------------
H3ANP3_BAD-02          NFWAARKYGQ-------ELRRMSDEFDMSF-L------------------
A0A4X2KAA5_BAD-01      ILWAARRYGS-------ELRRMSDEFDCTF-K------------------
G3VRY3_BAD-01          ILWAARHYGS-------ELRRMSDEFHCTF-K------------------
G3VRY3_BAD-02          ILWAARHYGS-------ELRRMSDEFHCTF-K------------------
A0A2I3TBK7_BAD-01      PVLVGSELGQG------KLRPLPVTFAPHP-E------------------
A0A2R8Z688_BAD-02      PVLVGSELGQG------KLRPLPVTFAPHP-E------------------
A0A2I2Z8C7_BAD-03      PVLVGSELGQG------KLRPLPVTFAAHP-E------------------
A8MXU7_BAD-03          PVLVGSELGQG------KLRPLPVTFAPHP-E------------------
A0A2K5M0A7_BAD-02      PVLVGSELGQG------KLRPLPVTFAPRP-E------------------
A0A2K5XJR2_BAD-02      PVLVGSELGQG------KLRPLPVTFAPRP-E------------------
A0A096MLD5_BAD-03      PVLVGSELGQG------KLRPLPVTFAPRP-E------------------
A0A2K5VCA9_BAD-02      PVLVGSELGQG------KLRTLPVTFAPRP-E------------------
A0A2K6E7I4_BAD-02      PVLVGSELGQG------KLRTLPVTFAPRP-E------------------
A0A2K5PDB1_BAD-02      PVLVGSELGQG------RIRSLPVTFAPHP-K------------------
A0A2K5E6A6_BAD-02      PVLVGSELGQG------RLRSLPVTFAPHP-E------------------
A0A2K6TG62_BAD-02      PVLVGSELGQG------RLRSLPVTFAPHP-E------------------
A0A2K5HKU7_BAD-02      GMSAPATDSEAQHAENVKLEALGL-WRPGV-A------------------
A0A2K6N196_BAD-02      GMSAPATDSEAQLAENVKLEALGL-WRPGV-A------------------
A0A2K6PUL3_BAD-02      GMSAPATDSEAQLAENVKLEALGL-WRPGV-A------------------
A0A2K5M0A7_BAD-03      RMSAPATDSEAQHAENVKLKALGL-WRPGV-A------------------
A0A2K5VCA9_BAD-03      RMSAPATDSEAQHAENVKLKALGL-WRPGV-A------------------
A0A2K5XJR2_BAD-03      RMSAPATDSEAQLAENVKLKALGL-WRPGV-A------------------
A0A096MLD5_BAD-02      PMSAPATDSEAQHAENVKLKALGL-WRRGV-A------------------
A0A2K6E7I4_BAD-03      RMSAPATDSEAQHAENVKLKALGL-WRPAV-A------------------
A0A2I2Z8C7_BAD-04      GMSAPAADSEAQHAENVKLEALGL-WRSGV-A------------------
A8MXU7_BAD-04          GMSAPAADSEAQHAENVKLEALGL-WRSGV-A------------------
A0A2I3TBK7_BAD-03      GMSAPAADSEAQHAENVKLEALGL-WRSGV-A------------------
A0A2R8Z688_BAD-03      GMSAPAADSEAQHAENVKLEALGL-WRSGV-A------------------
A0A2K5E6A6_BAD-03      GMSAPATDS-----ENVKLE-VPC-W---V-A------------------
A0A2K5PDB1_BAD-03      GMSSPATDSEAQHTENVKLEALGL-WRPGV-A------------------
A0A2K6TG62_BAD-03      GMSAPATDSEAQHTENVKLEALEP-WRHGV-A------------------
G1P8C5_BAD-01          NLWAAQRYGR-------ELRRMSDEFQGSFKK------------------
A0A452ER54_BAD-02      NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
W5P8G9_BAD-01          NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
G3TP47_BAD-01          NLWAAQRYGR-------ELRRMSDEFQGYF-K------------------
A0A287CT05_BAD-01      NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
A0A287CT05_BAD-02      NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
A0A1U7Q4V0_BAD-01      NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
Q61337_BAD-02          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
Q61337_BAD-01          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
A0A091DDU4_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
G5B6Q3_BAD-02          NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
G5B6Q3_BAD-01          NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
Q61337_BAD-05          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
Q61337_BAD-03          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
Q61337_BAD-04          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
Q61337_BAD-06          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
Q61337_BAD-07          NLWAAQRYGR-------ELRRMSDEFEGSFKS------------------
O35147_BAD-01          NLWAAQRYGR-------ELRRMSDEFEGSF-K------------------
F7DN67_BAD-01          NLWAARRYGR-------ELRRMSDEFQVSF-Q------------------
Q45KI9_BAD-01          NLCAARRYGR-------ELRRMSDEFQGSF-K------------------
A0A3Q7SWS0_BAD-01      NLCAALRYGR-------ELRRMSDEFQGSF-K------------------
H0WVR2_BAD-01          NLWAAQRYGR-------ELRRMSDEFEDSFKK------------------
A0A2K6GWV0_BAD-01      NLWAAQRYGR-------ELRRMSDEFEDSFKK------------------
H0V608_BAD-01          NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A1S3FL84_BAD-01      NLWAARRYGR-------ELRRMSDEFDGSF-K------------------
A0A2K5PDB1_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
U3F2S3_BAD-01          NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K5E6A6_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K6TG62_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A0D9R491_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K5M0A7_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K5VCA9_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A1D5QBW1_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K6E7I4_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K5XJR2_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A096MLD5_BAD-04      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K6N196_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K6PUL3_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
A0A2K5HKU7_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSF-K------------------
B4DZQ9_BAD-01          NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A0A096MLD5_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A0A2I2Z8C7_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A0A2I2Z8C7_BAD-02      NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A8MXU7_BAD-01          NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A8MXU7_BAD-02          NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A0A2I3TBK7_BAD-02      NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A0A2R8Z688_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
A0A2J8TYJ3_BAD-01      NLWAAQRYGR-------ELRRMSDEFVDSFKK------------------
G1MI17_BAD-01          NLCAALRYGR-------ELRRMSDEFQGSF-K------------------
A0A4X1VE31_BAD-01      ILWAAQRYGR-------ELRRMSDEFQGSF-KVSARVGLYPRVSSQWAVP
A0A4X1VE31_BAD-02      ILWAAQRYGR-------ELRRMSDEFQGSFKK------------------
A0A287AEF3_BAD-01      ILWAAQRYGR-------ELRRMSDEFQGSFKK------------------
A0A4X1VE31_BAD-03      ILWAAQRYGR-------ELRRMSDEFQGSF-K------------------
M3YNE7_BAD-01          NLCAALRYGR-------ELRRMSDEFQGSF-K------------------
A0A452RJM6_BAD-01      NLCAALRYGR-------ELRRMSDEFQGSF-K------------------
A0A384DJL2_BAD-01      NLCAALRYGR-------ELRRMSDEFQGSF-K------------------
A0A452ER54_BAD-01      NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
A0A4W2C9A8_BAD-01      NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
A0A4W2C9A8_BAD-01      NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
F1MUT9_BAD-01          NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
Q3SYZ0_BAD-01          NLWAAQRYGR-------ELRRMSDEFHVSF-K------------------
                                                                         

Q61337_BAD-09          -------------HLGSRHTHHPVS------------LTAQCRASW----
Q2PG01_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2I3H4B2_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A8MXU7_BAD-05          -------------GL-PRPKSAGTA------------TQMRQSSSWTR--
A8MXU7_BAD-06          -------------GL-PRPKSAG---------------------------
Q6P7C5_BAD-01          -------------------------------------GRFLTSIIFLSHV
A0A3B1JLM2_BAD-01      ------------GDL-RRTTGPG----------------RHTNRGWFSFL
A0A4W4DXF5_BAD-01      ------------GEI-RRVSSPGKL------------SQKQTNQGWFSFL
A0A3P8Y761_BAD-02      ------------GQM-KRVKSAGAA------------KQMTTSPSWWAFL
A0A3P9A5G8_BAD-01      ------------GEP-KRGIIPGRA--------------KQVYRGWFSFL
A0A2D0SYM2_BAD-01      ------------GDI-RRVSSPGKV------------SQKQSNRGWFSFL
A0A3B4DUY7_BAD-01      ------------GDT-RRASSPG----------------KQTNRGWFSFL
E7FBJ6_BAD-01          ------------GVS-K----TPNS------------QK-QTYRGWFSFL
A0A4W5MZR2_BAD-01      ------------GEP-KRGISPGGG------------KQ-KVSRGWFSFL
B5XEF1_BAD-01          ------------GVP-KRGIIPRGG------------KQ-KVSRGWFSFL
H3D8J8_BAD-01          ------------GGM-RKTSSAGSA------------RQMHHSRSWWSYL
A0A3B5L9R9_BAD-01      ------------GEM-RNVSSDGSN------------RPIHHSRSWWSYL
A0A3B4CPH6_BAD-01      ------------G-M-KRVRSAGAA------------RQMHASPSWFTFL
A0A4W5JLL9_BAD-02      ------------GEM-RRVKSAGAA------------KQMTKSPSWWAYL
A0A3Q2QC80_BAD-01      ------------GEL-RKVSSAGTN------------RPIHHSRSWWNYL
A0A3Q3FKT9_BAD-02      ------------G---VRIKGGGGG------------SRGGCGLVVESVV
A0A3P9B2E4_BAD-01      ------------G-------------------------------------
I3K7B6_BAD-01          ------------GEM-K-------L------------KKLHHSKTWWSYL
A0A3Q3C680_BAD-01      ------------GEM-K-------V------------KKLHHSKTWWSYL
A0A3P8QRJ7_BAD-01      ------------GEM-K-------V------------KKLHHSKTWWSYL
A0A3Q4GGN3_BAD-01      ------------GEM-K-------L------------KKLHHSKTWWSYL
A0A3B4GXJ6_BAD-01      ------------GEM-K-------V------------KKLHHSKTWWSYL
A0A3Q3FKT9_BAD-03      ------------GEM-KKVRSPGPA------------KQMHHSKSWWSYL
A0A3Q2D5S0_BAD-01      ------------GEL-RKVSSTGTN------------RPIRHSKSWWSYL
A0A3Q0QNQ2_BAD-01      ------------G-M-KKAKNAGTT------------RKMHHSKTWWSYL
A0A3P8WI83_BAD-01      ------------G-M-RKVKSAGTA------------RQMHHSKSWWSYL
A0A3P8WI83_BAD-02      ------------G-M-RKVKSAGTA------------RQMHHSKSWWSYL
A0A3P9HNZ2_BAD-01      ------------GEM-RKVRSTGAA------------KQMLHSTSWWNYL
A0A3B3BQF7_BAD-01      ------------GEM-RKVRSAGAT------------KQMHHSTSWWNYL
A0A3Q1K1C7_BAD-01      ------------GEM-RKVRSAGTA------------RQMHHSKSWWSYL
A0A3Q1K1C7_BAD-02      ------------GEM-RKVRSAGTA------------RQMHHSKSWWSYL
A0A3Q1GWH9_BAD-01      ------------GEM-KRVRSAGTA------------RQMHHSKSWWSYL
A0A3Q1CPU7_BAD-01      ------------GEM-KRVRSAGTA------------RQMHHSKSWWSYL
A0A3P8TWH6_BAD-01      ------------GEM-KRVRSAGTA------------RQMHHSKSWWSYL
A0A4W6EMZ7_BAD-02      ------------GEM-RRVKSATTT------------RQMHHSKSWWSYL
A0A2U9BAC9_BAD-01      ------------GEM-RKVKSAGTA------------RQMHHSQSWWSYL
A0A4W6EMZ7_BAD-01      ------------GEM-RRVKSATTT------------RQMHHSKSWWSYL
A0A3B4VFC5_BAD-01      ------------GEM-RKVKSAGTA------------KQMHHSKSWWSYL
A0A3B4W9T1_BAD-01      ------------GEM-RKVKSAGTA------------KQMHHSKSWWSYL
A0A452IFQ4_BAD-01      -------------VL-PRPKSAGTT------------SQLHRGNSWKETL
C1C3S9_BAD-01          -------------SI-PRPKSASAA------------TEMTVSKSFGETF
A0A4W4HE29_BAD-01      -------------GM-KRARSAGAA------------RQMHTSPSWFAFL
A0A337SAW2_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRFI
A0A3P9A5G8_BAD-02      ------------GEP-KRGIIPGRA------------KQ--VYRGWFSFL
A0A4W5R1T6_BAD-01      ------------GEP-KRGISPGGI------------KQ-EVSRGWFSFL
B5X1T1_BAD-01          ------------GEP-KRGISPGGV------------KQ-EVSRGWFSFL
Q4V925_BAD-02          ------------G-M-KRVKSAGTA------------RQMSQSPSWLAFL
Q4V925_BAD-03          ------------G-M-KRVKSAGTA------------RQMSQSPSWLAFL
A7MCM4_BAD-01          ------------GQM-KRVKSAGTA------------RQMSQSPSWLAFL
Q4V925_BAD-01          ------------GQM-KRVKSAGTA------------RQMSQSPSWLAFL
Q4V925_BAD-04          ------------GQM-KRVKSAGTA------------RQMSQSPSWLAFL
A0A3P8Y761_BAD-01      ------------GQM-KRVKSAGAA------------KQMTTSPSWWAFL
A0A4W5JLL9_BAD-01      ------------GEM-RRVKSAGAA------------KQMTKSPSWWAYL
A0A3B5Q2N7_BAD-01      ------------GEM-RNVSSDGSN------------RPIHHSRSWWSYL
A0A087X8P8_BAD-01      ------------GEM-RKVSSTGSN------------RPIHHSRSWWSYL
A0A3B3UA11_BAD-01      ------------GEM-RKVSSTGSN------------RPIHHSRSWWSYL
A0A3B3YFR1_BAD-01      ------------GEM-RKVSSTGSN------------RPIHHSRSWWSYL
A0A3P9Q7C3_BAD-01      ------------GEM-RKVSSAGSN------------GPIHHSRSWWSYL
A0A3B3HDU2_BAD-01      ------------GEM-RKVRSTGAA------------KQMLHSTSWWNYL
A0A3P9KSL7_BAD-01      ------------GEM-RKVRSTGAA------------KQMLHSTSWWNYL
A0A3P9KSL7_BAD-02      ------------GEM-RKVRSTGAA------------KQMLHSTSWWNYL
A0A3B5BAL2_BAD-01      ------------GEM-KRVRSAGTA------------KQMHHSKSWWSYL
A0A3Q3AEL8_BAD-01      ------------GEM-RKVKSAGTT------------KQIHHSRSWWNYL
A0A3Q3AEL8_BAD-02      ------------GEM-RKVKSAGTT------------KQIHHSRSWWNYL
G3Q8B3_BAD-01          ------------GEM-RRVKSAGTT------------KQMQHSKSWWSSL
A0A3Q2Y0E4_BAD-01      ------------GEL-KFKSAGGTS------------RAIHHSKTWWSYL
A0A3Q3R5S3_BAD-01      ------------GEM-KRVRSAGAA------------SQMHHSKSWWSYL
A0A3Q3RXS8_BAD-01      ------------GEM-R-VRNAGKA------------QKMHHSKTWWSYL
A0A3Q3RXS8_BAD-02      ------------GEM-R-VRNAGKA------------QKMHHSKTWWSYL
A0A3Q0QNQ2_BAD-02      ------------GMK-K-AKNAGTT------------RKMHHSKTWWSYL
A0A3Q3WTY4_BAD-01      ------------QEW-K-TRSAGTA------------TQMHQSRSWWSYL
A0A3Q3FKT9_BAD-01      -------------GV-RIKGGGGGSRGGCGLVVESVVSQPKSQEFNTQLL
A0A3B1IH05_BAD-01      -------------GM-KRVRSAGAA------------RQMQNSPSWFAFL
A0A5F8GA49_BAD-01      -------------GL-PRPKSAGTA------------SQMRRSHGWTRTV
A0A3B3QX41_BAD-01      -------------GM-KRVRSAGAA------------RQMQASPSWFAFL
H3ANP3_BAD-03          -------------GL-PRPKSAGAA------------GEMVDESWWKKLI
H3ANP3_BAD-04          -------------GL-PRPKSAGAA------------GEMVDESWWKKLI
H3ANP3_BAD-01          -------------GL-PRPKSAGAA------------GEMVDESWWKKLI
H3ANP3_BAD-02          -------------GL-PRPKSAGAA------------GEMVDESWWKKLI
A0A4X2KAA5_BAD-01      -------------GL-PRPKSAGTA------------SQMRRSHGWARTF
G3VRY3_BAD-01          -------------GL-PRPKSAGTA------------SQMRRSHGWTRTF
G3VRY3_BAD-02          -------------GL-PRPKSAGTA------------SQMRRSHGWTRTF
A0A2I3TBK7_BAD-01      -------------TP-PVPTALGSH------------LEYGRKYFPQAYA
A0A2R8Z688_BAD-02      -------------TP-PVPTALGSH------------LEYGRKYFPQAYA
A0A2I2Z8C7_BAD-03      -------------TP-PVPTALGSH------------LEYGRKYFPQAYA
A8MXU7_BAD-03          -------------TP-PVPTALGSH------------LEYGRKYFPQAYA
A0A2K5M0A7_BAD-02      -------------TP-PALTVLVGH------------LGYGRKCFPQALC
A0A2K5XJR2_BAD-02      -------------TP-PALTVLVGH------------LGYGRKCFPQASC
A0A096MLD5_BAD-03      -------------TP-PALTVLVGH------------LGYGRKCFPQALC
A0A2K5VCA9_BAD-02      -------------TP-PALTVLVGH------------LGYGRKCFPQALC
A0A2K6E7I4_BAD-02      -------------TP-PALTVLVGH------------LGYGRKCFPQALC
A0A2K5PDB1_BAD-02      -------------TP-PALIALSGH------------LGYGRKCFLQ---
A0A2K5E6A6_BAD-02      -------------TP-PVPIALGGH------------LGYGRKCFLQ---
A0A2K6TG62_BAD-02      -------------TL-PAPIALGGH------------LGHGRKCFLQ---
A0A2K5HKU7_BAD-02      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2K6N196_BAD-02      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2K6PUL3_BAD-02      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2K5M0A7_BAD-03      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2K5VCA9_BAD-03      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2K5XJR2_BAD-03      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A096MLD5_BAD-02      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2K6E7I4_BAD-03      -------------TA-PTPRGRRRT------------KGWRRSPAPFGAA
A0A2I2Z8C7_BAD-04      -------------TA-PTPRGRRTT------------KGWGRSPAPFGAA
A8MXU7_BAD-04          -------------TA-PTPRGRRTT------------KGWGRSPAPFGAA
A0A2I3TBK7_BAD-03      -------------TA-PTPRGRRTT------------KGWGRSPAPFGAA
A0A2R8Z688_BAD-03      -------------TA-PTPRGRRTT------------KGWGRSPAPFGAA
A0A2K5E6A6_BAD-03      -------------TA-PTPQGRRRT------------KGWRRSPAPFGAV
A0A2K5PDB1_BAD-03      -------------TD-RTPQGRRRT------------KGWRRSPAPFGAV
A0A2K6TG62_BAD-03      -------------TA-RTPQGRRGT------------KGWRRSPALFGAV
G1P8C5_BAD-01          -------------GL-PRPKSAGTA------------TQMWQKSSWTRFF
A0A452ER54_BAD-02      -------------GL-PRPKSAGTA------------TQMRQSPSWTRFL
W5P8G9_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPSWTRFL
G3TP47_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPSWTRII
A0A287CT05_BAD-01      -------------GL-PRPRSAGTA------------SQMRQSSSWTRFI
A0A287CT05_BAD-02      ----------------------------------------------VTFS
A0A1U7Q4V0_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSASWTRII
Q61337_BAD-02          -------------G-----------------------EELTYSLSPFRCV
Q61337_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSAGWTRII
A0A091DDU4_BAD-01      -------------GL-PRPKSAGTA------------TKLWQSSSWTRAI
G5B6Q3_BAD-02          -------------GL-PRPKSAGTA------------TKLWQSSSWTRAI
G5B6Q3_BAD-01          -------------GL-PRPKSAGTA------------TKLWQSSSWTRAI
Q61337_BAD-05          -------------VS-ASVRCDGT--------------------------
Q61337_BAD-03          -------------GL-PRPKSAGTA------------TQMRQSAGWTRII
Q61337_BAD-04          -------------GL-PRPKSAGTA------------TQMRQSAGWTRII
Q61337_BAD-06          -------------GL-PRPKSAGTA------------TQMRQSAGWTRII
Q61337_BAD-07          --------------------MLGLA------------VLIRPLSVSSDLL
O35147_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSASWTRII
F7DN67_BAD-01          -------------AL-PRPKSAGTA------------TQMRQSPSWTRAI
Q45KI9_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPSWTRVI
A0A3Q7SWS0_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRVI
H0WVR2_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSSSWTRVI
A0A2K6GWV0_BAD-01      -------------GL-PRPKSAGTA------------TQIRQSSSWTRVI
H0V608_BAD-01          -------------GL-PRPKSAGTA------------TKLWQNSNWTRAI
A0A1S3FL84_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRIF
A0A2K5PDB1_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSASWTRVI
U3F2S3_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSSSWTRVI
A0A2K5E6A6_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTQVI
A0A2K6TG62_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVI
A0A0D9R491_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K5M0A7_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K5VCA9_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A1D5QBW1_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K6E7I4_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K5XJR2_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A096MLD5_BAD-04      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K6N196_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K6PUL3_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2K5HKU7_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
B4DZQ9_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPRRLR--
A0A096MLD5_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2I2Z8C7_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2I2Z8C7_BAD-02      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A8MXU7_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A8MXU7_BAD-02          -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2I3TBK7_BAD-02      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2R8Z688_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
A0A2J8TYJ3_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSSSWTRVF
G1MI17_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPSWTRVI
A0A4X1VE31_BAD-01      FESQGLSGSEVQAPL-QKAKTPGFP------------KSLKREAGW----
A0A4X1VE31_BAD-02      -------------GL-PRPKSAGTA------------TQMRQSPSWKRFL
A0A287AEF3_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWKRFL
A0A4X1VE31_BAD-03      -------------GL-PRPKSAGTA------------TQMRQSPSWKRFL
M3YNE7_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPSWTRVI
A0A452RJM6_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRVI
A0A384DJL2_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRVI
A0A452ER54_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRFL
A0A4W2C9A8_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRFL
A0A4W2C9A8_BAD-01      -------------GL-PRPKSAGTA------------TQMRQSPSWTRFL
F1MUT9_BAD-01          -------------GL-PRPKSAGTA------------TQMRQSPSWTRFL
Q3SYZ0_BAD-01          -------------GL-PRPKSAGTA------------TEMRQSPSWTRFL
                                                                         

Q61337_BAD-09          -------WWGPD--SGCQNEAHSFLLLP----------------------
Q2PG01_BAD-01          -----QSWWDRN--LGRGSSAPSQ--------------------------
A0A2I3H4B2_BAD-01      -----QSWWDRN--LGRGSSAPSQ--------------------------
A8MXU7_BAD-05          --------------------------------------------------
A8MXU7_BAD-06          --------------------------------------------------
Q6P7C5_BAD-01          P-------------------------------------------------
A0A3B1JLM2_BAD-01      --------WGTK--EEEGRE------------------------------
A0A4W4DXF5_BAD-01      --------WCSK--EEEGRK------------------------------
A0A3P8Y761_BAD-02      --------FSHK--ETETE-KTPNLIITEPRSSE----------------
A0A3P9A5G8_BAD-01      --------WSPK--EAEGR--------------D----------------
A0A2D0SYM2_BAD-01      --------WGSREEEEEGR--------------E----------------
A0A3B4DUY7_BAD-01      --------WGSK--EEEGR--------------E----------------
E7FBJ6_BAD-01          --------WSPK--EEEGR--------------E----------------
A0A4W5MZR2_BAD-01      --------WSPK--EAEGR--------------E----------------
B5XEF1_BAD-01          --------WSPK--EAEGR--------------E----------------
H3D8J8_BAD-01          --------FSHQ--ETESE---NNHHD-----------------------
A0A3B5L9R9_BAD-01      --------FSHQ--ETEGE---NNHHENHASRTE----------------
A0A3B4CPH6_BAD-01      --------WSHK--ESDSE-ASSSLTAPDTRPAE----------------
A0A4W5JLL9_BAD-02      --------FSHK--ETETE---HTPTIPPRSSE-----------------
A0A3Q2QC80_BAD-01      --------FSHQ--ETEGE---NSHHENHAPRTE----------------
A0A3Q3FKT9_BAD-02      --------SQPK--SQEFN---TQLLQPHVRCVLGSLNVYKWDYLILIIT
A0A3P9B2E4_BAD-01      --------VRMG--VSQGL---N---------------------------
I3K7B6_BAD-01          --------FSHQ--ETEGE---NNHLENHNQRTE----------------
A0A3Q3C680_BAD-01      --------FSHQ--ETEGE---NNHLENHNQRTE----------------
A0A3P8QRJ7_BAD-01      --------FSHQ--ETEGE---NNHLENHNQRTE----------------
A0A3Q4GGN3_BAD-01      --------FSHQ--ETEGE---NNHLENHNQRTE----------------
A0A3B4GXJ6_BAD-01      --------FSHQ--ETEGE---NNHLENHNQRTE----------------
A0A3Q3FKT9_BAD-03      --------FSHQ--ETEGE---NNHHENHTHRNE----------------
A0A3Q2D5S0_BAD-01      --------FSHQ--EMEGE---NSHHENHTQCTEQRGE------------
A0A3Q0QNQ2_BAD-01      --------FSHQ--ESDGE---NSHHENHTQRTE----------------
A0A3P8WI83_BAD-01      --------FSHQ--ELEGE---NNHHENHTHRTE----------------
A0A3P8WI83_BAD-02      --------FSHQ--ELEGE---NNHHENHTHRTE----------------
A0A3P9HNZ2_BAD-01      --------FSHP--EAEGE---YSHHESQ--RTE----------------
A0A3B3BQF7_BAD-01      --------FSHP--EAEGE---YSHHESH--RTE----------------
A0A3Q1K1C7_BAD-01      --------FSHQ--ETEGE---NNHHESHTHRTE----------------
A0A3Q1K1C7_BAD-02      --------FSHQ--ETEGE---NNHHESHTHRTE----------------
A0A3Q1GWH9_BAD-01      --------FSHQ--EMEGE---NNHHESHTHRNE----------------
A0A3Q1CPU7_BAD-01      --------FSHQ--EMEGE---NNHHESHTHRNE----------------
A0A3P8TWH6_BAD-01      --------FSHQ--EMEGE---NNHHESHTHRNE----------------
A0A4W6EMZ7_BAD-02      --------FSHQ--ETEGE---NNHHENHTHRTE----------------
A0A2U9BAC9_BAD-01      --------FSHQ--EMEGE---NNHHENHTQRNE----------------
A0A4W6EMZ7_BAD-01      --------FSHQ--ETEGE---NNHHENHTHRTE----------------
A0A3B4VFC5_BAD-01      --------FSHQ--ETEGE---NNHHENHTHRTE----------------
A0A3B4W9T1_BAD-01      --------FSHQ--ETEGE---NNHHENHTHRTE----------------
A0A452IFQ4_BAD-01      -----QAWLGHR--PARDALPRSSK-------------------------
C1C3S9_BAD-01          -----FNFFRRK--NKDRSQSENDKH------------------------
A0A4W4HE29_BAD-01      --------WSHK--ESDTE-TSSSVTAPDTRPAE----------------
A0A337SAW2_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A3P9A5G8_BAD-02      --------WSPK--EAEGR--------------D----------------
A0A4W5R1T6_BAD-01      --------WSPK--ESEGR--------------E----------------
B5X1T1_BAD-01          --------WSPK--KAEGR--------------E----------------
Q4V925_BAD-02          --------WSHK--ESDAE----------SRPAE----------------
Q4V925_BAD-03          --------WSHK--ESDAE----------SRPAE----------------
A7MCM4_BAD-01          --------WSHK--ESDAE----------SRPAE----------------
Q4V925_BAD-01          --------WSHK--ESDAE----------SRPAE----------------
Q4V925_BAD-04          --------WSHK--ESDAE----------SRPAE----------------
A0A3P8Y761_BAD-01      --------FSHK--ETETE-KTPNLIITEPRSSE----------------
A0A4W5JLL9_BAD-01      --------FSHK--ETETE-HTPTI---PPRSSE----------------
A0A3B5Q2N7_BAD-01      --------FSHQ--ETEGE---NNHHENHASRTE----------------
A0A087X8P8_BAD-01      --------FSHQ--ETEGE---NNHHENHASRTE----------------
A0A3B3UA11_BAD-01      --------FSHQ--ETEGE---NNHHENHASRTE----------------
A0A3B3YFR1_BAD-01      --------FSHQ--ETEGE---NNHHENHASRTE----------------
A0A3P9Q7C3_BAD-01      --------FSHQ--ETEGE---NNHHENHASRTE----------------
A0A3B3HDU2_BAD-01      --------FSHP--EAEGE---YSHHESHRTE------------------
A0A3P9KSL7_BAD-01      --------FSHP--EAEGE---YSHHESHRTENRDLLGWLRCSSDITVSH
A0A3P9KSL7_BAD-02      --------FSHP--EAEGE---YSHHESHRTENRDLLGWLRCSSDITVSH
A0A3B5BAL2_BAD-01      --------FSHQ--ELEGE---NNHHENHTHRNE----------------
A0A3Q3AEL8_BAD-01      --------FSHQ--ETDGE---SSHHEKPTHRTE----------------
A0A3Q3AEL8_BAD-02      --------FSHQ--ETDGE---SSHHEKPTHRTE----------------
G3Q8B3_BAD-01          --------FSHQ--EMEGE---NNHHE-----------------------
A0A3Q2Y0E4_BAD-01      --------FSHQ--ETEGENNNNNHHDNHANRTE----------------
A0A3Q3R5S3_BAD-01      --------FSHQ--ETEGE---NTHHENAALAQEVERVVS----------
A0A3Q3RXS8_BAD-01      --------FSYQ--ETDGE---NNLHENHTPRTE----------------
A0A3Q3RXS8_BAD-02      --------FSYQ--ETDGE---NNLHENHTPRTE----------------
A0A3Q0QNQ2_BAD-02      --------FSHQ--ESDGE---NSHHENHTQRTE----------------
A0A3Q3WTY4_BAD-01      --------FSHQ--ETDGE---NNHHDSHTHRNE----------------
A0A3Q3FKT9_BAD-01      -----QPHVRCV--LGSLN-VYKWDYLILIITLHSSL-------------
A0A3B1IH05_BAD-01      -----WSHKESD--SEASS-SRPAE-------------------------
A0A5F8GA49_BAD-01      -----QSWFGRN--LGKGG-AGPSH-------------------------
A0A3B3QX41_BAD-01      -----WSHKESD--AEISG-SLSTADSRAAQ-------------------
H3ANP3_BAD-03          -----RSLKGRG--QPRDP---PGQ-------------------------
H3ANP3_BAD-04          -----RSLKGRG--QPRDP---PGQ-------------------------
H3ANP3_BAD-01          -----RSLKGRG--QPRDP---PGQQGVSIRGPD----------------
H3ANP3_BAD-02          -----RSLKGRG--QPRDP---PGQQGVSIRGPD----------------
A0A4X2KAA5_BAD-01      -----QSWLSRS--LGKGSAAGPSH-------------------------
G3VRY3_BAD-01          -----QSWFGRN--LGKGS-VGPSH-------------------------
G3VRY3_BAD-02          -----QSWFGRN--LGKGS-VGPSH-------------------------
A0A2I3TBK7_BAD-01      -----K----------RGS-VLSPLEGGLTPIPFRCV-------------
A0A2R8Z688_BAD-02      -----K----------RGS-VLSPLEGGLTQIPFRCV-------------
A0A2I2Z8C7_BAD-03      -----K----------RGS-VLSPLEGRLTQIPFRCV-------------
A8MXU7_BAD-03          -----K----------RGS-VLSPLEGGLTQIPFRCV-------------
A0A2K5M0A7_BAD-02      -----K----------RGS-VLPLSVGGLTQIPFRCM-------------
A0A2K5XJR2_BAD-02      -----K----------RGS-VLPLSVGGLTQIPFRCM-------------
A0A096MLD5_BAD-03      -----K----------RGS-VLPLSVGGLTQIPFRCM-------------
A0A2K5VCA9_BAD-02      -----K----------RGS-VLPLSVGGLTQIPFRCM-------------
A0A2K6E7I4_BAD-02      -----K----------RGS-VLPLSVGGLTQIPFRCM-------------
A0A2K5PDB1_BAD-02      --------------------------GGLTQIPFRCV-------------
A0A2K5E6A6_BAD-02      --------------------------GELTQIPFRCV-------------
A0A2K6TG62_BAD-02      --------------------------GGLTQIPFRCV-------------
A0A2K5HKU7_BAD-02      -----RAPRPLT--SGQHS-DMAASSGG----------------------
A0A2K6N196_BAD-02      -----RAPRPLT--SGQHS-DMAASSGG----------------------
A0A2K6PUL3_BAD-02      -----RAPRPLT--SGQHS-DMAASSGG----------------------
A0A2K5M0A7_BAD-03      -----RAPRPPT--SGQHS-VMAASSGG----------------------
A0A2K5VCA9_BAD-03      -----RAPRPPT--SGQHS-VMAASSGG----------------------
A0A2K5XJR2_BAD-03      -----RAPRPPT--SGQHS-VMAASSGG----------------------
A0A096MLD5_BAD-02      -----RAPRPPT--SGQHS-VMAASSGG----------------------
A0A2K6E7I4_BAD-03      -----RAPRPPT--SGQHS-VMAASSGG----------------------
A0A2I2Z8C7_BAD-04      -----RARRPPT--SGQHS-AMAASSGG----------------------
A8MXU7_BAD-04          -----RARRPPT--SGQHS-AMAASSGG----------------------
A0A2I3TBK7_BAD-03      -----RARRPPT--SGQHS-AMAASSGG----------------------
A0A2R8Z688_BAD-03      -----RARRPPT--SGQHS-AMAASSGG----------------------
A0A2K5E6A6_BAD-03      -----RAQHPPT--SGQHS-AMAASSGG----------------------
A0A2K5PDB1_BAD-03      -----RARHPPT--SGQHS-AMAASSGG----------------------
A0A2K6TG62_BAD-03      -----RARHPPT--SGQHS-DMAASSGG----------------------
G1P8C5_BAD-01          -----QSWWDRN--SGRGG-SAPSQ-------------------------
A0A452ER54_BAD-02      -----QSWLSRN--LGRGG-SAPSQ-------------------------
W5P8G9_BAD-01          -----QSWLSRN--LGRGG-SAPSQ-------------------------
G3TP47_BAD-01          -----QAWWDRN--LGRGS-SAPSQ-------------------------
A0A287CT05_BAD-01      -----QSWWDRN--LGRRG-SAPSQ-------------------------
A0A287CT05_BAD-02      -----QSPFLRA--------------------------------------
A0A1U7Q4V0_BAD-01      -----QSWWDRN--LGKGG-STPSQ-------------------------
Q61337_BAD-02          -----Q--------------------------------------------
Q61337_BAD-01          -----QSWWDRN--LGKGG-STPSQ-------------------------
A0A091DDU4_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
G5B6Q3_BAD-02          -----QSWWDRN--LGRGG-SAPSQ-------------------------
G5B6Q3_BAD-01          -----QSWWDRN--LGRGG-SAPSQ-------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-03          -----QSWWDRN--LGKGG-STPSQ-------------------------
Q61337_BAD-04          -----QSWWDRN--LGKGG-STPSQ-------------------------
Q61337_BAD-06          -----QSWWDRN--LGKGG-STPSQ-------------------------
Q61337_BAD-07          GFPPSSSFVQDP--VPSPG-LCLHL-------------------------
O35147_BAD-01          -----QSWWDRN--LGKGG-STPSQ-------------------------
F7DN67_BAD-01          -----QSWWDRN--LGRGG-SAPSQ-------------------------
Q45KI9_BAD-01          -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A3Q7SWS0_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
H0WVR2_BAD-01          -----QSWWDRN--VGRGG-SAPCQ-------------------------
A0A2K6GWV0_BAD-01      -----QSWWDRN--VGRGG-SAPSQ-------------------------
H0V608_BAD-01          -----QSWWDRN--LGRGG-SAPSQESV----------------------
A0A1S3FL84_BAD-01      -----QSWWDRN--LGRG--SAPSQ-------------------------
A0A2K5PDB1_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
U3F2S3_BAD-01          -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A2K5E6A6_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A2K6TG62_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A0D9R491_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K5M0A7_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K5VCA9_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A1D5QBW1_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K6E7I4_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K5XJR2_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A096MLD5_BAD-04      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K6N196_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K6PUL3_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2K5HKU7_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2I2Z8C7_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2I2Z8C7_BAD-02      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A8MXU7_BAD-01          -----QSWWDRN--LGRGS-SAPSQ-------------------------
A8MXU7_BAD-02          -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2I3TBK7_BAD-02      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2R8Z688_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
A0A2J8TYJ3_BAD-01      -----QSWWDRN--LGRGS-SAPSQ-------------------------
G1MI17_BAD-01          -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A4X1VE31_BAD-01      -----------H--LGS---------------------------------
A0A4X1VE31_BAD-02      -----QSWWYRN--SGRGG-PAPSQ-------------------------
A0A287AEF3_BAD-01      -----QSWWYRN--SGRGG-PAPSQ-------------------------
A0A4X1VE31_BAD-03      -----QSWWYRN--SGRGG-PAPSQ-------------------------
M3YNE7_BAD-01          -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A452RJM6_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A384DJL2_BAD-01      -----QSWWDRN--LGRGG-SAPSQ-------------------------
A0A452ER54_BAD-01      -----QSWLSRN--LGRGG-SAPSQ-------------------------
A0A4W2C9A8_BAD-01      -----QSWLSRN--LGRGG-SAPSQ-------------------------
A0A4W2C9A8_BAD-01      -----QSWLSRN--LGRGG-SAPSQ-------------------------
F1MUT9_BAD-01          -----QSWLSRN--LGRGG-SAPSQ-------------------------
Q3SYZ0_BAD-01          -----QSWLSRN--LGRGG-SAPSQ-------------------------
                                                                         

Q61337_BAD-09          ---------------------------------------------
Q2PG01_BAD-01          ---------------------------------------------
A0A2I3H4B2_BAD-01      ---------------------------------------------
A8MXU7_BAD-05          ---------------------------------------------
A8MXU7_BAD-06          ---------------------------------------------
Q6P7C5_BAD-01          ---------------------------------------------
A0A3B1JLM2_BAD-01      ---------------------------------------------
A0A4W4DXF5_BAD-01      ---------------------------------------------
A0A3P8Y761_BAD-02      ---------------------------------------------
A0A3P9A5G8_BAD-01      ---------------------------------------------
A0A2D0SYM2_BAD-01      ---------------------------------------------
A0A3B4DUY7_BAD-01      ---------------------------------------------
E7FBJ6_BAD-01          ---------------------------------------------
A0A4W5MZR2_BAD-01      ---------------------------------------------
B5XEF1_BAD-01          ---------------------------------------------
H3D8J8_BAD-01          ---------------------------------------------
A0A3B5L9R9_BAD-01      ---------------------------------------------
A0A3B4CPH6_BAD-01      ---------------------------------------------
A0A4W5JLL9_BAD-02      ---------------------------------------------
A0A3Q2QC80_BAD-01      ---------------------------------------------
A0A3Q3FKT9_BAD-02      LHSSL----------------------------------------
A0A3P9B2E4_BAD-01      ---------------------------------------------
I3K7B6_BAD-01          ---------------------------------------------
A0A3Q3C680_BAD-01      ---------------------------------------------
A0A3P8QRJ7_BAD-01      ---------------------------------------------
A0A3Q4GGN3_BAD-01      ---------------------------------------------
A0A3B4GXJ6_BAD-01      ---------------------------------------------
A0A3Q3FKT9_BAD-03      ---------------------------------------------
A0A3Q2D5S0_BAD-01      ---------------------------------------------
A0A3Q0QNQ2_BAD-01      ---------------------------------------------
A0A3P8WI83_BAD-01      ---------------------------------------------
A0A3P8WI83_BAD-02      ---------------------------------------------
A0A3P9HNZ2_BAD-01      ---------------------------------------------
A0A3B3BQF7_BAD-01      ---------------------------------------------
A0A3Q1K1C7_BAD-01      ---------------------------------------------
A0A3Q1K1C7_BAD-02      ---------------------------------------------
A0A3Q1GWH9_BAD-01      ---------------------------------------------
A0A3Q1CPU7_BAD-01      ---------------------------------------------
A0A3P8TWH6_BAD-01      ---------------------------------------------
A0A4W6EMZ7_BAD-02      ---------------------------------------------
A0A2U9BAC9_BAD-01      ---------------------------------------------
A0A4W6EMZ7_BAD-01      ---------------------------------------------
A0A3B4VFC5_BAD-01      ---------------------------------------------
A0A3B4W9T1_BAD-01      ---------------------------------------------
A0A452IFQ4_BAD-01      ---------------------------------------------
C1C3S9_BAD-01          ---------------------------------------------
A0A4W4HE29_BAD-01      ---------------------------------------------
A0A337SAW2_BAD-01      ---------------------------------------------
A0A3P9A5G8_BAD-02      ---------------------------------------------
A0A4W5R1T6_BAD-01      ---------------------------------------------
B5X1T1_BAD-01          ---------------------------------------------
Q4V925_BAD-02          ---------------------------------------------
Q4V925_BAD-03          ---------------------------------------------
A7MCM4_BAD-01          ---------------------------------------------
Q4V925_BAD-01          ---------------------------------------------
Q4V925_BAD-04          ---------------------------------------------
A0A3P8Y761_BAD-01      ---------------------------------------------
A0A4W5JLL9_BAD-01      ---------------------------------------------
A0A3B5Q2N7_BAD-01      ---------------------------------------------
A0A087X8P8_BAD-01      ---------------------------------------------
A0A3B3UA11_BAD-01      ---------------------------------------------
A0A3B3YFR1_BAD-01      ---------------------------------------------
A0A3P9Q7C3_BAD-01      ---------------------------------------------
A0A3B3HDU2_BAD-01      ---------------------------------------------
A0A3P9KSL7_BAD-01      VTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQARQNFLEPSIRT
A0A3P9KSL7_BAD-02      VTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQR-----------
A0A3B5BAL2_BAD-01      ---------------------------------------------
A0A3Q3AEL8_BAD-01      ---------------------------------------------
A0A3Q3AEL8_BAD-02      ---------------------------------------------
G3Q8B3_BAD-01          ---------------------------------------------
A0A3Q2Y0E4_BAD-01      ---------------------------------------------
A0A3Q3R5S3_BAD-01      ---------------------------------------------
A0A3Q3RXS8_BAD-01      ---------------------------------------------
A0A3Q3RXS8_BAD-02      ---------------------------------------------
A0A3Q0QNQ2_BAD-02      ---------------------------------------------
A0A3Q3WTY4_BAD-01      ---------------------------------------------
A0A3Q3FKT9_BAD-01      ---------------------------------------------
A0A3B1IH05_BAD-01      ---------------------------------------------
A0A5F8GA49_BAD-01      ---------------------------------------------
A0A3B3QX41_BAD-01      ---------------------------------------------
H3ANP3_BAD-03          ---------------------------------------------
H3ANP3_BAD-04          ---------------------------------------------
H3ANP3_BAD-01          ---------------------------------------------
H3ANP3_BAD-02          ---------------------------------------------
A0A4X2KAA5_BAD-01      ---------------------------------------------
G3VRY3_BAD-01          ---------------------------------------------
G3VRY3_BAD-02          ---------------------------------------------
A0A2I3TBK7_BAD-01      ---------------------------------------------
A0A2R8Z688_BAD-02      ---------------------------------------------
A0A2I2Z8C7_BAD-03      ---------------------------------------------
A8MXU7_BAD-03          ---------------------------------------------
A0A2K5M0A7_BAD-02      ---------------------------------------------
A0A2K5XJR2_BAD-02      ---------------------------------------------
A0A096MLD5_BAD-03      ---------------------------------------------
A0A2K5VCA9_BAD-02      ---------------------------------------------
A0A2K6E7I4_BAD-02      ---------------------------------------------
A0A2K5PDB1_BAD-02      ---------------------------------------------
A0A2K5E6A6_BAD-02      ---------------------------------------------
A0A2K6TG62_BAD-02      ---------------------------------------------
A0A2K5HKU7_BAD-02      ---------------------------------------------
A0A2K6N196_BAD-02      ---------------------------------------------
A0A2K6PUL3_BAD-02      ---------------------------------------------
A0A2K5M0A7_BAD-03      ---------------------------------------------
A0A2K5VCA9_BAD-03      ---------------------------------------------
A0A2K5XJR2_BAD-03      ---------------------------------------------
A0A096MLD5_BAD-02      ---------------------------------------------
A0A2K6E7I4_BAD-03      ---------------------------------------------
A0A2I2Z8C7_BAD-04      ---------------------------------------------
A8MXU7_BAD-04          ---------------------------------------------
A0A2I3TBK7_BAD-03      ---------------------------------------------
A0A2R8Z688_BAD-03      ---------------------------------------------
A0A2K5E6A6_BAD-03      ---------------------------------------------
A0A2K5PDB1_BAD-03      ---------------------------------------------
A0A2K6TG62_BAD-03      ---------------------------------------------
G1P8C5_BAD-01          ---------------------------------------------
A0A452ER54_BAD-02      ---------------------------------------------
W5P8G9_BAD-01          ---------------------------------------------
G3TP47_BAD-01          ---------------------------------------------
A0A287CT05_BAD-01      ---------------------------------------------
A0A287CT05_BAD-02      ---------------------------------------------
A0A1U7Q4V0_BAD-01      ---------------------------------------------
Q61337_BAD-02          ---------------------------------------------
Q61337_BAD-01          ---------------------------------------------
A0A091DDU4_BAD-01      ---------------------------------------------
G5B6Q3_BAD-02          ---------------------------------------------
G5B6Q3_BAD-01          ---------------------------------------------
Q61337_BAD-05          ---------------------------------------------
Q61337_BAD-03          ---------------------------------------------
Q61337_BAD-04          ---------------------------------------------
Q61337_BAD-06          ---------------------------------------------
Q61337_BAD-07          ---------------------------------------------
O35147_BAD-01          ---------------------------------------------
F7DN67_BAD-01          ---------------------------------------------
Q45KI9_BAD-01          ---------------------------------------------
A0A3Q7SWS0_BAD-01      ---------------------------------------------
H0WVR2_BAD-01          ---------------------------------------------
A0A2K6GWV0_BAD-01      ---------------------------------------------
H0V608_BAD-01          ---------------------------------------------
A0A1S3FL84_BAD-01      ---------------------------------------------
A0A2K5PDB1_BAD-01      ---------------------------------------------
U3F2S3_BAD-01          ---------------------------------------------
A0A2K5E6A6_BAD-01      ---------------------------------------------
A0A2K6TG62_BAD-01      ---------------------------------------------
A0A0D9R491_BAD-01      ---------------------------------------------
A0A2K5M0A7_BAD-01      ---------------------------------------------
A0A2K5VCA9_BAD-01      ---------------------------------------------
A0A1D5QBW1_BAD-01      ---------------------------------------------
A0A2K6E7I4_BAD-01      ---------------------------------------------
A0A2K5XJR2_BAD-01      ---------------------------------------------
A0A096MLD5_BAD-04      ---------------------------------------------
A0A2K6N196_BAD-01      ---------------------------------------------
A0A2K6PUL3_BAD-01      ---------------------------------------------
A0A2K5HKU7_BAD-01      ---------------------------------------------
B4DZQ9_BAD-01          ---------------------------------------------
A0A096MLD5_BAD-01      ---------------------------------------------
A0A2I2Z8C7_BAD-01      ---------------------------------------------
A0A2I2Z8C7_BAD-02      ---------------------------------------------
A8MXU7_BAD-01          ---------------------------------------------
A8MXU7_BAD-02          ---------------------------------------------
A0A2I3TBK7_BAD-02      ---------------------------------------------
A0A2R8Z688_BAD-01      ---------------------------------------------
A0A2J8TYJ3_BAD-01      ---------------------------------------------
G1MI17_BAD-01          ---------------------------------------------
A0A4X1VE31_BAD-01      ---------------------------------------------
A0A4X1VE31_BAD-02      ---------------------------------------------
A0A287AEF3_BAD-01      ---------------------------------------------
A0A4X1VE31_BAD-03      ---------------------------------------------
M3YNE7_BAD-01          ---------------------------------------------
A0A452RJM6_BAD-01      ---------------------------------------------
A0A384DJL2_BAD-01      ---------------------------------------------
A0A452ER54_BAD-01      ---------------------------------------------
A0A4W2C9A8_BAD-01      ---------------------------------------------
A0A4W2C9A8_BAD-01      ---------------------------------------------
F1MUT9_BAD-01          ---------------------------------------------
Q3SYZ0_BAD-01          ---------------------------------------------
                                                                    

© 1998-2020Legal notice