Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

130 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A0A337SAW2_BAD-01      MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A3B1IH05_BAD-01      --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
A8MXU7_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K5VCA9_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A8MXU7_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z688_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A1U7Q4V0_BAD-01      --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
A0A091DDU4_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
F1PK10_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2R8Z688_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A3Q2QC80_BAD-01      ------------------------------------------MSPSSSSH
A0A3Q3FKT9_BAD-03      ----------------------------------------------MKCN
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
A0A3B1JLM2_BAD-01      ----MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWN
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          -----------------------------------------------MGD
Q61337_BAD-05          --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A3B1IH05_BAD-01      ---------MSTAARAAAGTCDSTAVSQPSKLDFTMDH------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
A0A3B3QX41_BAD-01      -----------------------------------------------MSG
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
A8MXU7_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K5VCA9_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A8MXU7_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z688_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      ------------------------------------------------YR
W5P8G9_BAD-01          --------------------------------------------QGPRYR
G3TP47_BAD-01          ----------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSSGGLQS-
A0A1U7Q4V0_BAD-01      ---------MGTPKQPSLAPAHALGVRKS---DPGIRSLGNDAGGRRRRP
Q61337_BAD-01          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
A0A287CT05_BAD-02      ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A287CT05_BAD-01      ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
O35147_BAD-01          -----------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPA
A0A091DDU4_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      ---------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPA
G1MI17_BAD-01          -----------VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALAPT
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      -----------------MGTPENPSAAPTTRKLSIRRRRRESGGRQWAGP
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
F1PK10_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2R8Z688_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      ------MSNQYLQKLRRARFNCEEERYKKVIKTLTGEKGTPFNPLCWNSL
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A3Q3FKT9_BAD-01      -------------------------------------------MTLTASD
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A3Q2QC80_BAD-01      IGCFPYPLRNQINSSPSCTFISGLNFPNSCLP-----------------D
A0A3Q3FKT9_BAD-03      NKCYHF--IRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGVLD
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      ----------------------------------------MNVEVSIFPD
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      -----------------------------------------MAQSVETSD
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-02      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          PAAQSMFQ-IPEFEPSEQEDA--------STTDRGLGPSLTEDQ------
A0A3B1JLM2_BAD-01      SSGSTVFT-MEKTPPHSKEDD--------ISPIDDHDESRWSEA---VKS
A0A452IFQ4_BAD-01      -----MFR-IQEFP----DEV--------FPGRGKEAPAPPESQ---RGH
C1C3S9_BAD-01          SPHKSMFS-IEEFPPTERGSA--------FSGTN---PPGFGGD---PGH
Q61337_BAD-05          -----MFQ-IPEFEPSEQEDA--------SATDRGLGPSLTEDQ------
A0A337SAW2_BAD-01      AWAQSMFQ-IPEFEPSEQEDS--------SPTDRGLGPSPTGDR---P-R
A0A3B1IH05_BAD-01      -----MFT-ISDESDASEELG--------DSDQPEVSKTAE--------P
H3ANP3_BAD-01          -----MFQ-ISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT-----A
H3ANP3_BAD-02          -----MFQ-ISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT-----A
H3ANP3_BAD-03          -----MFQ-ISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKT-----A
A0A3B3QX41_BAD-01      VTMAHMFT-ISGNESDTSESD--------T-------PDVTANS---Q-L
A0A2I3TBK7_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2I2Z8C7_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A8MXU7_BAD-03          -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2K5M0A7_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSLAGDR---P-S
A0A2K5XJR2_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSLAGDR---P-S
A0A2K5VCA9_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K6E7I4_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K5HKU7_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K6N196_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K6PUL3_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K5M0A7_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSLAGDR---P-S
A0A2K5VCA9_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A096MLD5_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDK---P-S
A0A2K6E7I4_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A8MXU7_BAD-04          -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2I3TBK7_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2R8Z688_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2K5E6A6_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLSPSTAGDR---P-P
A0A2K5PDB1_BAD-03      -----MFQ-IPEFEPSEQEGS--------SSAERGLNPSTAGDS---P-P
A0A2K6TG62_BAD-03      -----MFQ-IPEFEPSEQEDS--------SSAERGLSPSTAGDS---P-P
G3VRY3_BAD-01          -----MFQ-ISEFEPSEPGED--------PSASTAPSLAPLRPG---PRA
G3VRY3_BAD-02          -----MFQ-ISEFEPSEPGED--------PSASTAPSLAPLRPG---PRA
G1P8C5_BAD-01          PTAQSMFQ-IPEFEHSEQEDS--------SPADRGLGPCPTGDQ---P-P
A0A452ER54_BAD-02      AWAQSMFQ-IPEFEQSEQEDS--------SPADRGLGPSPTGDR---P-P
W5P8G9_BAD-01          AWAQSMFQ-IPEFEQSEQEDS--------SPADRGLGPSPTGDR---P-P
G3TP47_BAD-01          -----MFQ-IPEFEQSDREDS--------TPADRGLGPSPEGYW---P-S
A0A1U7Q4V0_BAD-01      A-AQSMFQ-IPEFEPSEQEDS--------NTADRGLGPSLTGDP---P-G
Q61337_BAD-01          A-AQSMFQ-IPEFEPSEQEDA--------SATDRGLGPSLTEDQ---P-G
A0A287CT05_BAD-02      AWTQSMFQ-IPEFEPSEQEDS--------SSAEGGLGPSPAGDR---P-G
A0A287CT05_BAD-01      AWTQSMFQ-IPEFEPSEQEDS--------SSAEGGLGPSPAGDR---P-G
O35147_BAD-01          A--QSMFQ-IPEFEPSEQEDA--------STTDRGLGPSLTEDQ---P-G
A0A091DDU4_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSEERGLGPSPIGDQ---L-G
A0A287AEF3_BAD-01      S--QSMFQ-IPEFEQSEQEDS--------SPADRGLGPSPTGTD---P--
G1MI17_BAD-01          A--QSMFQ-IPEFEPSEQEDS--------SPADRGLGPSPTGDQ---P-P
M3YNE7_BAD-01          -----MFQ-IPEFEPSEQEDS--------SPADRGLGPSPTGDQ---P-P
A0A452RJM6_BAD-01      -----MFQ-IPEFEPSEQEDS--------SPADRGLGPSPTGDQ---P-P
A0A384DJL2_BAD-01      -----MFQ-IPEFEPSEQEDS--------SPADRGLGPSPTGDQ---P-P
A0A452ER54_BAD-01      R--GSMFQ-IPEFEQSEQEDS--------SPADRGLGPSPTGDR---P-P
F1MUT9_BAD-01          -----MFQ-IPEFEQSEQEDS--------SPADRGLGPSPTGDR---P-P
Q3SYZ0_BAD-01          -----MFQ-IPEFEQSEQEDS--------SRADRGLGPSPTGDR---P-P
F7DN67_BAD-01          -----MFQ-IPEFEQSEPEDS--------SPADRGLGPSPTGDW---P-S
F1PK10_BAD-01          -----MFQ-IPEFEPSEQEDS--------SPANRGLGPSPTGDR---P-P
Q45KI9_BAD-01          -----MFQ-IPEFEPSEQEDS--------SPANRGLGPSPTGDR---P-P
H0WVR2_BAD-01          -----MFQ-IPEFEPSEQEDS--------SSSDRGLGPSPSGDQ---P-L
A0A2K6GWV0_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAGRGLGPSPSGDR---P-S
H0V608_BAD-01          -----MFQ-IPEFEPSEQEDS--------SSEERGLGPSPTGDE---L-G
A0A1S3FL84_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSADRGLGPSLC---------
A0A2K5PDB1_BAD-01      -----MFQ-IPEFEPSEQEGS--------SSAERGLNPSTAGDS---P-P
A0A2K5E6A6_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLSPSTAGDR---P-P
A0A2K6TG62_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLSPSTAGDS---P-P
A0A0D9R491_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGNR---P-S
A0A2K5HKU7_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K5XJR2_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSLAGDR---P-S
A0A2K6N196_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A2K6PUL3_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
B4DZQ9_BAD-01          -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A096MLD5_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDK---P-S
A0A2I2Z8C7_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2I2Z8C7_BAD-02      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2R8Z688_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDG---P-S
A0A2J8TYJ3_BAD-01      -----MFQ-IPEFEPSEQEDS--------SSAERGLGPSPAGDR---P-S
A0A3B4DUY7_BAD-01      RTTACAMEKHSEDGISTMDDQ--------DESNWSETVKNGDSPQLDSQH
E7FBJ6_BAD-01          ---------MENTSHDHQDDS--------------STLDEKERSHLKGTI
B5XEF1_BAD-01          ----------MDYTHDCVDEC--------ESDHSGTTRNSEFQLHVSTTM
A0A3Q3FKT9_BAD-01      VTMAAKFT-ISDSESGSEEEV--------KEEENDQSSAVE------EPH
A0A3B4CPH6_BAD-01      --MAHMFT-LSD-DSDTSEDL--------GDADQPEASKRAE--------
A0A3P9A5G8_BAD-01      --MAFKMDHTQDCVGDIPENI--------NEKYDLDHLGTT------HYP
A0A3P9A5G8_BAD-02      --MAFKMDHTQDCVGDIPENI--------NEKYDLDHLGTT------HYP
B5X1T1_BAD-01          ------MDHTHDCVDDNPETM--------NEHDESDHSGTT------HYP
A0A3Q2QC80_BAD-01      DTMAAKFT-ISDSDSEPPEEV--------EEEGNDQPADGK------VEP
A0A3Q3FKT9_BAD-03      VTMAAKFT-ISDSESGSEEEV--------KEEENDQSSAVE------EPH
H3D8J8_BAD-01          --MAAKFSLCSDSDSEPSEEV--------EEGERGS--------------
A0A3B5L9R9_BAD-01      --MDTKFTI-SDGESDPSEDV--------EE-------------------
A0A3P9B2E4_BAD-01      --MAANFK-ISDSDSEASEEV--------GEGENQQSAG--------QAQ
I3K7B6_BAD-01          --MAANFT-ISDSESETSEEV--------GEEENQQPAG--------QDQ
A0A3Q3C680_BAD-01      --MAANFK-ISDSDSEASEEV--------GEEENQQSAG--------QAQ
A0A3P8QRJ7_BAD-01      --MAANFK-ISDSDSEASEEV--------GEGENQQSAG--------QAQ
A0A3Q4GGN3_BAD-01      --MAANFK-ISDSDSETSEEV--------GEGENQQSAR--------QVQ
A0A3B4GXJ6_BAD-01      --MAANFK-ISDSDSEASEEV--------GEGENQQSAG--------QAQ
A0A3Q0QNQ2_BAD-01      --FIHFLP-FIQGRGQQPSHL------------LQLIWGTP------RHS
A0A3P8WI83_BAD-02      VTMAAQFT-ISDSESEPEEEV--------EGGKIKHSLNDP------EQV
A0A3P8WI83_BAD-01      --MAAQFT-ISDSESEPEEEV--------EGGKIKHSLNDP------EQV
A0A3Q2D5S0_BAD-01      PIMAATFT-ISDSDTEPSEEV--------EETRNKE--------------
A0A3P9HNZ2_BAD-01      --MAAKFT-ISD-DSESSEEV--------EGGKLDLGAAGG-GGGGEGEH
A0A3B3BQF7_BAD-01      --MAAKFS-ISDNDSESSEEV--------EGGRLDLAASGGEGGGGGGGH
A0A3Q1K1C7_BAD-02      --MAARFT-ISDSDSDPSEGM--------EEEGHNQSPPGQ------EQQ
A0A3Q1K1C7_BAD-01      --MAARFT-ISDSDSDPSEGM--------EEEGHNQSPPGQ------EQQ
A0A3Q1GWH9_BAD-01      --MAAKFS-ISDGDSEPEE----------VEGENNHSPATE------AMP
A0A3Q1CPU7_BAD-01      --MAAKFT-ISDSESEPSEEV--------EEGENNHSPATQ------AMP
A0A3P8TWH6_BAD-01      --MAAKFT-ISDSESEPSEEV--------EEGENNHSPATQ------AMP
A0A2U9BAC9_BAD-01      --MAANFT-ISDSESEPSEEV--------EEGEVSQPWTGP------GEQ
A0A3B4VFC5_BAD-01      --MAANFT-ISDSESEPSEEV--------DEGEMSQSLTGQ------EQE
A0A3B4W9T1_BAD-01      --MAANFT-ISDSESEPSEEV--------DEGEMSQSLTGQ------EQE
Q4V925_BAD-03          --MAHMFNISDDSETETMEDS--------EDSSLDKHKSGSAQK------
Q4V925_BAD-02          --MAHMFNISDDSETETMEDS--------EDSSLDKHKSGSAQK------
A7MCM4_BAD-01          --MAHMFNISDDSETETMEDS--------EASSLDKHKSGSAQK------
Q4V925_BAD-01          --MAHMFNISDDSETETMEDS--------EDSSLDKHKSGSAQK------
Q4V925_BAD-04          --MAHMFNISDDSETETMEDS--------EDSSLDKHKSGSAQK------
A0A3P8Y761_BAD-01      --MENIFT-ISDTESESSDVE--------ETKKEWIAGQGKTGS------
A0A3B5Q2N7_BAD-01      --MDTKFT-ISDGESDPSEDV--------EERGDLQLMQEKEKP-----L
A0A087X8P8_BAD-01      --MDAKFT-ISDSDSEPSEDV--------EERGNLQLMQVKERP-----L
A0A3B3UA11_BAD-01      --MDAKFT-ISDSDSEPSEDV--------EERGNLQLMQVKERP-----L
A0A3B3YFR1_BAD-01      --MDAKFT-ISDSDSEPSEDV--------EERGNLQLMQVKERP-----L
A0A3P9Q7C3_BAD-01      --MDAKFT-ISDSDSEPSEDV--------EERGNLQLMQVKERP-----L
A0A3B3HDU2_BAD-01      --MAAKFT-ISD-DSESSEEV--------EGGKLDLGAAAGGEG---EHL
A0A3P9KSL7_BAD-01      --MAAKFT-ISD-DSESSEEV--------EGGKLDLGAAAGGEG---EHL
A0A3P9KSL7_BAD-02      --MAAKFT-ISD-DSESSEEV--------EGGKLDLGAAAGGEG---EHL
A0A3B5BAL2_BAD-01      --MAAQFS-ISGSESDP-EEV--------EEGENNHPPAEQPMH-----V
A0A3Q3AEL8_BAD-01      --MAAKFT-ISDSESEPSDEV--------EEGKSKQPAAGPEDG------
A0A3Q3AEL8_BAD-02      --MAAKFT-ISDSESEPSDEV--------EEGKSKQPAAGPEDG------
G3Q8B3_BAD-01          --MAAHFT-ISDSESEPSDGV--------EEREDGQLSSGQEQQ-----R
A0A3Q2Y0E4_BAD-01      --MAANFS-ISDSESEPSEEV--------EEGDDGQGAAEKEQE---QCL
A0A3Q3R5S3_BAD-01      --MAANFT-ISDSESESSEEV--------EEGKHSQSSTSQEQQ-----V
A0A3Q3RXS8_BAD-01      --MAAKFS-ISESESDSSEEV--------EGGKQKKSSARQEQQ-----V
A0A3Q3RXS8_BAD-02      --MAAKFS-ISESESDSSEEV--------EGGKQKKSSARQEQQ-----V
A0A3Q0QNQ2_BAD-02      ---------MPEPPRLVLFDV--------EEGQSPFREGSFLLL-----V
A0A3Q3WTY4_BAD-01      --MATNFTISSDSESELSEEI--------EEGENSQLQTEQEQQ-----V
                                                                         

Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          ---PGPYLAPGLLGSIVQ-------QQPGQAANNSHHG------------
A0A3B1JLM2_BAD-01      VDSPQTDSGPSMYRDTSSDELLEVGGRVRLYSESQVYN------------
A0A452IFQ4_BAD-01      TPGSKQPDTPTAEVRSRI-------GSDT---------------------
C1C3S9_BAD-01          KSSPNLRRIKGKETRQRT-------ESAS---------------------
Q61337_BAD-05          ---PGPYLAPGLLGSNIH-------QQGR-AATNSHHG--GAGAMETR--
A0A337SAW2_BAD-01      GPGKHQRTTPGLLGEAGH-------QQGQ-PASSNHHG--GAGAVETR--
A0A3B1IH05_BAD-01      SRSGQHITVPEKLRVEPR-------QRNFSMNEEALQE-SGAGRHEDG--
H3ANP3_BAD-01          GLKKHSRTAPNLQNPGPH-------QSHP-PSHT-------------DNM
H3ANP3_BAD-02          GLKKHSRTAPNLQNPGPH-------QSHP-PSHT-------------DNM
H3ANP3_BAD-03          GLKKHSRTAPNLQNPGPH-------QSHP-PSHTGVYG--WVKLRKRNNM
A0A3B3QX41_BAD-01      GNNLKNTKNPGEAGGRVR-------MRSESQVSSIRSE------------
A0A2I3TBK7_BAD-01      GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--EGT--SSPEE
A0A2I2Z8C7_BAD-03      GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--EGT--SSPEE
A8MXU7_BAD-03          GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--EGT--SSPEE
A0A2K5M0A7_BAD-02      DCGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GT---SSPEE
A0A2K5XJR2_BAD-02      DCGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GT---SSPEE
A0A2K5VCA9_BAD-02      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GT---SSPEE
A0A2K6E7I4_BAD-02      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GT---SSPEE
A0A2K5HKU7_BAD-02      DSGKHHRQAPGLLWDASH-------QQEQ-ATSSSHHG--GRAWYSPS-E
A0A2K6N196_BAD-02      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRAWYYPA-E
A0A2K6PUL3_BAD-02      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRAWYYPA-E
A0A2K5M0A7_BAD-03      DCGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GGAWYSPSWE
A0A2K5VCA9_BAD-03      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRAWYSPSWE
A0A096MLD5_BAD-02      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRAWYSPSWE
A0A2K6E7I4_BAD-03      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRAWYSPSWE
A8MXU7_BAD-04          GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRTSYSPSWE
A0A2I3TBK7_BAD-03      GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRTSYSPSWE
A0A2R8Z688_BAD-03      GSSKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GRTSYSPSWE
A0A2K5E6A6_BAD-03      GSGKHPRQAPGLPGDASH-------QQGQ-PTSSSHHG--GE--YSTCAS
A0A2K5PDB1_BAD-03      GSGKHRRQAPGLPGDASH-------QQGQ-PTSSSHHG------------
A0A2K6TG62_BAD-03      GSGKHRRQAPGLPGDASH-------QQGQ-PTSSSHHG------------
G3VRY3_BAD-01          APGAHHHEGAGAGRPRLI-------SYPPL-----------------REG
G3VRY3_BAD-02          APGAHHHEKGGAQKSQTH-------VSKELKASASQGR-LGKGSFEGREG
G1P8C5_BAD-01          GLNKHWSTVPGLLGEAGH-------QQGQ-PASSSHHD--GAGSVEPR--
A0A452ER54_BAD-02      GLSKHWLTAPGLLGEAGH-------QQGQ-PAGSSHHG--GTGAVETR--
W5P8G9_BAD-01          GLSKHWLTAPGLLGEAGH-------QQGQ-PAGSSHHG--GTGAVETR--
G3TP47_BAD-01          GPSDRHRVAPGFLRDSSH-------QQGQ-PTSSGHHG--GAAAVETR--
A0A1U7Q4V0_BAD-01      PC-----LAPGLLGNIRH-------QQEQ-AANSSHHG--GTGAMETR--
Q61337_BAD-01          PY-----LAPGLLGSNIH-------QQGR-AATNSHHG--GAGAMETR--
A0A287CT05_BAD-02      CG-----LAPGLPRDTGH-------QQWQ-ATSSSNHG--GAGATETR--
A0A287CT05_BAD-01      CG-----LAPGLPRDTGH-------QQWQ-ATSSSNHG--GAGATETR--
O35147_BAD-01          PY-----LAPGLLGSIVQ-------QQPGQAANNSHHG--GAGTMETR--
A0A091DDU4_BAD-01      PS-----PARGFLGDTSH-------QQRQ-LFSSRHHG--GAGAMETR--
A0A287AEF3_BAD-01      ---QPWRTAPGHLGEAGH-------QQGQ-PASSSHHG--GAGAVETR--
G1MI17_BAD-01          GPGKHRQTAPGLLGEAAH-------PQGQ-PASSNHHG--GAGAVEPR--
M3YNE7_BAD-01          GLGKHLQTAPGLLGEAGH-------QQGQ-PASSSHHG--GAGAVETR--
A0A452RJM6_BAD-01      GPGKHRQTAPGLLGEAAQ-------PQGQ-PASSNHHG--GAGAVEPR--
A0A384DJL2_BAD-01      GPGKHRQTAPGLLGEAAH-------PQGQ-PASSNHHG--GAGAVEPR--
A0A452ER54_BAD-01      GLT------PGLLGEAGH-------QQGQ-PAGSSHHG--GTGAVETR--
F1MUT9_BAD-01          GLSKHWLTAPGLLGEAGH-------QQGQ-PAGSSHHG--GTGAVETR--
Q3SYZ0_BAD-01          GLSKHWLTAPGLLGEAGH-------QQGQ-PAGSSHHG--GTGAVETR--
F7DN67_BAD-01          DPVRHQRTAPGLLGEAGH-------QQGQ-PASSSHHG--GAGAVETR--
F1PK10_BAD-01          SPGKHQQTAPGLLGEAGH-------QQGQ-PASRKHHG--GAGA-ETR--
Q45KI9_BAD-01          SPGKHQQTAPGLLGEAGH-------QQGQ-PASRKHHG--GAGA-ETR--
H0WVR2_BAD-01          GPGKNRCTTPSLLGDASH-------LQGQ-PASNTHHG-AGPGAVETR--
A0A2K6GWV0_BAD-01      GPGKHPCTAPSFLGDASH-------QQGQ-PSSSSHHG--GAGSVETR--
H0V608_BAD-01          SS-----PAGGFLGDTSH-------QQRQLRSSRSHHG--GTVAMETR--
A0A1S3FL84_BAD-01      -------PAPGLLGDHSP-------QQGL-PTSRSHHG--GAGAVETR--
A0A2K5PDB1_BAD-01      GSGKHRRQAPGLPGDASH-------QQGQ-PTSSSHHG--GAGAVETR--
A0A2K5E6A6_BAD-01      GSGKHPRQAPGLPGDASH-------QQGQ-PTSSSHHG--GAGAVETR--
A0A2K6TG62_BAD-01      GSGKHRRQAPGLPGDASH-------QQGQ-PTSSSHHG--GAGAVETR--
A0A0D9R491_BAD-01      DSGKHHHQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVETR--
A0A2K5HKU7_BAD-01      DSGKHHRQAPGLLWDASH-------QQEQ-ATSSSHHG--GAGAVETR--
A0A2K5XJR2_BAD-01      DCGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVETR--
A0A2K6N196_BAD-01      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVETR--
A0A2K6PUL3_BAD-01      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVETR--
B4DZQ9_BAD-01          GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVEIR--
A0A096MLD5_BAD-01      DSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVETR--
A0A2I2Z8C7_BAD-01      GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVEIR--
A0A2I2Z8C7_BAD-02      GSGKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVEIR--
A0A2R8Z688_BAD-01      GSSKHHRQAPGLLWDASH-------QQEQ-PTSSSHHG--GAGAVEIR--
A0A2J8TYJ3_BAD-01      GSSKHHRQAPGLLRDASH-------QQEQ-PTSSSHHG--GAGAVEIR--
A0A3B4DUY7_BAD-01      SMASNISPASPDELSEVG-------CRVRLYSESQVYT-VSRWQ------
E7FBJ6_BAD-01          KNHGQHQDRTSAN-ISPQ-------GRVRLYSESQVYT-VSRWQ------
B5XEF1_BAD-01          SNRPR-----------PG-------ERVRLYSESQVRSQVGKRE------
A0A3Q3FKT9_BAD-01      VPQRHSLTLPELR-LAGT-------GRIRLNSESHAYT-VSRDE------
A0A3B4CPH6_BAD-01      --------------LSQS-------GQHPLVPERFRES-RQRNH------
A0A3P9A5G8_BAD-01      EFQFCNTSTNTSNRTLPG-------VRVRLYSESQVCS-QVGRQ------
A0A3P9A5G8_BAD-02      EFQFCNTSTNTSNRTLPG-------VRVRLYSESQVCS-QVGRQ------
B5X1T1_BAD-01          EFQRHYVSTRTGIRPRPG-------GRVRLYSESQVCS-QVGRR------
A0A3Q2QC80_BAD-01      LRQRHALTLPELR--SGH-------GRIRLNSESHAST-ISREE------
A0A3Q3FKT9_BAD-03      VPQRHSLTLPELR-LAGT-------GRIRLNSESHAYT-VSRDE------
H3D8J8_BAD-01          --------------FSTS-------GRIRVNSESQASA-VSRDE------
A0A3B5L9R9_BAD-01      -----------------R-------GDLQLMQEKEKPL-SQRHTLTLPEL
A0A3P9B2E4_BAD-01      ESKPQTLSLPVTK-TTAA-------GRLRVNSESHTSS-IARDE------
I3K7B6_BAD-01          ESKPQTLALPVIK-TTGA-------GRLRLNSESHTSS-VARDE------
A0A3Q3C680_BAD-01      ESKPQTLSLPVIK-TTAA-------GRLRVNSESHTSS-IARDE------
A0A3P8QRJ7_BAD-01      ESKPQTLSLPVTK-TTAA-------GRLRVNSESHTSS-IARDE------
A0A3Q4GGN3_BAD-01      ESKPQTLSLPVIK-TTAA-------GRLRVNSESHTSS-IARDE------
A0A3B4GXJ6_BAD-01      ESKPQTLSLPVIK-TTAA-------GRLRVNSESHTSS-IARDE------
A0A3Q0QNQ2_BAD-01      QAIGHDQNTSPMR-HPTA-------RRIRMNSESHTSS-VSRDE------
A0A3P8WI83_BAD-02      VPHRHNLTLPELR-VAGS-------RRIRLNSESHAST-ISREE------
A0A3P8WI83_BAD-01      VPHRHNLTLPELR-VAGS-------RRIRLNSESHAST-ISREE------
A0A3Q2D5S0_BAD-01      ---------PRIR-NSGK-------THRRIRLSSESHA-FTREE------
A0A3P9HNZ2_BAD-01      LHDRHSLTLPELR-LTSN-------GRTRLNSESTAST-YSRDE------
A0A3B3BQF7_BAD-01      LHDRHALTLPELR-LTSN-------GRTRLNSESTVST-YSRDE------
A0A3Q1K1C7_BAD-02      VFPRHTLTLPELR---AS-------GRIRLNSESHAST-VYRDE------
A0A3Q1K1C7_BAD-01      VFPRHTLTLPELR---AS-------GRIRLNSESHAST-VYRDE------
A0A3Q1GWH9_BAD-01      VFARRNMALPELR-TPAS-------GRIRLNSESHAST-LSRDE------
A0A3Q1CPU7_BAD-01      VFARRNMALPELR-TPAS-------GRLRLNSESHAST-LSRDE------
A0A3P8TWH6_BAD-01      VFARRNMALPELR-TPAS-------GRLRLNSESHAST-LSRDE------
A0A2U9BAC9_BAD-01      VPPRHTLALPELR-MAAT-------GRIRLNSESNAST-LSRDE------
A0A3B4VFC5_BAD-01      LSQRHTLTLPELR-GAAT-------GRTRLNSESHTST-VSRDE------
A0A3B4W9T1_BAD-01      LSQRHTLTLPELR-GAAT-------GRTRLNSESHTST-VSRDE------
Q4V925_BAD-03          ---KQHLTVPDRLKGEQL-------GRQR---------------------
Q4V925_BAD-02          ---KQHLTVPDRLKGEQL-------GRQR---------------------
A7MCM4_BAD-01          ---KQHLTVPDRLKGEQL-------GRQR---------------------
Q4V925_BAD-01          ---KQHLTVPDRLKGEQL-------GRQR---------------------
Q4V925_BAD-04          ---KQHLTVPDRLKGEQL-------GRQR---------------------
A0A3P8Y761_BAD-01      -RLGLSLNLPG------E-------GRIRLNSESQVFA-TSGGE------
A0A3B5Q2N7_BAD-01      -SQRHTLTLPELR--STT-------GRVRLNSESIAST-ISR-E------
A0A087X8P8_BAD-01      -SQRHTLTLPELR--STT-------GRVRLNSESIAST-ISR-E------
A0A3B3UA11_BAD-01      -SQRHTLTLPELR--STT-------GRVRLNSESIAST-ISR-E------
A0A3B3YFR1_BAD-01      -SQRHTLTLPELR--STT-------GRVRLNSESIAST-ISR-E------
A0A3P9Q7C3_BAD-01      -SQRHTLTLPELR--STT-------GRVRLNSESIAST-ISR-E------
A0A3B3HDU2_BAD-01      -HDRHSLTLPELR-LTSN-------GRTRLNSESTAST-YSRDE------
A0A3P9KSL7_BAD-01      -HDRHSLTLPELR-LTSN-------GRTRLNSESTAST-YSRDE------
A0A3P9KSL7_BAD-02      -HDRHSLTLPELR-LTSN-------GRTRLNSESTAST-YSRDE------
A0A3B5BAL2_BAD-01      -FERRNLALPELR-TPAA-------GRIRLNSESHATT-VSR-D------
A0A3Q3AEL8_BAD-01      --VRQRLTLPELR-HSKN-------GRLRVNSESLSST-SSRGE------
A0A3Q3AEL8_BAD-02      --VRQRLTLPELR-HSKN-------GRLRVNSESLSST-SSRGE------
G3Q8B3_BAD-01          -LQRHTLTLPELRLSGRK-------SQRIVEKE-----------------
A0A3Q2Y0E4_BAD-01      -RQGLRLTLPELPMEAMS-------GRIRLNSESHALA-VSR-E------
A0A3Q3R5S3_BAD-01      -PPCHSLTLPELRMAATS--------RNRVSSESNAST-VQ---------
A0A3Q3RXS8_BAD-01      -SQRHALALPELR-TTAS-------NRIRLSSES----------------
A0A3Q3RXS8_BAD-02      -SQRHALALPELR-TTAS-------NRIRLSSES----------------
A0A3Q0QNQ2_BAD-02      SVISFFWSLPKAF-SR--------------DEEL----------------
A0A3Q3WTY4_BAD-01      -FQRHTLTLPELR-MA--------------GRTL----------------
                                                                         

Q2PG01_BAD-01          ---------MEEE-------------PSPFRGRSRSAPPNLWAAQRYGRE
A0A2I3H4B2_BAD-01      ---------MGEE-------------PSPFRGRSRSAPPNLWAAQRYGRE
Q6P7C5_BAD-01          -----------------------------------------------GRF
A0A3B1JLM2_BAD-01      --INRWEDNENQD--GASAEDGGVGDGAPFRGRSQSAPAALWKAKKYGRQ
A0A452IFQ4_BAD-01      ---------------PSLEPEVQDEPGGAFRARSRSAPPILWAAMRYGRE
C1C3S9_BAD-01          ---------------EASETDSVGEL-QHFRSRSRSAPSSLMVAARYGRE
Q61337_BAD-05          SRHSSYPAGTEED--EGMEEEL-----SPFRGRSRSAPPNLWAAQRYGRE
A0A337SAW2_BAD-01      SRHSSYPAGTEED--EGTEEEE----PSPFRGRSRSAPPNLWAALRYGRE
A0A3B1IH05_BAD-01      ARDG-----------------------DSFRRRSRSAPPSLWAAKKYGRQ
H3ANP3_BAD-01          EILGRPSSESQIS--DSESLDE----LGPFRTRSRSAPPNFWAARKYGQE
H3ANP3_BAD-02          EILGRPSSESQIS--DSESLDE----LGPFRTRSRSAPPNFWAARKYGQE
H3ANP3_BAD-03          EILGRPSSESQIS--DSESLDE----LGPFRTRSRSAPPNFWAARKYGQE
A0A3B3QX41_BAD-01      DLDFGEGGASEEG--GGVCPGD----GTPFRGRSRSAPPALWAAQRYGRQ
A0A2I3TBK7_BAD-01      RGHSNPDAAKLQL--DASLPVL----VGSELGQG---------------K
A0A2I2Z8C7_BAD-03      RRHSNADAAKLQL--DASLPVL----VGSELGQG---------------K
A8MXU7_BAD-03          RGHSNADAAKLQL--DASLPVL----VGSELGQG---------------K
A0A2K5M0A7_BAD-02      RGHSDADAAKLQL--DASLPVL----VGSELGQG---------------K
A0A2K5XJR2_BAD-02      RGHSDADAAKLQL--DASLPVL----VGSELGQG---------------K
A0A2K5VCA9_BAD-02      RGHSDADAAKLQL--DASLPVL----VGSELGQG---------------K
A0A2K6E7I4_BAD-02      RGHSDADAAKLQL--DASLPVL----VGSELGQG---------------K
A0A2K5HKU7_BAD-02      SEDSENPSARMLT--EASAGMS----APATDSEAQHAE---------NVK
A0A2K6N196_BAD-02      SEDSENPSARMLA--EASAGMS----APATDSEAQLAE---------NVK
A0A2K6PUL3_BAD-02      SEDSENPSARMLA--EASAGMS----APATDSEAQLAE---------NVK
A0A2K5M0A7_BAD-03      SEDSENPSARMLA--EASARMS----APATDSEAQHAE---------NVK
A0A2K5VCA9_BAD-03      SEDSENPSARMLA--EASARMS----APATDSEAQHAE---------NVK
A0A096MLD5_BAD-02      SEDSENPSARMLA--EASAPMS----APATDSEAQHAE---------NVK
A0A2K6E7I4_BAD-03      SEDSENPSARMLA--EASARMS----APATDSEAQHAE---------NVK
A8MXU7_BAD-04          SEDSENPSAGMLA--EASAGMS----APAADSEAQHAE---------NVK
A0A2I3TBK7_BAD-03      SEDSENPSAGMLA--EASAGMS----APAADSEAQHAE---------NVK
A0A2R8Z688_BAD-03      SEDSENPSAGMLA--EASAGMS----APAADSEAQHAE---------NVK
A0A2K5E6A6_BAD-03      ASSSENPSARMLS--KASAGMS----APATDS-----E---------NVK
A0A2K5PDB1_BAD-03      ----ENPSARMLS--KTSAGMS----SPATDSEAQHTE---------NVK
A0A2K6TG62_BAD-03      ----ENPSAKMLS--KASAGMS----APATDSEAQHTE---------NVK
G3VRY3_BAD-01          SREASPEAEAEAE--QSEGEEE----RGLFRGRSSSAPPILWAARHYGSE
G3VRY3_BAD-02          SREASPEAEAEAE--QSEGEEE----RGLFRGRSSSAPPILWAARHYGSE
G1P8C5_BAD-01          SRHSSYPTGTEED--DDTEEGE----PSPFRGRSRSAPPNLWAAQRYGRE
A0A452ER54_BAD-02      SRHSSYPAGPEDD--EGTEEED----LGPFRGRSRSAPPNLWAAQRYGRE
W5P8G9_BAD-01          SRHSSYPAGPEDD--EGTEEED----LGPFRGRSRSAPPNLWAAQRYGRE
G3TP47_BAD-01          SRHSSYPAGSDEA--EGLEEDP-----SPFRGRSLSAPPNLWAAQRYGRE
A0A1U7Q4V0_BAD-01      SRHSSYTAGNEED--EGMEEEL-----SPFRGRSRSAPPNLWAAQRYGRE
Q61337_BAD-01          SRHSSYPAGTEED--EGMEEEL-----SPFRGRSRSAPPNLWAAQRYGRE
A0A287CT05_BAD-02      SRHSSYPADTDLD--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A287CT05_BAD-01      SRHSSYPADTDLD--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
O35147_BAD-01          SRHSSYPAGTEED--EGMEEEL-----SPFRGRSRSAPPNLWAAQRYGRE
A0A091DDU4_BAD-01      SRHSSYPTGTEEE--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A287AEF3_BAD-01      SRHSSYPEGTEED--EGTEDEE----LSPFRGRSLSAPPILWAAQRYGRE
G1MI17_BAD-01          SRHSSYPAGTEED--EGLEEEE----LSPFRGRSSSAPPNLCAALRYGRE
M3YNE7_BAD-01          SRHSSYPAGTEED--EGMEEEE----LSPFRGRSRSAPPNLCAALRYGRE
A0A452RJM6_BAD-01      SRHSSYPAGTEED--EGLEEEE----LSPFRGRSSSAPPNLCAALRYGRE
A0A384DJL2_BAD-01      SRHSSYPAGTEED--EGLEEEE----LSPFRGRSSSAPPNLCAALRYGRE
A0A452ER54_BAD-01      SRHSSYPAGPEDD--EGTEEED----LGPFRGRSRSAPPNLWAAQRYGRE
F1MUT9_BAD-01          SRHSSYRAGPEDN--EETEEED----LGPFRGRSRSAPPNLWAAQRYGRE
Q3SYZ0_BAD-01          SRHSSYRAGPEDN--EETEEED----LGPFRGRSRSAPPNLWAAQRYGRE
F7DN67_BAD-01          SRHSSYPEGTEDE--GMEGEEP-----GPFRGRSRSAPPNLWAARRYGRE
F1PK10_BAD-01          SRHSSFPAGTDED--EGMEEEE----LSPFRGRSSSAPPNLCAARRYGRE
Q45KI9_BAD-01          SRHSSFPAGTDED--EGMEEEE----LSPFRGRSSSAPPNLCAARRYGRE
H0WVR2_BAD-01          SRHSSYPAGTEED--EGI-EEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2K6GWV0_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
H0V608_BAD-01          SRHRSYPAGTEEE--EGMEEEL-----SPFRGRSRSAPPNLWAAQRYGRE
A0A1S3FL84_BAD-01      SRHSSYPAGMEED--EGLEEEP-----SPFRGRSRSAPPNLWAARRYGRE
A0A2K5PDB1_BAD-01      SRHRSYPAGTEED--EGMEEEP-----STFRGRSRSAPPNLWAAQRYGRE
A0A2K5E6A6_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2K6TG62_BAD-01      SRHSSYPAGTEGD--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A0D9R491_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2K5HKU7_BAD-01      SRHSSHPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2K5XJR2_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2K6N196_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2K6PUL3_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
B4DZQ9_BAD-01          SRHSSYPAGTEDD--EGMGEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A096MLD5_BAD-01      SRHSSYPAGTEED--EGMEEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2I2Z8C7_BAD-01      SRHSSYPAGTEDD--EGMGEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2I2Z8C7_BAD-02      SRHSSYPAGTEDD--EGMGEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2R8Z688_BAD-01      SRHSSYPAGTEDD--EGMGEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A2J8TYJ3_BAD-01      SRHSSYPAGTEDD--EGMGEEP-----SPFRGRSRSAPPNLWAAQRYGRE
A0A3B4DUY7_BAD-01      -----DNEDGLLA--EDGGAGD----GAPFRGRSQSAPAALWKAKKYGRQ
E7FBJ6_BAD-01          -------DTETQD----GASVEENGDGLPFRGRSQSAPAALWKAKKYGRQ
B5XEF1_BAD-01          -------DTEFQD--VMTPTEEGGGDGASFRGRSQSAPPALWAAKKYGCQ
A0A3Q3FKT9_BAD-01      -----ELQARGEE--EAGTPTE----GAPFRGRSKSAPPALWAAKKYGRQ
A0A3B4CPH6_BAD-01      -----SMNEDALQESGAVRHGDGAADGDSFRRRCRSAPPALWAAKKYGRQ
A0A3P9A5G8_BAD-01      --DNTEFQVAMTPTEESGGD------AAPFRGRSQSAPPALWAAKKYGCQ
A0A3P9A5G8_BAD-02      --DNTEFQVAMTPTEESGGD------AAPFRGRSQSAPPALWAAKKYGCQ
B5X1T1_BAD-01          --DNTEFQDVMTPTEEGGGD------GAPFRSRSQSAPPTLWAAKKYGRQ
A0A3Q2QC80_BAD-01      -----ELQGRAEE--EAGTPTE----GLPFRNRSNSAPPALWAAKKYGRQ
A0A3Q3FKT9_BAD-03      -----ELQARGEE--EAGTPTE----GAPFRGRSKSAPPALWAAKKYGRQ
H3D8J8_BAD-01          -----ELQGNGDD--EAGTPTD----GAPFRGRSRSAPPALWAAKKYGRQ
A0A3B5L9R9_BAD-01      RSTKVELQARGEE--EVGTPTE----GFPFRGRSLSAPPSLWAAKKYGRQ
A0A3P9B2E4_BAD-01      -----ELMARGED--EVCTPTE----GDPFRRRSKSAPPALWAAKKYGRQ
I3K7B6_BAD-01          -----DLMARGED--EVCTPTE----GDPFRRRSKSAPPALWAAKKYGQK
A0A3Q3C680_BAD-01      -----ELMARGED--EVCTPTE----GDPFRRRSKSAPPALWAAKKYGRQ
A0A3P8QRJ7_BAD-01      -----ELMARGED--EVCTPTE----GDPFRRRSKSAPPALWAAKKYGRQ
A0A3Q4GGN3_BAD-01      -----ELMARGED--EVCTPTE----GDPFRRRSKSAPPALWAAKKYGRQ
A0A3B4GXJ6_BAD-01      -----ELMARGED--EVCTPTE----GDPFRRRSKSAPPALWAAKKYGRQ
A0A3Q0QNQ2_BAD-01      -----ELVVRGED--EICTPTE----GDPFRRRSKSAPPALWAAKKYGQQ
A0A3P8WI83_BAD-02      -----AFQSWGEE--EAGTPTE----GAPFRGRSRSAPPALWAAKKYGRQ
A0A3P8WI83_BAD-01      -----AFQSWGEE--EAGTPTE----GAPFRGRSRSAPPALWAAKKYGRQ
A0A3Q2D5S0_BAD-01      -----E--ARGEE--EVGTPTE----GYPFRGRSNSAPPALWAAKKYGRQ
A0A3P9HNZ2_BAD-01      -----DLAR--ED--EAGTPTD----GLAFRGRSKSAPPALWAAKKYGQQ
A0A3B3BQF7_BAD-01      -----DLPR--ED--EAGTPTD----GLAFRGRSKSAPPALWAAKKYGQQ
A0A3Q1K1C7_BAD-02      -----ELQAKADE--EAGTPTD----GAPFRARSKSAPPALWAAKKYGQQ
A0A3Q1K1C7_BAD-01      -----ELQAKADE--EAGTPTD----GAPFRARSKSAPPALWAAKKYGQQ
A0A3Q1GWH9_BAD-01      -----ELQAKGEE--EAGTPTE----GAPFRARSKSAPPALWAAKKYGQQ
A0A3Q1CPU7_BAD-01      -----ELQARGEE--EAGTPTD----GAPFRARSKSAPPALWAAKKYGQQ
A0A3P8TWH6_BAD-01      -----ELQARGEE--EAGTPTD----GAPFRARSKSAPPALWAAKKYGQQ
A0A2U9BAC9_BAD-01      -----ELLTRWDE--EAGTPTD----GAPFRGRSKSAPPALWAAMKYGQK
A0A3B4VFC5_BAD-01      -----EFQARGEE--EAGTPTE----GAPFRGRSKSAPPALWAAKKYGQK
A0A3B4W9T1_BAD-01      -----EFQARGEE--EAGTPTE----GAPFRGRSKSAPPALWAAKKYGQK
Q4V925_BAD-03          -----NLSMNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQ
Q4V925_BAD-02          -----NLSMNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQ
A7MCM4_BAD-01          -----NLSMNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQ
Q4V925_BAD-01          -----NLSMNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQ
Q4V925_BAD-04          -----NLSMNEEDLLETGVAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQ
A0A3P8Y761_BAD-01      --RSGELQGLGQG--LNCVATE----GLPFRVRSQSAPPALWAAKRYGRQ
A0A3B5Q2N7_BAD-01      --V--ELQARGEE--EVGTPTE----GFPFRGRSLSAPPSLWAAKKYGRQ
A0A087X8P8_BAD-01      --E--ELQARGEE--EVGTPTE----GFPFRGRSNSAPPSLWAAKKYGRQ
A0A3B3UA11_BAD-01      --E--ELQARGEE--EVGTPTE----GFPFRGRSNSAPPSLWAAKKYGRQ
A0A3B3YFR1_BAD-01      --E--ELQARGEE--EVGTPTE----GFPFRGRSNSAPPSLWAAKKYGRQ
A0A3P9Q7C3_BAD-01      --E--ELQARGEE--EVGTPTE----GFPFRVRSNSAPPSLWAAKKYGRQ
A0A3B3HDU2_BAD-01      -------DLARED--EAGTPTD----GLAFRGRSKSAPPALWAAKKYGQQ
A0A3P9KSL7_BAD-01      -------DLARED--EAGTPTD----GLAFRGRSKSAPPALWAAKKYGQQ
A0A3P9KSL7_BAD-02      -------DLARED--EAGTPTD----GLAFRGRSKSAPPALWAAKKYGQQ
A0A3B5BAL2_BAD-01      --E--ELQARGEE--EAGTPTD----GAPFRGRSKSAPPALWAAKKYGQK
A0A3Q3AEL8_BAD-01      --E--ELPARADD--EPGTPTE----GYPFRGRSKSAPPALWAAKKYGRQ
A0A3Q3AEL8_BAD-02      --E--ELPARADD--EPGTPTE----GYPFRGRSKSAPPALWAAKKYGRQ
G3Q8B3_BAD-01          -------EELWLD--ETGTPTE----GAPFRVRSKSAPPALWAAKKYGRQ
A0A3Q2Y0E4_BAD-01      --E--EFQARVDE--EVGTPTD----GAPFRGRSKSAPPVLWAAKKYGRQ
A0A3Q3R5S3_BAD-01      -------DAKSDE--EAGTPTD----GAPFRGRSKSAPPALWAAKKYGRQ
A0A3Q3RXS8_BAD-01      -------QSRVDE--EAGTPTD----GAPFRGRSKSAPPALWAAKKYGQQ
A0A3Q3RXS8_BAD-02      -------QSRVDE--EAGTPTD----GAPFRGRSKSAPPALWAAKKYGQQ
A0A3Q0QNQ2_BAD-02      -------VVRGED--EICTPTE----GDPFRRRSKSAPPALWAAKKYGQQ
A0A3Q3WTY4_BAD-01      -------QVKGED--EAGTPTD----GAPFRGRSKSAPPSLWAAKKYGQR
                                                                         

Q2PG01_BAD-01          LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2I3H4B2_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
Q6P7C5_BAD-01          LTSI----------------------------------------------
A0A3B1JLM2_BAD-01      LRRMSDEFDTWLDKGDLRRTTGPGR-------------------------
A0A452IFQ4_BAD-01      LRRMSDEFDVALQV--LPRPKSAGTTSQL---------------------
C1C3S9_BAD-01          LRRMSDEFDQIFTS--IPRPKSASAATEM---------------------
Q61337_BAD-05          LRRMSDEFEGSFKVSASVRCDGT---------------------------
A0A337SAW2_BAD-01      LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
A0A3B1IH05_BAD-01      LRKMSDEFDKGLEQG-MKRVRSAGAARQM---------------------
H3ANP3_BAD-01          LRRMSDEFDMSF-LG-LPRPKSAGAAGEM---------------------
H3ANP3_BAD-02          LRRMSDEFDMSF-LG-LPRPKSAGAAGEM---------------------
H3ANP3_BAD-03          LRRMSDEFDMSF-LG-LPRPKSAGAAGEM---------------------
A0A3B3QX41_BAD-01      LRRMSDEFDTLLDKG-MKRVRSAGAARQM---------------------
A0A2I3TBK7_BAD-01      LRPLPVTFAPHP-ET-PPVPTALGSHLEY---------------------
A0A2I2Z8C7_BAD-03      LRPLPVTFAAHP-ET-PPVPTALGSHLEY---------------------
A8MXU7_BAD-03          LRPLPVTFAPHP-ET-PPVPTALGSHLEY---------------------
A0A2K5M0A7_BAD-02      LRPLPVTFAPRP-ET-PPALTVLVGHLGY---------------------
A0A2K5XJR2_BAD-02      LRPLPVTFAPRP-ET-PPALTVLVGHLGY---------------------
A0A2K5VCA9_BAD-02      LRTLPVTFAPRP-ET-PPALTVLVGHLGY---------------------
A0A2K6E7I4_BAD-02      LRTLPVTFAPRP-ET-PPALTVLVGHLGY---------------------
A0A2K5HKU7_BAD-02      LEALGL-WRPGV-AT-APTPRGRRRTKGW---------------------
A0A2K6N196_BAD-02      LEALGL-WRPGV-AT-APTPRGRRRTKGW---------------------
A0A2K6PUL3_BAD-02      LEALGL-WRPGV-AT-APTPRGRRRTKGW---------------------
A0A2K5M0A7_BAD-03      LKALGL-WRPGV-AT-APTPRGRRRTKGW---------------------
A0A2K5VCA9_BAD-03      LKALGL-WRPGV-AT-APTPRGRRRTKGW---------------------
A0A096MLD5_BAD-02      LKALGL-WRRGV-AT-APTPRGRRRTKGW---------------------
A0A2K6E7I4_BAD-03      LKALGL-WRPAV-AT-APTPRGRRRTKGW---------------------
A8MXU7_BAD-04          LEALGL-WRSGV-AT-APTPRGRRTTKGW---------------------
A0A2I3TBK7_BAD-03      LEALGL-WRSGV-AT-APTPRGRRTTKGW---------------------
A0A2R8Z688_BAD-03      LEALGL-WRSGV-AT-APTPRGRRTTKGW---------------------
A0A2K5E6A6_BAD-03      LE-VPC-W---V-AT-APTPQGRRRTKGW---------------------
A0A2K5PDB1_BAD-03      LEALGL-WRPGV-AT-DRTPQGRRRTKGW---------------------
A0A2K6TG62_BAD-03      LEALEP-WRHGV-AT-ARTPQGRRGTKGW---------------------
G3VRY3_BAD-01          LRRMSDEFHCTF-KG-LPRPKSAGTASQM---------------------
G3VRY3_BAD-02          LRRMSDEFHCTF-KG-LPRPKSAGTASQM---------------------
G1P8C5_BAD-01          LRRMSDEFQGSFKKG-LPRPKSAGTATQM---------------------
A0A452ER54_BAD-02      LRRMSDEFHVSF-KG-LPRPKSAGTATQM---------------------
W5P8G9_BAD-01          LRRMSDEFHVSF-KG-LPRPKSAGTATQM---------------------
G3TP47_BAD-01          LRRMSDEFQGYF-KG-LPRPKSAGTATQM---------------------
A0A1U7Q4V0_BAD-01      LRRMSDEFEGSF-KG-LPRPKSAGTATQM---------------------
Q61337_BAD-01          LRRMSDEFEGSF-KG-LPRPKSAGTATQM---------------------
A0A287CT05_BAD-02      LRRMSDEFEGSF-K------------------------------------
A0A287CT05_BAD-01      LRRMSDEFEGSF-KG-LPRPRSAGTASQM---------------------
O35147_BAD-01          LRRMSDEFEGSF-KG-LPRPKSAGTATQM---------------------
A0A091DDU4_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATKL---------------------
A0A287AEF3_BAD-01      LRRMSDEFQGSFKKG-LPRPKSAGTATQM---------------------
G1MI17_BAD-01          LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
M3YNE7_BAD-01          LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
A0A452RJM6_BAD-01      LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
A0A384DJL2_BAD-01      LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
A0A452ER54_BAD-01      LRRMSDEFHVSF-KG-LPRPKSAGTATQM---------------------
F1MUT9_BAD-01          LRRMSDEFHVSF-KG-LPRPKSAGTATQM---------------------
Q3SYZ0_BAD-01          LRRMSDEFHVSF-KG-LPRPKSAGTATEM---------------------
F7DN67_BAD-01          LRRMSDEFQVSF-QA-LPRPKSAGTATQM---------------------
F1PK10_BAD-01          LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
Q45KI9_BAD-01          LRRMSDEFQGSF-KG-LPRPKSAGTATQM---------------------
H0WVR2_BAD-01          LRRMSDEFEDSFKKG-LPRPKSAGTATQM---------------------
A0A2K6GWV0_BAD-01      LRRMSDEFEDSFKKG-LPRPKSAGTATQI---------------------
H0V608_BAD-01          LRRMSDEFVDSF-KG-LPRPKSAGTATKL---------------------
A0A1S3FL84_BAD-01      LRRMSDEFDGSF-KG-LPRPKSAGTATQM---------------------
A0A2K5PDB1_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2K5E6A6_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2K6TG62_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A0D9R491_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2K5HKU7_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2K5XJR2_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2K6N196_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
A0A2K6PUL3_BAD-01      LRRMSDEFVDSF-KG-LPRPKSAGTATQM---------------------
B4DZQ9_BAD-01          LRRMSDEFVDSFKKG-LPRPKSAGTATQM---------------------
A0A096MLD5_BAD-01      LRRMSDEFVDSFKKG-LPRPKSAGTATQM---------------------
A0A2I2Z8C7_BAD-01      LRRMSDEFVDSFKKG-LPRPKSAGTATQM---------------------
A0A2I2Z8C7_BAD-02      LRRMSDEFVDSFKKG-LPRPKSAGTATQM---------------------
A0A2R8Z688_BAD-01      LRRMSDEFVDSFKKG-LPRPKSAGTATQM---------------------
A0A2J8TYJ3_BAD-01      LRRMSDEFVDSFKKG-LPRPKSAGTATQM---------------------
A0A3B4DUY7_BAD-01      LRRMSDEFDTWLDKGDTRRASSPGK-------------------------
E7FBJ6_BAD-01          LRRMSDEFDTWLDKGVSK----TPNSQK----------------------
B5XEF1_BAD-01          LRRMSDEFDTWLDKGVPKRGIIPRGGKQ----------------------
A0A3Q3FKT9_BAD-01      LRRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQPKSQEFNTQLL
A0A3B4CPH6_BAD-01      LRKMSDEFDTLLDKG-MKRVRSAGAARQM---------------------
A0A3P9A5G8_BAD-01      LRRMSDEFDTWLDKGEPKRGIIPGRAKQ----------------------
A0A3P9A5G8_BAD-02      LRRMSDEFDTWLDKGEPKRGIIPGRAKQ----------------------
B5X1T1_BAD-01          LRRMSDEFDTWLDKGEPKRGISPGGVKQE---------------------
A0A3Q2QC80_BAD-01      LRRMSDEFGSLLDKGELRKVSSAGTNRPI---------------------
A0A3Q3FKT9_BAD-03      LRRMSDEFDILLDKGEMKKVRSPGPAKQM---------------------
H3D8J8_BAD-01          LRRMSDEFDSLLDKGGMRKTSSAGSARQM---------------------
A0A3B5L9R9_BAD-01      LRRMSDEFVNLLDKGEMRNVSSDGSNRPI---------------------
A0A3P9B2E4_BAD-01      LRRMSDEFDSLLDKG-----------------------------------
I3K7B6_BAD-01          LRRMSDEFDSLLDKGEMK-------LKKL---------------------
A0A3Q3C680_BAD-01      LRRMSDEFDSLLDKGEMK-------VKKL---------------------
A0A3P8QRJ7_BAD-01      LRRMSDEFDSLLDKGEMK-------VKKL---------------------
A0A3Q4GGN3_BAD-01      LRRMSDEFDSLLDKGEMK-------LKKL---------------------
A0A3B4GXJ6_BAD-01      LRRMSDEFDSLLDKGEMK-------VKKL---------------------
A0A3Q0QNQ2_BAD-01      LRRMSDEFDSLLDKG-MKKAKNAGTTRKM---------------------
A0A3P8WI83_BAD-02      LRRMSDEFDSLLDKG-MRKVKSAGTARQM---------------------
A0A3P8WI83_BAD-01      LRRMSDEFDSLLDKG-MRKVKSAGTARQM---------------------
A0A3Q2D5S0_BAD-01      LRRMSDEFVTLLDKGELRKVSSTGTNRPI---------------------
A0A3P9HNZ2_BAD-01      LRRMSDEFDSLLDKGEMRKVRSTGAAKQM---------------------
A0A3B3BQF7_BAD-01      LRRMSDEFDSLLDKGEMRKVRSAGATKQM---------------------
A0A3Q1K1C7_BAD-02      LRRMSDEFDSLLDKGEMRKVRSAGTARQM---------------------
A0A3Q1K1C7_BAD-01      LRRMSDEFDSLLDKGEMRKVRSAGTARQM---------------------
A0A3Q1GWH9_BAD-01      LRRMSDEFDSLLDKGEMKRVRSAGTARQM---------------------
A0A3Q1CPU7_BAD-01      LRRMSDEFDSLLDKGEMKRVRSAGTARQM---------------------
A0A3P8TWH6_BAD-01      LRRMSDEFDSLLDKGEMKRVRSAGTARQM---------------------
A0A2U9BAC9_BAD-01      LRRMSDEFDSLLDKGEMRKVKSAGTARQM---------------------
A0A3B4VFC5_BAD-01      LRRMSDEFDSLLDKGEMRKVKSAGTAKQM---------------------
A0A3B4W9T1_BAD-01      LRRMSDEFDSLLDKGEMRKVKSAGTAKQM---------------------
Q4V925_BAD-03          LRRMSDEF----DKG-MKRVKSAGTARQM---------------------
Q4V925_BAD-02          LRRMSDEF----DKG-MKRVKSAGTARQM---------------------
A7MCM4_BAD-01          LRRMSDEF----DKGQMKRVKSAGTARQM---------------------
Q4V925_BAD-01          LRRMSDEF----DKGQMKRVKSAGTARQM---------------------
Q4V925_BAD-04          LRRMSDEF----DKGQMKRVKSAGTARQM---------------------
A0A3P8Y761_BAD-01      LRRMSDEFDTWLDKGQMKRVKSAGAAKQM---------------------
A0A3B5Q2N7_BAD-01      LRRMSDEFVNLLDKGEMRNVSSDGSNRPI---------------------
A0A087X8P8_BAD-01      LRRMSDEFVNLLDKGEMRKVSSTGSNRPI---------------------
A0A3B3UA11_BAD-01      LRRMSDEFVNLLDKGEMRKVSSTGSNRPI---------------------
A0A3B3YFR1_BAD-01      LRRMSDEFVNLLDKGEMRKVSSTGSNRPI---------------------
A0A3P9Q7C3_BAD-01      LRRMSDEFVNLLDKGEMRKVSSAGSNGPI---------------------
A0A3B3HDU2_BAD-01      LRRMSDEFDSLLDKGEMRKVRSTGAAKQM---------------------
A0A3P9KSL7_BAD-01      LRRMSDEFDSLLDKGEMRKVRSTGAAKQM---------------------
A0A3P9KSL7_BAD-02      LRRMSDEFDSLLDKGEMRKVRSTGAAKQM---------------------
A0A3B5BAL2_BAD-01      LRRMSDEFDSLLDKGEMKRVRSAGTAKQM---------------------
A0A3Q3AEL8_BAD-01      LRRMSDEFDSLLDKGEMRKVKSAGTTKQI---------------------
A0A3Q3AEL8_BAD-02      LRRMSDEFDSLLDKGEMRKVKSAGTTKQI---------------------
G3Q8B3_BAD-01          LRRMSDEFDSLLDKGEMRRVKSAGTTKQM---------------------
A0A3Q2Y0E4_BAD-01      LRRMSDEFDSLMDKGELKFKSAGGTSRAI---------------------
A0A3Q3R5S3_BAD-01      LRRMSDEFDSLLDKGEMKRVRSAGAASQM---------------------
A0A3Q3RXS8_BAD-01      LRRMSDEFDSLLDKGEMR-VRNAGKAQKM---------------------
A0A3Q3RXS8_BAD-02      LRRMSDEFDSLLDKGEMR-VRNAGKAQKM---------------------
A0A3Q0QNQ2_BAD-02      LRRMSDEFDSLLDKGMKK-AKNAGTTRKM---------------------
A0A3Q3WTY4_BAD-01      LRRMSDEF----DRQEWK-TRSAGTATQM---------------------
                       *  :                                              

Q2PG01_BAD-01          ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I3H4B2_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
Q6P7C5_BAD-01          -----------------IFLSHVP--------------------------
A0A3B1JLM2_BAD-01      ---------HTNRGWFSFLWGTKEEEGRE---------------------
A0A452IFQ4_BAD-01      ---------HRGNSWKETLQAWLGHRPARDALPRSSK-------------
C1C3S9_BAD-01          ---------TVSKSFGETFFNFFRRKNKDRSQSENDKH------------
Q61337_BAD-05          --------------------------------------------------
A0A337SAW2_BAD-01      ---------RQSPSWTRFIQSWWDRNLGRGGSAPSQ--------------
A0A3B1IH05_BAD-01      ---------QNSPSWFAFLWSHKESDSEASSSRPAE--------------
H3ANP3_BAD-01          ---------VDESWWKKLIRSLKGRGQPRDPPGQQGVSIRGPD-------
H3ANP3_BAD-02          ---------VDESWWKKLIRSLKGRGQPRDPPGQQGVSIRGPD-------
H3ANP3_BAD-03          ---------VDESWWKKLIRSLKGRGQPRDPPGQ----------------
A0A3B3QX41_BAD-01      ---------QASPSWFAFLWSHKESDAEISGSLSTADSRAAQ--------
A0A2I3TBK7_BAD-01      ---------GRKYFPQAYAK--------RGSVLSPLEGGLTPIPFRCV--
A0A2I2Z8C7_BAD-03      ---------GRKYFPQAYAK--------RGSVLSPLEGRLTQIPFRCV--
A8MXU7_BAD-03          ---------GRKYFPQAYAK--------RGSVLSPLEGGLTQIPFRCV--
A0A2K5M0A7_BAD-02      ---------GRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K5XJR2_BAD-02      ---------GRKCFPQASCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K5VCA9_BAD-02      ---------GRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K6E7I4_BAD-02      ---------GRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K5HKU7_BAD-02      ---------RRSPAPFGAARAPRPLTSGQHSDMAASSGG-----------
A0A2K6N196_BAD-02      ---------RRSPAPFGAARAPRPLTSGQHSDMAASSGG-----------
A0A2K6PUL3_BAD-02      ---------RRSPAPFGAARAPRPLTSGQHSDMAASSGG-----------
A0A2K5M0A7_BAD-03      ---------RRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2K5VCA9_BAD-03      ---------RRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A096MLD5_BAD-02      ---------RRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2K6E7I4_BAD-03      ---------RRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A8MXU7_BAD-04          ---------GRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
A0A2I3TBK7_BAD-03      ---------GRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
A0A2R8Z688_BAD-03      ---------GRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
A0A2K5E6A6_BAD-03      ---------RRSPAPFGAVRAQHPPTSGQHSAMAASSGG-----------
A0A2K5PDB1_BAD-03      ---------RRSPAPFGAVRARHPPTSGQHSAMAASSGG-----------
A0A2K6TG62_BAD-03      ---------RRSPALFGAVRARHPPTSGQHSDMAASSGG-----------
G3VRY3_BAD-01          ---------RRSHGWTRTFQSWFGRNLGKGSVGPSH--------------
G3VRY3_BAD-02          ---------RRSHGWTRTFQSWFGRNLGKGSVGPSH--------------
G1P8C5_BAD-01          ---------WQKSSWTRFFQSWWDRNSGRGGSAPSQ--------------
A0A452ER54_BAD-02      ---------RQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
W5P8G9_BAD-01          ---------RQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
G3TP47_BAD-01          ---------RQSPSWTRIIQAWWDRNLGRGSSAPSQ--------------
A0A1U7Q4V0_BAD-01      ---------RQSASWTRIIQSWWDRNLGKGGSTPSQ--------------
Q61337_BAD-01          ---------RQSAGWTRIIQSWWDRNLGKGGSTPSQ--------------
A0A287CT05_BAD-02      ---------------VTFSQSPFLRA------------------------
A0A287CT05_BAD-01      ---------RQSSSWTRFIQSWWDRNLGRRGSAPSQ--------------
O35147_BAD-01          ---------RQSASWTRIIQSWWDRNLGKGGSTPSQ--------------
A0A091DDU4_BAD-01      ---------WQSSSWTRAIQSWWDRNLGRGGSAPSQ--------------
A0A287AEF3_BAD-01      ---------RQSPSWKRFLQSWWYRNSGRGGPAPSQ--------------
G1MI17_BAD-01          ---------RQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
M3YNE7_BAD-01          ---------RQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A452RJM6_BAD-01      ---------RQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A384DJL2_BAD-01      ---------RQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A452ER54_BAD-01      ---------RQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
F1MUT9_BAD-01          ---------RQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
Q3SYZ0_BAD-01          ---------RQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
F7DN67_BAD-01          ---------RQSPSWTRAIQSWWDRNLGRGGSAPSQ--------------
F1PK10_BAD-01          ---------RQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
Q45KI9_BAD-01          ---------RQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
H0WVR2_BAD-01          ---------RQSSSWTRVIQSWWDRNVGRGGSAPCQ--------------
A0A2K6GWV0_BAD-01      ---------RQSSSWTRVIQSWWDRNVGRGGSAPSQ--------------
H0V608_BAD-01          ---------WQNSNWTRAIQSWWDRNLGRGGSAPSQESV-----------
A0A1S3FL84_BAD-01      ---------RQSSSWTRIFQSWWDRNLGRG-SAPSQ--------------
A0A2K5PDB1_BAD-01      ---------RQSASWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A2K5E6A6_BAD-01      ---------RQSSSWTQVIQSWWDRNLGRGGSAPSQ--------------
A0A2K6TG62_BAD-01      ---------RQSSSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A0D9R491_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5HKU7_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5XJR2_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K6N196_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K6PUL3_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
B4DZQ9_BAD-01          ---------RQSPRRLR---------------------------------
A0A096MLD5_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I2Z8C7_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I2Z8C7_BAD-02      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2R8Z688_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2J8TYJ3_BAD-01      ---------RQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A3B4DUY7_BAD-01      ---------QTNRGWFSFLWGSKEEEGR--------------E-------
E7FBJ6_BAD-01          ---------QTYRGWFSFLWSPKEEEGR--------------E-------
B5XEF1_BAD-01          ---------KVSRGWFSFLWSPKEAEGR--------------E-------
A0A3Q3FKT9_BAD-01      QPHVRCVLGSLNVYKWDYLILIITLHSSL---------------------
A0A3B4CPH6_BAD-01      ---------HASPSWFTFLWSHKESDSE-ASSSLTAPDTRPAE-------
A0A3P9A5G8_BAD-01      ---------VY-RGWFSFLWSPKEAEGR--------------D-------
A0A3P9A5G8_BAD-02      ---------VY-RGWFSFLWSPKEAEGR--------------D-------
B5X1T1_BAD-01          ---------VS-RGWFSFLWSPKKAEGR--------------E-------
A0A3Q2QC80_BAD-01      ---------HHSRSWWNYLFSHQETEGE---NSHHENHAPRTE-------
A0A3Q3FKT9_BAD-03      ---------HHSKSWWSYLFSHQETEGE---NNHHENHTHRNE-------
H3D8J8_BAD-01          ---------HHSRSWWSYLFSHQETESE---NNHHD--------------
A0A3B5L9R9_BAD-01      ---------HHSRSWWSYLFSHQETEGE---NNHHENHASRTE-------
A0A3P9B2E4_BAD-01      -------------------VRMGVSQGL---N------------------
I3K7B6_BAD-01          ---------HHSKTWWSYLFSHQETEGE---NNHLENHNQRTE-------
A0A3Q3C680_BAD-01      ---------HHSKTWWSYLFSHQETEGE---NNHLENHNQRTE-------
A0A3P8QRJ7_BAD-01      ---------HHSKTWWSYLFSHQETEGE---NNHLENHNQRTE-------
A0A3Q4GGN3_BAD-01      ---------HHSKTWWSYLFSHQETEGE---NNHLENHNQRTE-------
A0A3B4GXJ6_BAD-01      ---------HHSKTWWSYLFSHQETEGE---NNHLENHNQRTE-------
A0A3Q0QNQ2_BAD-01      ---------HHSKTWWSYLFSHQESDGE---NSHHENHTQRTE-------
A0A3P8WI83_BAD-02      ---------HHSKSWWSYLFSHQELEGE---NNHHENHTHRTE-------
A0A3P8WI83_BAD-01      ---------HHSKSWWSYLFSHQELEGE---NNHHENHTHRTE-------
A0A3Q2D5S0_BAD-01      ---------RHSKSWWSYLFSHQEMEGE---NSHHENHTQCTEQRGE---
A0A3P9HNZ2_BAD-01      ---------LHSTSWWNYLFSHPEAEGE---YSHHESQ--RTE-------
A0A3B3BQF7_BAD-01      ---------HHSTSWWNYLFSHPEAEGE---YSHHESH--RTE-------
A0A3Q1K1C7_BAD-02      ---------HHSKSWWSYLFSHQETEGE---NNHHESHTHRTE-------
A0A3Q1K1C7_BAD-01      ---------HHSKSWWSYLFSHQETEGE---NNHHESHTHRTE-------
A0A3Q1GWH9_BAD-01      ---------HHSKSWWSYLFSHQEMEGE---NNHHESHTHRNE-------
A0A3Q1CPU7_BAD-01      ---------HHSKSWWSYLFSHQEMEGE---NNHHESHTHRNE-------
A0A3P8TWH6_BAD-01      ---------HHSKSWWSYLFSHQEMEGE---NNHHESHTHRNE-------
A0A2U9BAC9_BAD-01      ---------HHSQSWWSYLFSHQEMEGE---NNHHENHTQRNE-------
A0A3B4VFC5_BAD-01      ---------HHSKSWWSYLFSHQETEGE---NNHHENHTHRTE-------
A0A3B4W9T1_BAD-01      ---------HHSKSWWSYLFSHQETEGE---NNHHENHTHRTE-------
Q4V925_BAD-03          ---------SQSPSWLAFLWSHKESDAE----------SRPAE-------
Q4V925_BAD-02          ---------SQSPSWLAFLWSHKESDAE----------SRPAE-------
A7MCM4_BAD-01          ---------SQSPSWLAFLWSHKESDAE----------SRPAE-------
Q4V925_BAD-01          ---------SQSPSWLAFLWSHKESDAE----------SRPAE-------
Q4V925_BAD-04          ---------SQSPSWLAFLWSHKESDAE----------SRPAE-------
A0A3P8Y761_BAD-01      ---------TTSPSWWAFLFSHKETETE-KTPNLIITEPRSSE-------
A0A3B5Q2N7_BAD-01      ---------HHSRSWWSYLFSHQETEGE---NNHHENHASRTE-------
A0A087X8P8_BAD-01      ---------HHSRSWWSYLFSHQETEGE---NNHHENHASRTE-------
A0A3B3UA11_BAD-01      ---------HHSRSWWSYLFSHQETEGE---NNHHENHASRTE-------
A0A3B3YFR1_BAD-01      ---------HHSRSWWSYLFSHQETEGE---NNHHENHASRTE-------
A0A3P9Q7C3_BAD-01      ---------HHSRSWWSYLFSHQETEGE---NNHHENHASRTE-------
A0A3B3HDU2_BAD-01      ---------LHSTSWWNYLFSHPEAEGE---YSHHESHRTE---------
A0A3P9KSL7_BAD-01      ---------LHSTSWWNYLFSHPEAEGE---YSHHESHRTENRDLLGWLR
A0A3P9KSL7_BAD-02      ---------LHSTSWWNYLFSHPEAEGE---YSHHESHRTENRDLLGWLR
A0A3B5BAL2_BAD-01      ---------HHSKSWWSYLFSHQELEGE---NNHHENHTHRNE-------
A0A3Q3AEL8_BAD-01      ---------HHSRSWWNYLFSHQETDGE---SSHHEKPTHRTE-------
A0A3Q3AEL8_BAD-02      ---------HHSRSWWNYLFSHQETDGE---SSHHEKPTHRTE-------
G3Q8B3_BAD-01          ---------QHSKSWWSSLFSHQEMEGE---NNHHE--------------
A0A3Q2Y0E4_BAD-01      ---------HHSKTWWSYLFSHQETEGENNNNNHHDNHANRTE-------
A0A3Q3R5S3_BAD-01      ---------HHSKSWWSYLFSHQETEGE---NTHHENAALAQEVERVVS-
A0A3Q3RXS8_BAD-01      ---------HHSKTWWSYLFSYQETDGE---NNLHENHTPRTE-------
A0A3Q3RXS8_BAD-02      ---------HHSKTWWSYLFSYQETDGE---NNLHENHTPRTE-------
A0A3Q0QNQ2_BAD-02      ---------HHSKTWWSYLFSHQESDGE---NSHHENHTQRTE-------
A0A3Q3WTY4_BAD-01      ---------HQSRSWWSYLFSHQETDGE---NNHHDSHTHRNE-------
                                                                         

Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A0A337SAW2_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
A8MXU7_BAD-03          --------------------------------------------------
A0A2K5M0A7_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2K5VCA9_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-02      --------------------------------------------------
A0A2K5HKU7_BAD-02      --------------------------------------------------
A0A2K6N196_BAD-02      --------------------------------------------------
A0A2K6PUL3_BAD-02      --------------------------------------------------
A0A2K5M0A7_BAD-03      --------------------------------------------------
A0A2K5VCA9_BAD-03      --------------------------------------------------
A0A096MLD5_BAD-02      --------------------------------------------------
A0A2K6E7I4_BAD-03      --------------------------------------------------
A8MXU7_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z688_BAD-03      --------------------------------------------------
A0A2K5E6A6_BAD-03      --------------------------------------------------
A0A2K5PDB1_BAD-03      --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G3VRY3_BAD-01          --------------------------------------------------
G3VRY3_BAD-02          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
A0A1U7Q4V0_BAD-01      --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
A0A287CT05_BAD-02      --------------------------------------------------
A0A287CT05_BAD-01      --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
A0A091DDU4_BAD-01      --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
F1PK10_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5PDB1_BAD-01      --------------------------------------------------
A0A2K5E6A6_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5HKU7_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2K6N196_BAD-01      --------------------------------------------------
A0A2K6PUL3_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A096MLD5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2R8Z688_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A3Q3FKT9_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3FKT9_BAD-03      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WI83_BAD-02      --------------------------------------------------
A0A3P8WI83_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3P9HNZ2_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3P9KSL7_BAD-01      CSSDITVSHVTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQARQNFLEP
A0A3P9KSL7_BAD-02      CSSDITVSHVTAGFQLPFTRNSLFQGWWFDLPVQDQRRQQLQR-------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
                                                                         

Q2PG01_BAD-01          ----
A0A2I3H4B2_BAD-01      ----
Q6P7C5_BAD-01          ----
A0A3B1JLM2_BAD-01      ----
A0A452IFQ4_BAD-01      ----
C1C3S9_BAD-01          ----
Q61337_BAD-05          ----
A0A337SAW2_BAD-01      ----
A0A3B1IH05_BAD-01      ----
H3ANP3_BAD-01          ----
H3ANP3_BAD-02          ----
H3ANP3_BAD-03          ----
A0A3B3QX41_BAD-01      ----
A0A2I3TBK7_BAD-01      ----
A0A2I2Z8C7_BAD-03      ----
A8MXU7_BAD-03          ----
A0A2K5M0A7_BAD-02      ----
A0A2K5XJR2_BAD-02      ----
A0A2K5VCA9_BAD-02      ----
A0A2K6E7I4_BAD-02      ----
A0A2K5HKU7_BAD-02      ----
A0A2K6N196_BAD-02      ----
A0A2K6PUL3_BAD-02      ----
A0A2K5M0A7_BAD-03      ----
A0A2K5VCA9_BAD-03      ----
A0A096MLD5_BAD-02      ----
A0A2K6E7I4_BAD-03      ----
A8MXU7_BAD-04          ----
A0A2I3TBK7_BAD-03      ----
A0A2R8Z688_BAD-03      ----
A0A2K5E6A6_BAD-03      ----
A0A2K5PDB1_BAD-03      ----
A0A2K6TG62_BAD-03      ----
G3VRY3_BAD-01          ----
G3VRY3_BAD-02          ----
G1P8C5_BAD-01          ----
A0A452ER54_BAD-02      ----
W5P8G9_BAD-01          ----
G3TP47_BAD-01          ----
A0A1U7Q4V0_BAD-01      ----
Q61337_BAD-01          ----
A0A287CT05_BAD-02      ----
A0A287CT05_BAD-01      ----
O35147_BAD-01          ----
A0A091DDU4_BAD-01      ----
A0A287AEF3_BAD-01      ----
G1MI17_BAD-01          ----
M3YNE7_BAD-01          ----
A0A452RJM6_BAD-01      ----
A0A384DJL2_BAD-01      ----
A0A452ER54_BAD-01      ----
F1MUT9_BAD-01          ----
Q3SYZ0_BAD-01          ----
F7DN67_BAD-01          ----
F1PK10_BAD-01          ----
Q45KI9_BAD-01          ----
H0WVR2_BAD-01          ----
A0A2K6GWV0_BAD-01      ----
H0V608_BAD-01          ----
A0A1S3FL84_BAD-01      ----
A0A2K5PDB1_BAD-01      ----
A0A2K5E6A6_BAD-01      ----
A0A2K6TG62_BAD-01      ----
A0A0D9R491_BAD-01      ----
A0A2K5HKU7_BAD-01      ----
A0A2K5XJR2_BAD-01      ----
A0A2K6N196_BAD-01      ----
A0A2K6PUL3_BAD-01      ----
B4DZQ9_BAD-01          ----
A0A096MLD5_BAD-01      ----
A0A2I2Z8C7_BAD-01      ----
A0A2I2Z8C7_BAD-02      ----
A0A2R8Z688_BAD-01      ----
A0A2J8TYJ3_BAD-01      ----
A0A3B4DUY7_BAD-01      ----
E7FBJ6_BAD-01          ----
B5XEF1_BAD-01          ----
A0A3Q3FKT9_BAD-01      ----
A0A3B4CPH6_BAD-01      ----
A0A3P9A5G8_BAD-01      ----
A0A3P9A5G8_BAD-02      ----
B5X1T1_BAD-01          ----
A0A3Q2QC80_BAD-01      ----
A0A3Q3FKT9_BAD-03      ----
H3D8J8_BAD-01          ----
A0A3B5L9R9_BAD-01      ----
A0A3P9B2E4_BAD-01      ----
I3K7B6_BAD-01          ----
A0A3Q3C680_BAD-01      ----
A0A3P8QRJ7_BAD-01      ----
A0A3Q4GGN3_BAD-01      ----
A0A3B4GXJ6_BAD-01      ----
A0A3Q0QNQ2_BAD-01      ----
A0A3P8WI83_BAD-02      ----
A0A3P8WI83_BAD-01      ----
A0A3Q2D5S0_BAD-01      ----
A0A3P9HNZ2_BAD-01      ----
A0A3B3BQF7_BAD-01      ----
A0A3Q1K1C7_BAD-02      ----
A0A3Q1K1C7_BAD-01      ----
A0A3Q1GWH9_BAD-01      ----
A0A3Q1CPU7_BAD-01      ----
A0A3P8TWH6_BAD-01      ----
A0A2U9BAC9_BAD-01      ----
A0A3B4VFC5_BAD-01      ----
A0A3B4W9T1_BAD-01      ----
Q4V925_BAD-03          ----
Q4V925_BAD-02          ----
A7MCM4_BAD-01          ----
Q4V925_BAD-01          ----
Q4V925_BAD-04          ----
A0A3P8Y761_BAD-01      ----
A0A3B5Q2N7_BAD-01      ----
A0A087X8P8_BAD-01      ----
A0A3B3UA11_BAD-01      ----
A0A3B3YFR1_BAD-01      ----
A0A3P9Q7C3_BAD-01      ----
A0A3B3HDU2_BAD-01      ----
A0A3P9KSL7_BAD-01      SIRT
A0A3P9KSL7_BAD-02      ----
A0A3B5BAL2_BAD-01      ----
A0A3Q3AEL8_BAD-01      ----
A0A3Q3AEL8_BAD-02      ----
G3Q8B3_BAD-01          ----
A0A3Q2Y0E4_BAD-01      ----
A0A3Q3R5S3_BAD-01      ----
A0A3Q3RXS8_BAD-01      ----
A0A3Q3RXS8_BAD-02      ----
A0A3Q0QNQ2_BAD-02      ----
A0A3Q3WTY4_BAD-01      ----
                           

© 1998-2020Legal notice