Dataset for protein classical BH3-containing proteins of organism Xenopus tropicalis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *:  :  .     :  .                         .*      : .: :    ..: .
---------dssqssVfypdefsyegqtltst-------------srqhvrrpvrrssPtsrs--yqgkqsrtrgsssss
meqesylnmmelppd lslecngnpegqmqlstvfnqsqsyvdpprgfgshqlshkgg sllrspfpdnetqlltepaie
       ma akdda     dg d g p        ftcll  a lfp lacca gc gad e  a deg    a 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .    . :                                                        
t----------p----srsppcsvvrt---------gy--------p---------------------------n-----
sswtptvspys-sssvnimlhsmmsegssrvsytss--lsylvsps-vsfgksvqtpsppcqafnhllsamadr-rvqqq
qpegdkigelh frfrd  a  glia pqllfkgha  flfepqng arcdeetd                    prnem

       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
    . ..:*. :.*:*             * *  .            :  *::                  
s-e-wiareLrrigDqFnrsf--------nLpRpqsnsqviwstvlrfirrLimrl---r------------
-p-lrygqk qcms e hkf-tprrgifnh q llqarnqgqmrinisfin vlhpvsr-kslgrresgdee
 a hk          d ea  s       g    kd daafilqg     d   g fgn agkaqd      
© 1998-2021Legal notice