Dataset for protein classical BH3-containing proteins of organism Xenopus tropicalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8PXS6_BAD-01      MADSSPSAVFKLEEFDNEEQGLPLPFVDPPRGAGVRQPVAKSSPSLRRYP
Q4KMV9_BCL2L11-01      ------MDVFK-KGFSMAKEGVVAAAEKTKQGVTEAAEKTKEGVMYVGAK
                               *** : *.  ::*:  .  .. .*.      :*..       

A0A6I8PXS6_BAD-01      GKESRLRTESASESSETDK--------VGELHPFRSRSRSAPSSMIATKY
Q4KMV9_BCL2L11-01      TKEGVVHSVSTVAEKTKEQANVVGGAVVSGVNQVASKTVEGTENIVGTTG
                        **. :.: *:  .. .::        *. :: . *.: .....::.*. 

A0A6I8PXS6_BAD-01      GRELRRMSDEFEKSFTGLPRPKSASAAGQMTGNRSIRDLIMGLFSRRKSK
Q4KMV9_BCL2L11-01      LVKKEDLHPGQPEEPAGEEEPAVEA-----------------------TE
                         :   :     :. :*   *   :                       ::

A0A6I8PXS6_BAD-01      GRDESGDEE-
Q4KMV9_BCL2L11-01      STEQVGDGEN
                       . :: ** * 

© 1998-2020Legal notice