Dataset for protein classical BH3-containing proteins of organism Xenopus tropicalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8PXS6_BAD-01      -------MADSSPSAVFKLEEFDNEEQGLPLP--------FVDPPRGAGV
F6TGJ4_BMF-01          MEQESYLNMDELDDDVFYPDEFGYPDQTMTSSTVFNQSQSYTCLLSRFHL
Q4KMV9_BCL2L11-01      ---------MAKQPSVLSPDCNSGEGGQLQST-------------SRQHS
                                      *:  :  .     :  .                  

A0A6I8PXS6_BAD-01      RQPVAKSSPSLRR--YPGKESRLRTESASESSETDKVGELHPFRSRSRSA
F6TGJ4_BMF-01          FPLSHCCGPGCRGADYEDKATQTLGSPSISQ---------------DIML
Q4KMV9_BCL2L11-01      HRPLRRGAPTSLSSPFQGNQSDEGGSSSASTPWGPTISPYSPSSFVNRSP
                              .*      : .: :    ..: .                .   

A0A6I8PXS6_BAD-01      PSSMIAT-------------------------------------------
F6TGJ4_BMF-01          PCGVSETPQRLFYGHAGYLLYLPQNSPARFGEEVD---------------
Q4KMV9_BCL2L11-01      HCMLVRGSSLVSKTSSGYFSFEVSPGPVSCDKSTQTPSPPCQAFNHLLSA
                        . :                                              

A0A6I8PXS6_BAD-01      --------------KYGRELRRMSDEFEKSFT-------GLPRPKSASAA
F6TGJ4_BMF-01          ----NRRQEQSAEHRIARKLQCIGDQFHRF---------HLQRLQQNRNQ
Q4KMV9_BCL2L11-01      MADRNPVNQMSPELWIAQELRRIGDDFNASFSPRRGIFNNLPRPLDNDQV
                                     . ..:*. :.*:*             * *  .    

A0A6I8PXS6_BAD-01      GQMTGNRSIRDLIMGLFSRRKSKGRDESGDEE
F6TGJ4_BMF-01          FWSQILIFFRNLVMHPVGNRAGLAQR------
Q4KMV9_BCL2L11-01      IILRVLRFIIRLILRL----------------
                               :  *::                  

© 1998-2021Legal notice